PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::A6ZKI3 to PF16297 (DUF4939)

SwissProt::A6ZKI3 has 113 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.9e-67  210.5   0.0    2.1e-67  210.4   0.0    1.0  1  SwissProt::A6ZKI3  


Domain annotation for each sequence (and alignments):
>> SwissProt::A6ZKI3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  210.4   0.0   2.1e-67   2.1e-67       1     112 []       2     113 .]       2     113 .] 0.99

  Alignments for each domain:
  == domain 1  score: 210.4 bits;  conditional E-value: 2.1e-67
            DUF4939   1 dgrkqlikallalprlrqkrrwrnpipfpetfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllnd 92 
                        dgr+qlikallalp ++++rrwrnpipfpetfdGdtdrlpefivqt+sym+vde+tfssdalkvtflitrltG+al+wv+pyikk+spllnd
  SwissProt::A6ZKI3   2 DGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSYMFVDENTFSSDALKVTFLITRLTGPALQWVIPYIKKESPLLND 93 
                        789***************************************************************************************** PP

            DUF4939  93 yraflaemkrvfGweededf 112
                        yr+flaemkrvfGweededf
  SwissProt::A6ZKI3  94 YRGFLAEMKRVFGWEEDEDF 113
                        *******************8 PP



Or compare SwissProt::A6ZKI3 to CDD or PaperBLAST