PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q17RB0 to PF16297 (DUF4939)

SwissProt::Q17RB0 has 113 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    9.7e-67  208.2   0.0    1.1e-66  208.1   0.0    1.0  1  SwissProt::Q17RB0  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q17RB0  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  208.1   0.0   1.1e-66   1.1e-66       2     112 .]       3     113 .]       2     113 .] 0.99

  Alignments for each domain:
  == domain 1  score: 208.1 bits;  conditional E-value: 1.1e-66
            DUF4939   2 grkqlikallalprlrqkrrwrnpipfpetfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllndy 93 
                        gr+ql+kalla+p++++ rrwrnpipfpetfdGdtdrlpefivqt sym+vde+tfs+dalkvtflitrltG+al+wv+pyikk+spll+dy
  SwissProt::Q17RB0   3 GRVQLMKALLARPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIKKESPLLSDY 94 
                        799***************************************************************************************** PP

            DUF4939  94 raflaemkrvfGweededf 112
                        r+flaemkrvfGweededf
  SwissProt::Q17RB0  95 RGFLAEMKRVFGWEEDEDF 113
                        ******************8 PP



Or compare SwissProt::Q17RB0 to CDD or PaperBLAST