PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q505G4 to PF16297 (DUF4939)

SwissProt::Q505G4 has 243 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.3e-26   77.7   0.0    5.6e-26   76.9   0.0    1.3  1  SwissProt::Q505G4  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q505G4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   76.9   0.0   5.6e-26   5.6e-26      22     104 ..      95     177 ..      78     180 .. 0.93

  Alignments for each domain:
  == domain 1  score: 76.9 bits;  conditional E-value: 5.6e-26
            DUF4939  22 wrnpipfpetfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllndyraflaemkrvf 104
                           p   pe f+Gd ++l  f++q+  +m+ +   f  +a +v+fl++rltGea++w++p+++ dspl n+y++flae++r++
  SwissProt::Q505G4  95 TTPPTSLPEPFSGDPGQLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLRNNYQGFLAELRRTY 177
                        4568899************************************************************************9986 PP



Or compare SwissProt::Q505G4 to CDD or PaperBLAST