SwissProt::Q5DTT4 has 599 amino acids
Query: DUF4939 [M=112] Accession: PF16297.9 Description: Domain of unknown function (DUF4939) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-16 45.3 0.0 1.2e-15 43.7 0.0 1.9 1 SwissProt::Q5DTT4 Domain annotation for each sequence (and alignments): >> SwissProt::Q5DTT4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.7 0.0 1.2e-15 1.2e-15 29 103 .. 160 234 .. 141 237 .. 0.94 Alignments for each domain: == domain 1 score: 43.7 bits; conditional E-value: 1.2e-15 DUF4939 29 elfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeef 103 e f+G+ l ef++q +++ +e++f a +vafli+ ++G+a +w++ q+ s l n+ fl+e+++ef SwissProt::Q5DTT4 160 EPFSGDPVYLAEFLMQLETFIADHEDHFPGGAERVAFLISFFTGEARDWAISVTQEGSSLHANFPRFLDEIRKEF 234 67**********************************************************************999 PP
Or compare SwissProt::Q5DTT4 to CDD or PaperBLAST