SwissProt::Q5DTT4 has 599 amino acids
Query: DUF4939 [M=112]
Accession: PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.6e-16 45.3 0.0 1.2e-15 43.7 0.0 1.9 1 SwissProt::Q5DTT4
Domain annotation for each sequence (and alignments):
>> SwissProt::Q5DTT4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 43.7 0.0 1.2e-15 1.2e-15 29 103 .. 160 234 .. 141 237 .. 0.94
Alignments for each domain:
== domain 1 score: 43.7 bits; conditional E-value: 1.2e-15
DUF4939 29 elfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeef 103
e f+G+ l ef++q +++ +e++f a +vafli+ ++G+a +w++ q+ s l n+ fl+e+++ef
SwissProt::Q5DTT4 160 EPFSGDPVYLAEFLMQLETFIADHEDHFPGGAERVAFLISFFTGEARDWAISVTQEGSSLHANFPRFLDEIRKEF 234
67**********************************************************************999 PP
Or compare SwissProt::Q5DTT4 to CDD or PaperBLAST