PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q5DTT4 to PF16297 (DUF4939)

SwissProt::Q5DTT4 has 599 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.3e-16   45.4   0.0    8.4e-16   44.1   0.0    1.6  1  SwissProt::Q5DTT4  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q5DTT4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   44.1   0.0   8.4e-16   8.4e-16      30     104 ..     160     234 ..     146     237 .. 0.95

  Alignments for each domain:
  == domain 1  score: 44.1 bits;  conditional E-value: 8.4e-16
            DUF4939  30 etfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllndyraflaemkrvf 104
                        e f+Gd   l ef++q  +++  +e++f   a +v+fli+ +tGea +w++   ++ s l  ++  fl+e++++f
  SwissProt::Q5DTT4 160 EPFSGDPVYLAEFLMQLETFIADHEDHFPGGAERVAFLISFFTGEARDWAISVTQEGSSLHANFPRFLDEIRKEF 234
                        67**********************************************************************999 PP



Or compare SwissProt::Q5DTT4 to CDD or PaperBLAST