PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q5HYW3 to PF16297 (DUF4939)

SwissProt::Q5HYW3 has 569 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.2e-17   48.7   0.0    2.4e-16   45.9   0.0    2.4  2  SwissProt::Q5HYW3  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q5HYW3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   45.9   0.0   2.4e-16   2.4e-16      29     104 ..     153     228 ..     136     231 .. 0.91
   2 ?   -1.1   0.0     0.093     0.093       6      30 ..     297     321 ..     293     324 .. 0.82

  Alignments for each domain:
  == domain 1  score: 45.9 bits;  conditional E-value: 2.4e-16
            DUF4939  29 petfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllndyraflaemkrvf 104
                         e f+Gd   l ef++q  +++  +e +f   a +v+fli+ +tGea++w++   ++ spl  ++  fl+e++++f
  SwissProt::Q5HYW3 153 IEPFSGDPVYLAEFLMQLETFIADHEVHFPGGAERVAFLISFFTGEAKDWAISVTQEGSPLHANFPRFLDEIRKEF 228
                        357**********************************************************************999 PP

  == domain 2  score: -1.1 bits;  conditional E-value: 0.093
            DUF4939   6 likallalprlrqkrrwrnpipfpe 30 
                        l  ++l+  + ++k r   pip p 
  SwissProt::Q5HYW3 297 LDELILECVEIERKVRVPKPIPLPG 321
                        6678889999999999999***995 PP



Or compare SwissProt::Q5HYW3 to CDD or PaperBLAST