PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q7TN75 to PF16297 (DUF4939)

SwissProt::Q7TN75 has 958 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    8.3e-18   50.6   0.0    1.9e-17   49.4   0.0    1.6  1  SwissProt::Q7TN75  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q7TN75  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   49.4   0.0   1.9e-17   1.9e-17      28     104 ..     137     213 ..     130     220 .. 0.96

  Alignments for each domain:
  == domain 1  score: 49.4 bits;  conditional E-value: 1.9e-17
            DUF4939  28 fpetfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllndyraflaemkrvf 104
                         pe+fdG+ d l  f+ q   +m    + fs d ++v f+ + l G+a +w+   +++ ++l+ +y+af+ e+k+vf
  SwissProt::Q7TN75 137 LPEKFDGNPDMLGPFMYQCQLFMEKSTRDFSVDRIRVCFVTSMLIGRAARWATAKLQRCTYLMHNYTAFMMELKHVF 213
                        69**************************************************************************9 PP



Or compare SwissProt::Q7TN75 to CDD or PaperBLAST