SwissProt::Q8N8U3 has 475 amino acids
Query: DUF4939 [M=112] Accession: PF16297.9 Description: Domain of unknown function (DUF4939) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-17 50.1 0.0 2.5e-17 49.1 0.0 1.5 1 SwissProt::Q8N8U3 Domain annotation for each sequence (and alignments): >> SwissProt::Q8N8U3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.1 0.0 2.5e-17 2.5e-17 22 104 .. 235 317 .. 219 325 .. 0.91 Alignments for each domain: == domain 1 score: 49.1 bits; conditional E-value: 2.5e-17 DUF4939 22 rnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeefG 104 p+ + +f+G+s++lpef+vq sym v + + ++a v f+ ++Gra w ++ +spll++ ++f+ ++++f SwissProt::Q8N8U3 235 DFPLQYTLTFSGDSQKLPEFLVQLYSYMRVRGHLYPTEAALVSFVGNCFSGRAGWWFQLLLDIQSPLLEQCESFIPVLQDTFD 317 57999**********************************************************************99999886 PP
Or compare SwissProt::Q8N8U3 to CDD or PaperBLAST