PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8N8U3 to PF16297 (DUF4939)

SwissProt::Q8N8U3 has 475 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.2e-17   50.1   0.0    2.5e-17   49.1   0.0    1.5  1  SwissProt::Q8N8U3  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8N8U3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   49.1   0.0   2.5e-17   2.5e-17      22     104 ..     235     317 ..     219     325 .. 0.91

  Alignments for each domain:
  == domain 1  score: 49.1 bits;  conditional E-value: 2.5e-17
            DUF4939  22 rnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeefG 104
                          p+ +  +f+G+s++lpef+vq  sym v  + + ++a  v f+   ++Gra  w    ++ +spll++ ++f+  ++++f 
  SwissProt::Q8N8U3 235 DFPLQYTLTFSGDSQKLPEFLVQLYSYMRVRGHLYPTEAALVSFVGNCFSGRAGWWFQLLLDIQSPLLEQCESFIPVLQDTFD 317
                        57999**********************************************************************99999886 PP



Or compare SwissProt::Q8N8U3 to CDD or PaperBLAST