PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9BWD3 to PF16297 (DUF4939)

SwissProt::Q9BWD3 has 113 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      6e-67  208.9   0.0    6.7e-67  208.7   0.0    1.0  1  SwissProt::Q9BWD3  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9BWD3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  208.7   0.0   6.7e-67   6.7e-67       1     112 []       2     113 .]       2     113 .] 0.99

  Alignments for each domain:
  == domain 1  score: 208.7 bits;  conditional E-value: 6.7e-67
            DUF4939   1 dgrkqlikallalprlrqkrrwrnpipfpetfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllnd 92 
                        dgr+ql+kalla p++++ rrwrnpipfpetfdGdtdrlpefivqt sym+vde+tfs+dalkvtflitrltG+al+wv+pyi+k+spllnd
  SwissProt::Q9BWD3   2 DGRVQLMKALLAGPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIRKESPLLND 93 
                        789***************************************************************************************** PP

            DUF4939  93 yraflaemkrvfGweededf 112
                        yr+flaemkrvfGweededf
  SwissProt::Q9BWD3  94 YRGFLAEMKRVFGWEEDEDF 113
                        *******************8 PP



Or compare SwissProt::Q9BWD3 to CDD or PaperBLAST