XP_014957540.2 has 1333 amino acids
Query: DUF4939 [M=112]
Accession: PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.5e-19 53.8 0.0 1.9e-18 52.7 0.0 1.5 1 XP_014957540.2
Domain annotation for each sequence (and alignments):
>> XP_014957540.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.7 0.0 1.9e-18 1.9e-18 21 105 .. 183 267 .. 168 271 .. 0.92
Alignments for each domain:
== domain 1 score: 52.7 bits; conditional E-value: 1.9e-18
DUF4939 21 wrnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeefGw 105
+ +p p++f+G+ efiv + + f++d+l+v ++i++l+G a+ew+ ++k+s +++++ afl+ m ++f +
XP_014957540.2 183 NKGQLPTPKQFSGDRREYHEFIVLCQLILQSYPRVFCNDRLRVGYVISHLSGMAMEWASDLVEKESSMIDDFPAFLEAMNDTFEY 267
56679*******************999999999************************************************9977 PP
Or compare XP_014957540.2 to CDD or PaperBLAST