PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS354178 to PF16332 (DUF4962)

VIMSS354178 has 872 amino acids

Query:       DUF4962  [M=476]
Accession:   PF16332.5
Description: Domain of unknown function (DUF4962)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   6.9e-237  772.5   8.3   9.2e-237  772.1   8.3    1.1  1  VIMSS354178  


Domain annotation for each sequence (and alignments):
>> VIMSS354178  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  772.1   8.3  9.2e-237  9.2e-237       1     476 []      31     503 ..      31     503 .. 1.00

  Alignments for each domain:
  == domain 1  score: 772.1 bits;  conditional E-value: 9.2e-237
      DUF4962   1 etlmhevretpyPlngatvktnavallWPdkvnslgavldgveeekkkvekkkvaYkvrlsqdkefkkevikaeqeWavynpekklkkGkWyWqyayv 98 
                  +tlmhevretp+Pl+g++++ n+++++WPdk+++lg+vldgveee   ++k++v+Y++r+++d+efk+ev++ae++Wa++np+k ++kGkWyWq+ay+
  VIMSS354178  31 QTLMHEVRETPSPLGGQHIAVNPPRFMWPDKFPHLGPVLDGVEEE---DHKPEVTYRIRIARDPEFKSEVMTAERNWAFFNPFKLFEKGKWYWQHAYL 125
                  69*****************************************99...99************************************************ PP

      DUF4962  99 kkdgkeewsevyqfevedkaaklkpPslkevlaklkkeHPrvlllkkewedfikknkdnpeakaylekaekllkkplkklereidttgvkklknevqk 196
                  +kdgkeews+vy+f+v++++++++pPsl+evlak++++HPr+ll++k+w+++i++nk+npea+ y++ka+k+l++plk+le+eidtt+v kl+n+vq 
  VIMSS354178 126 DKDGKEEWSPVYHFYVDEQTRTFNPPSLQEVLAKFSQSHPRILLDAKDWDQIIERNKNNPEAQLYIQKARKCLNHPLKHLEEEIDTTQVVKLTNIVQY 223
                  ************************************************************************************************** PP

      DUF4962 197 kslltresrkivdkeeanvealvraylLtkDkkyakeaikrllellswdkskavkgDFnaatllsllalaYDsfYdllseeekkllkkaikergkkiy 294
                  +s+l+resrkivd+eean+ea+vraylLtkD+ y+ke+ikrl+e+lsw++sk+++gDFn++t+ls++++aYD++Y+ll+++ek+ll+++i+e+++k+y
  VIMSS354178 224 RSALIRESRKIVDREEANIEAMVRAYLLTKDEVYYKEGIKRLSEILSWKDSKYFAGDFNRSTILSMSTSAYDAWYNLLTPAEKQLLLETISENAHKFY 321
                  ************************************************************************************************** PP

      DUF4962 295 eefvnrlenhiadnHvWqmtlRiltlaalavvgelpeAdkWldyvYevWlaRfPgLnkDGgWHngdsYfkvnlrtlievpalysklsGvdfFsdpWyq 392
                  +e+vn+len+iadnHvWqmt+Ril++aa+a++gelp+A++W+dy+Y++W++R+PgLn+DGgWHngdsYf+vnlrtlievpa+ys++sG+dfF+dpWy+
  VIMSS354178 322 HEYVNHLENRIADNHVWQMTFRILNMAAFATYGELPMASTWVDYCYNEWVSRLPGLNTDGGWHNGDSYFHVNLRTLIEVPAFYSRISGFDFFADPWYN 419
                  ************************************************************************************************** PP

      DUF4962 393 nnalyvlyqqppfsksggnGdshenllkpnkkrvgyadALarkvnnpyaaayvkeilkkepdilkkallakpddlawfRlltek 476
                  nnalyv+y+qppfsks+g+G+she+++kpn++rvgyadALar++nnp+aaay+++il+kepdi+kk++l+k++dl+w+R++t+k
  VIMSS354178 420 NNALYVIYHQPPFSKSAGHGNSHETKMKPNGTRVGYADALARECNNPWAAAYARTILEKEPDIMKKSFLGKAGDLTWYRCITDK 503
                  *********************************************************************************997 PP



Or compare VIMSS354178 to CDD or PaperBLAST