VIMSS303193 has 813 amino acids
Query: Rv2179c-like [M=177] Accession: PF16473.9 Description: 3'-5' exoribonuclease Rv2179c-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-72 227.4 0.0 2e-71 225.4 0.0 2.0 2 VIMSS303193 Domain annotation for each sequence (and alignments): >> VIMSS303193 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.0 0.11 0.11 84 121 .. 191 223 .. 174 269 .. 0.73 2 ! 225.4 0.0 2e-71 2e-71 2 177 .] 632 803 .. 631 803 .. 0.98 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.11 Rv2179c-like 84 lkeleefieenedakslkvwgngasfDnviLraafela 121 +++l++ + +++ kv+ n + D+ +++a fe+ VIMSS303193 191 IRDLHKLV-----RDTDKVFPNPGNSDLGLITAFFEAY 223 57788888.....5888999999999**9999999983 PP == domain 2 score: 225.4 bits; conditional E-value: 2e-71 Rv2179c-like 2 hlmiDiEtlgneetaaivsIGavffdpetGelGeeFyarvdlesseeagaevdaeTikWWlkqssearaellkddaksledalkeleefieenedak 98 hlmiD+Et+g++++a+i+sIGa+ffdp+tG++G eF +++dle + g+ +d +TikWWlkqs ea++++++d+ ++l+dal +l+efi en+ + VIMSS303193 632 HLMIDLETMGKNPDAPIISIGAIFFDPQTGDMGPEFSKTIDLETA---GGVIDRDTIKWWLKQSREAQSAIMTDE-IPLDDALLQLREFIDENSGEF 724 9*****************************************655...99**********************998.99******************* PP Rv2179c-like 99 slkvwgngasfDnviLraafelagleipwkfwndrdvrTlvelakelglekkrdipfegvkhnAlddAkhqakivsaiw 177 ++vwgnga+fDn+iLr+++e+ g+++pw+++ndrdvrT+vel+k+++++++ +ipfeg++hnAlddA++qak+vs+iw VIMSS303193 725 FVQVWGNGANFDNTILRRSYERQGIPCPWRYYNDRDVRTIVELGKAIDFDARTAIPFEGERHNALDDARYQAKYVSVIW 803 ******************************************************************************9 PP
Or compare VIMSS303193 to CDD or PaperBLAST