PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS41499 to PF16473 (DUF5051)

VIMSS41499 has 197 amino acids

Query:       DUF5051  [M=166]
Accession:   PF16473.5
Description: 3' exoribonuclease, RNase T-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    4.9e-12   32.3   0.0    5.7e-12   32.1   0.0    1.1  1  VIMSS41499  


Domain annotation for each sequence (and alignments):
>> VIMSS41499  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.1   0.0   5.7e-12   5.7e-12       3     131 ..      24     150 ..      22     191 .. 0.73

  Alignments for each domain:
  == domain 1  score: 32.1 bits;  conditional E-value: 5.7e-12
     DUF5051   3 lmiDiEtlgne.etaelvsIGaVff.....petG..eFyaeidlesdeeagidaetieWWlkqskearaellkdtqeakslkdalqaleeFlekslkvw 93 
                 ++ D+Et+g   ++a++v+IGaV +     +     +F++ + ++     g +   i W  +  + +  e+++    a+ +kd+l ++++F+ +   v+
  VIMSS41499  24 VVFDLETTGFSpASAAIVEIGAVRIvggqiD--EtlKFETLVRPTRP--DG-SLLSIPWQAQRVHGISDEMVRR---APAIKDVLPDFFDFV-DGSAVV 113
                 568*******999**********88766422..25689998888333..23.4456666666666666677644...69*************.6899** PP

     DUF5051  94 angasfDlviLraafellipwkywndrdvrtlvalape 131
                 a++ sfD   +ra  e+l   ++  +r + t++ ++++
  VIMSS41499 114 AHNVSFDGGFMRAGAERL-GLSWAPERELCTMQLSRRA 150
                 *************99985.4456667777777766643 PP



Or compare VIMSS41499 to CDD or PaperBLAST