PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS92972 to PF16473 (DUF5051)

VIMSS92972 has 145 amino acids

Query:       DUF5051  [M=166]
Accession:   PF16473.5
Description: 3' exoribonuclease, RNase T-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      2e-42  131.2   0.2    2.4e-42  130.9   0.2    1.0  1  VIMSS92972  


Domain annotation for each sequence (and alignments):
>> VIMSS92972  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  130.9   0.2   2.4e-42   2.4e-42      45     166 .]      10     135 ..       2     135 .. 0.92

  Alignments for each domain:
  == domain 1  score: 130.9 bits;  conditional E-value: 2.4e-42
     DUF5051  45 g.idaetieWWlkqskearaellkdtqeakslkdalqaleeFl.....ekslkvwangasfDlviLraafel...lipwkywndrdvrtlvalapelek 134
                 + +  +ti+WWlkqs+ea++++++d+    +l+dal++l+eF+     e  ++vw+nga+fD++iLr  +e+    +pw+y+ndrdvrt+v+l+++ + 
  VIMSS92972  10 KhTARDTIKWWLKQSREAQSAIMTDE---IPLDDALLQLREFIdensgEFFVQVWGNGANFDNTILRRSYERqgiPCPWRYYNDRDVRTIVELGKA-ID 104
                 236679*****************877...99*************999977899*******************77669*****************88.99 PP

     DUF5051 135 geekkreipfegvkHnALaDAkhqakavsail 166
                 + +++ +ipfeg++HnAL+DA++qak+vs+i+
  VIMSS92972 105 F-DARTAIPFEGERHNALDDARYQAKYVSVIW 135
                 9.7****************************9 PP



Or compare VIMSS92972 to CDD or PaperBLAST