WP_000102132.1 has 812 amino acids
Query: Rv2179c-like [M=177] Accession: PF16473.9 Description: 3'-5' exoribonuclease Rv2179c-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-72 227.4 0.0 2e-71 225.4 0.0 2.0 2 WP_000102132.1 Domain annotation for each sequence (and alignments): >> WP_000102132.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.0 0.1 0.1 84 121 .. 191 228 .. 175 276 .. 0.70 2 ! 225.4 0.0 2e-71 2e-71 2 177 .] 631 802 .. 630 802 .. 0.98 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.1 Rv2179c-like 84 lkeleefieenedakslkvwgngasfDnviLraafel.....a 121 +++l++ + +++ kv+ n + D+ +++a fe+ WP_000102132.1 191 IRDLHKLV-----RDTDKVFPNPGNSDLGLITAFFEAyldadY 228 57777777.....588899999999999999999998444440 PP == domain 2 score: 225.4 bits; conditional E-value: 2e-71 Rv2179c-like 2 hlmiDiEtlgneetaaivsIGavffdpetGelGeeFyarvdlesseeagaevdaeTikWWlkqssearaellkddaksledalkeleefieened 96 hlmiD+Et+g++++a+i+sIGa+ffdp+tG++G eF +++dle + g+ +d +TikWWlkqs ea++++++d+ ++l+dal +l+efi en+ WP_000102132.1 631 HLMIDLETMGKNPDAPIISIGAIFFDPQTGDMGPEFSKTIDLETA---GGVIDRDTIKWWLKQSREAQSAIMTDE-IPLDDALLQLREFIDENSG 721 9*****************************************655...99**********************998.99***************** PP Rv2179c-like 97 akslkvwgngasfDnviLraafelagleipwkfwndrdvrTlvelakelglekkrdipfegvkhnAlddAkhqakivsaiw 177 + ++vwgnga+fDn+iLr+++e+ g+++pw+++ndrdvrT+vel+k+++++++ +ipfeg++hnAlddA++qak+vs+iw WP_000102132.1 722 EFFVQVWGNGANFDNTILRRSYERQGIPCPWRYYNDRDVRTIVELGKAIDFDARTAIPFEGERHNALDDARYQAKYVSVIW 802 ********************************************************************************9 PP
Or compare WP_000102132.1 to CDD or PaperBLAST