PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1937997 to PF18367 (Rv2175c_C)

VIMSS1937997 has 121 amino acids

Query:       Rv2175c_C  [M=56]
Accession:   PF18367.1
Description: Rv2175c C-terminal domain of unknown function
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.5e-32   97.8   0.1    2.6e-32   97.0   0.1    1.4  1  VIMSS1937997  


Domain annotation for each sequence (and alignments):
>> VIMSS1937997  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   97.0   0.1   2.6e-32   2.6e-32       1      56 []      65     120 ..      65     120 .. 0.99

  Alignments for each domain:
  == domain 1  score: 97.0 bits;  conditional E-value: 2.6e-32
     Rv2175c_C   1 VkgLpGtltvLrDgGfddeeilrWLFteDesLpgrPidALregrkrEVkRrAqAlA 56 
                   VkgL Gtlt+LrD+Gf+dee+l+WLFt+D+sLpg+P +AL e+r++EVkRrAqAlA
  VIMSS1937997  65 VKGLVGTLTLLRDDGFTDEEMLEWLFTPDPSLPGTPAQALSENRGTEVKRRAQALA 120
                   9*****************************************************98 PP



Or compare VIMSS1937997 to CDD or PaperBLAST