VIMSS1937997 has 121 amino acids
Query: Rv2175c_C [M=56]
Accession: PF18367.5
Description: Rv2175c C-terminal domain of unknown function
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.3e-33 98.8 0.0 1.2e-32 98.0 0.0 1.4 1 VIMSS1937997
Domain annotation for each sequence (and alignments):
>> VIMSS1937997
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 98.0 0.0 1.2e-32 1.2e-32 1 56 [] 65 120 .. 65 120 .. 0.99
Alignments for each domain:
== domain 1 score: 98.0 bits; conditional E-value: 1.2e-32
Rv2175c_C 1 VkgLpGtltvLrDgGfddeeilrWLFteDesLpgrPidALregrkrEVkRrAqalA 56
VkgL Gtlt+LrD+Gf+dee+l+WLFt+D+sLpg+P +AL e+r++EVkRrAqalA
VIMSS1937997 65 VKGLVGTLTLLRDDGFTDEEMLEWLFTPDPSLPGTPAQALSENRGTEVKRRAQALA 120
9******************************************************8 PP
Or compare VIMSS1937997 to CDD or PaperBLAST