PaperBLAST – Find papers about a protein or its homologs

 

Align P23326 to TIGR00001

P23326 has 159 amino acids

Query:       TIGR00001  [M=63]
Accession:   TIGR00001
Description: rpmI_bact: ribosomal protein L35
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.8e-29   88.1   5.6    1.8e-29   88.1   5.6    1.7  2  P23326    


Domain annotation for each sequence (and alignments):
>> P23326  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.1   0.0      0.27      0.27      35      55 ..      39      59 ..      35      63 .. 0.68
   2 !   88.1   5.6   1.8e-29   1.8e-29       1      63 []      90     152 ..      90     152 .. 0.99

  Alignments for each domain:
  == domain 1  score: -2.1 bits;  conditional E-value: 0.27
  TIGR00001 35 KsskrkRqLrkkalvsksdlk 55
               K+ k + +L++++ +s+s+++
     P23326 39 KQLKSTLNLSSSSSISSSKVQ 59
               555666677777777777665 PP

  == domain 2  score: 88.1 bits;  conditional E-value: 1.8e-29
  TIGR00001   1 pKmKTkkaaaKRFkvtgsGkikrkkagkrHlltkKsskrkRqLrkkalvsksdlkrvkllLpy 63 
                +KmKT+ka+aKRF+vtg+Gki+r++agk+Hll+kK++krk++L+k  +v++sd+++v+  Lpy
     P23326  90 YKMKTHKASAKRFRVTGKGKIVRRRAGKQHLLAKKNTKRKNRLSKLIQVDRSDYDNVIGALPY 152
                6************************************************************98 PP



Or compare P23326 to CDD or PaperBLAST