PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10089316 to TIGR00001

VIMSS10089316 has 145 amino acids

Query:       TIGR00001  [M=63]
Accession:   TIGR00001
Description: rpmI_bact: ribosomal protein L35
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      9e-27   79.5   5.9    1.4e-26   78.9   5.9    1.3  1  VIMSS10089316  


Domain annotation for each sequence (and alignments):
>> VIMSS10089316  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   78.9   5.9   1.4e-26   1.4e-26       1      63 []      75     137 ..      75     137 .. 0.99

  Alignments for each domain:
  == domain 1  score: 78.9 bits;  conditional E-value: 1.4e-26
      TIGR00001   1 pKmKTkkaaaKRFkvtgsGkikrkkagkrHlltkKsskrkRqLrkkalvsksdlkrvkllLpy 63 
                    +KmKT+ka+aKRF+vtg Gki+r+++gk+Hll+kK++krk +L+k + v++sd+++v+  Lpy
  VIMSS10089316  75 YKMKTHKASAKRFRVTGRGKIVRRRSGKQHLLAKKNNKRKLRLSKMTEVNRSDYDNVIGALPY 137
                    6************************************************************98 PP



Or compare VIMSS10089316 to CDD or PaperBLAST