Family Search for PF04379 (DUF525)
PF04379.14 hits 16 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.
PA0591 hypothetical protein (NCBI) from Pseudomonas aeruginosa PAO1
Aligns to 18:104 / 126 (69.0%), covers 97.7% of PF04379, 123.2 bits
- Pseudomonas aeruginosa cells attached to a surface display a typical proteome early as 20 minutes of incubation
Crouzet, PloS one 2017 - “...difference in attachment ability compared to PAO1 control ( S8 Table ). 3 of them (PA0591, PA0950 and PA3675) presented an increase in the attachment capacity (ratio 1.5 to 1.6). For the others (PA0180, PA2235, PA2864, PA3160 and PA3435) there is a large decrease in attachment...”
- “...a flavodoxin and PA2864 encoding a protein of unknown function. Interestingly, for 3 mutant strains (PA0591, PA0950 and PA3675) a net increase in the attachment capacity was observed (ratio 1.5 to 1.6). No clear function is attributed to these genes but we can hypothesize that these...”
ApaG / b0050 DUF525 domain-containing protein ApaG from Escherichia coli K-12 substr. MG1655 (see 4 papers)
ECs0055 hypothetical protein (NCBI ptt file) from Escherichia coli O157:H7 str. Sakai
b0050 hypothetical protein (NCBI) from Escherichia coli str. K-12 substr. MG1655
S0049 hypothetical protein (NCBI ptt file) from Shigella flexneri 2a str. 2457T
DR76_RS13325 Co2+/Mg2+ efflux protein ApaG from Escherichia coli ATCC 25922
Aligns to 17:103 / 125 (69.6%), covers 97.7% of PF04379, 114.9 bits
- Transcriptomic analysis of Escherichia coli O157:H7 and K-12 cultures exposed to inorganic and organic acids in stationary phase reveals acidulant- and strain-specific acid tolerance responses
King, Applied and environmental microbiology 2010 - “...and metabolism ECs0969 ECs1601 b1129 b0884 ECs5321 ECs0206 ECs3395 ECs0055 ECs2569 b4361 b0210 b2529 b0050 b1859 bcsE (yhjS) yecJ yhcN yheO yaiZ ybeD ydcX yebG...”
- Functional genomics analysis of free fatty acid production under continuous phosphate limiting conditions
Youngquist, Journal of industrial microbiology & biotechnology 2017 - “...2 potassium translocating ATPase, subunit C b4111 proP 8.2 2.7 10 4 proline/glycine betaine transporter b0050 apaG 2.0 1.8 10 2 protein associated with Co2+ and Mg 2+ efflux Pentose phosphate b b1852 zwf 2.4 8.0 10 4 glucose-6-phosphate dehydrogenase b0767 pgl 2.0 4.8 10 2...”
- Directional RNA-seq reveals highly complex condition-dependent transcriptomes in E. coli K12 through accurate full-length transcripts assembling
Li, BMC genomics 2013 - “...in at least one of our seven samples (Additional file 14 ), and 21 ( b0050, b0137, b1356, b1382, b1419, b1446, b1457, b1607, b1952, b1998, b3471, b3638, b3937, b4325, b4335, b4336, b4593, b4596, b4610, b4615 and b4620 ) of them were expressed in all the seven...”
- Transcriptomic analysis of Escherichia coli O157:H7 and K-12 cultures exposed to inorganic and organic acids in stationary phase reveals acidulant- and strain-specific acid tolerance responses
King, Applied and environmental microbiology 2010 - “...b0884 ECs5321 ECs0206 ECs3395 ECs0055 ECs2569 b4361 b0210 b2529 b0050 b1859 bcsE (yhjS) yecJ yhcN yheO yaiZ ybeD ydcX yebG yohJ yieP rrmJ yiaU zntR xseA nudE...”
- Microarray analysis of orthologous genes: conservation of the translational machinery across species at the sequence and expression level
Jiménez, Genome biology 2003 - “...isomerase rRNA modification and chaperone b0049 Yes* COG0639 T Diadenosine tetraphosphatase rRNA modification and chaperone b0050 No COG2967 P Uncharacterized protein affecting Mg 2+ /Co 2+ transport rRNA modification and chaperone b0051 Yes** COG0030 J 6-m-2-A methyltransferase; put. 16S rRNA methyltransferase rRNA modification and chaperone b0052...”
- A functional update of the Escherichia coli K-12 genome
Serres, Genome Biology 2001 - “...solvent tolerance b0201 rrsH n 16S rRNA b0001 ec_G0001 thrL l thr operon leader peptide b0050 ec_0078 apaG o Conserved protein b0081 ec_0123 mraZ o Conserved hypothetical protein b0005 ec_G0005 yaaX o Unknown CDS * Gene product type: c, carrier; e, enzyme; f, factor; h, extrachromosomal...”
- Combined, functional genomic-biochemical approach to intermediary metabolism: interaction of acivicin, a glutamine amidotransferase inhibitor, with Escherichia coli K-12
Smulski, Journal of bacteriology 2001 - “...fimA fis fixX flgD b3256 b4015 b4016 b1623 b0111 b0050 b0564 b0469 b0908 b2601 b1704 b3433 b0930 b1597 b3734 b3731 b3732 b3736 b3572 b0778 b1270 b1661 b2155...”
- A multiplex oligonucleotide ligation-PCR as a complementary tool for subtyping of Salmonella Typhimurium
Wuyts, Applied microbiology and biotechnology 2015 - “...showed variation among 8 DT1 S . Typhimurium isolates (S0031, S0032, S0036, S0041, S0042, S0043, S0049 and S0050 in Data set S1), which were screened earlier to determine a positive control for the PCR with these markers. For each SNP marker, PCR amplicons were sequenced of...”
- Virulence and transcriptome profile of multidrug-resistant Escherichia coli from chicken
Hussain, Scientific reports 2017 - “...Iron-enterobactin transporter membrane protein 1.87 0.01 DR76_RS23065 Ferrienterobactin ABC transporter periplasmic binding protein 1.80 0.01 DR76_RS13325 Cobalt transporter 1.54 0.01 DR76_RS12185 Fe3+ dicitrate ABC transporter permease 1.40 0.01 DR76_RS23085 Iron-enterobactin transporter ATP-binding protein 1.42 0.01 DR76_RS12180 Iron ABC transporter 1.24 0.01 DR76_RS12205 fecR Fec operon regulator...”
PFLU5579 hypothetical protein (RefSeq) from Pseudomonas fluorescens SBW25
Aligns to 18:104 / 126 (69.0%), covers 97.7% of PF04379, 112.8 bits
C5975_08880 Co2+/Mg2+ efflux protein ApaG from Cronobacter sakazakii
Aligns to 17:103 / 125 (69.6%), covers 97.7% of PF04379, 111.8 bits
- Draft genomes of Cronobacter sakazakii strains isolated from dried spices bring unique insights into the diversity of plant-associated strains
Jang, Standards in genomic sciences 2018 - “...RND efflux (C5975_02520, Transporter), proteins associated with heavy metal efflux of nickel/cobalt (C5975_13445, RcnB), cobalt/magnesium (C5975_08880, ApaG), and manganese ions (C5975_18840, MntP), sugar efflux (C5975_13720, SetB), and multidrug resistance (MdtA, MdtH, MdtD). There were on average 513, 110, 1520 proteins that were annotated as integrases, transposases,...”
XP_016873022 F-box only protein 3 isoform X4 from Homo sapiens
Aligns to 132:222 / 309 (29.4%), covers 97.7% of PF04379, 102.1 bits
- The SCFFBXO3 ubiquitin E3 ligase regulates inflammation in atherosclerosis.
Chandra, Journal of molecular and cellular cardiology 2019 (PubMed)- GeneRIF: FBXO3 potentiates vascular inflammation and atherosclerosis that can be effectively mitigated by a small molecule inhibitor.
- The SCFFBXO46 ubiquitin ligase complex mediates degradation of the tumor suppressor FBXO31 and thereby prevents premature cellular senescence.
Choppara, The Journal of biological chemistry 2018 - GeneRIF: reveal that FBXO46 is a crucial proteasomal regulator of FBXO31 and thereby prevents senescence in normal growth conditions
- Crystal structure and interaction studies of the human FBxo3 ApaG domain.
Krzysiak, The FEBS journal 2016 - GeneRIF: we report the X-ray structure of the human FBxo3 ApaG domain, residues 278-407, at 2.0 A resolution
- FBXO3 Protein Promotes Ubiquitylation and Transcriptional Activity of AIRE (Autoimmune Regulator).
Shao, The Journal of biological chemistry 2016 - GeneRIF: AIRE, which is phosphorylated on two specific residues near its N terminus, then binds to the F-box protein 3 (FBXO3) E3 ubiquitin ligase. In turn, this SCF(FBXO3) (SKP1-CUL1-F box) complex ubiquitylates AIRE, increases its binding to the positive transcription elongation factor b (P-TEFb), and potentiates its transcriptional activity.
- F-box protein Fbxo3 targets Smurf1 ubiquitin ligase for ubiquitination and degradation.
Li, Biochemical and biophysical research communications 2015 (PubMed)- GeneRIF: Fbxo3 promotes the proteasomal degradation of Smurf1. Fbxo3 promotes the poly-ubiquitination of Smurf1.
- Virulence factor NSs of rift valley fever virus recruits the F-box protein FBXO3 to degrade subunit p62 of general transcription factor TFIIH.
Kainulainen, Journal of virology 2014 - GeneRIF: Virulence factor NSs of rift valley fever virus recruits the FBXO3 to degrade subunit p62 of general transcription factor TFIIH.
- A combinatorial F box protein directed pathway controls TRAF adaptor stability to regulate inflammation.
Chen, Nature immunology 2013 - GeneRIF: controls TRAF adaptor stability to regulate inflammation
- PML activates transcription by protecting HIPK2 and p300 from SCFFbx3-mediated degradation.
Shima, Molecular and cellular biology 2008 - GeneRIF: Fbx3 formed SCF(Fbx3) ubiquitin ligase and promoted the degradation of HIPK2 and p300 by the ubiquitin-proteasome pathway
- More
FBX3_HUMAN / Q9UK99 F-box only protein 3 from Homo sapiens (Human) (see paper)
Aligns to 294:384 / 471 (19.3%), covers 97.7% of PF04379, 101.3 bits
- function: Substrate recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Mediates the ubiquitination of HIPK2 and probably that of EP300, leading to rapid degradation by the proteasome. In the presence of PML, HIPK2 ubiquitination still occurs, but degradation is prevented. PML, HIPK2 and FBXO3 may act synergically to activate p53/TP53-dependent transactivation.
subunit: Part of a SCF (SKP1-cullin-F-box) protein ligase complex consisting of FBXO3, SKP1, CUL1 and RBX1. Interacts with PML, interaction is direct and takes place either alone or within the SCF complex. - Multi-chaperone function modulation and association with cytoskeletal proteins are key features of the function of AIP in the pituitary gland.
Hernández-Ramírez, Oncotarget 2018 - “...) Co-F [ 105 ] P03372 Oestrogen receptor ( ESR1 ) Co-IP [ 106 ] Q9UK99 F-box only protein 3 ( FBXO3 ) Co-IP, AC-MS [ 7 ] P50395 Rab GDP dissociation inhibitor beta ( GDIB ) Co-F [ 107 ] Q14344 Guanine nucleotide-binding protein subunit...”
- “...ILGLLDTHLKTR KFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELR 10 D4ABP9 FBX3_RAT F-box only protein 3 ( Fbxo3 ) 55.4 EEDLDAVEAQIGCKLPDDYR 91 Q9UK99 FBX3_HUMAN F-box only protein 3 ( FBXO3 ) 54.6 ITNAKGDVEEVQGPGVVGEFPIISPGR 11 Q99PF5 FUBP2_RAT Far upstream element-binding protein 2 ( Khsrp ) 74.2 KDAFADAVQR 98 Q92945 FUBP2_HUMAN Far upstream element-binding protein...”
- Acetylation-regulated interaction between p53 and SET reveals a widespread regulatory mode.
Wang, Nature 2016 - “...Q96KQ7 Q8IX15 Q8WYB5 P19338 Q5H9L4 Q13029 P27797 Q9UER7 Q4LE39 Q9UPS6-2 P39687 P09429 Q9BT43 P17480 Q15911 Q9UK99 Q9Y4B6 Proline-, glutamic acid- and leucine-rich protein 1 Acidic leucine-rich nuclear phosphoprotein 32 family member B Myelin transcription factor 1-like protein Myelin transcription factor 1 Zinc finger and BTB domain-containing...”
- Virulence factor NSs of rift valley fever virus recruits the F-box protein FBXO3 to degrade subunit p62 of general transcription factor TFIIH.
Kainulainen, Journal of virology 2014 - Quantitative proteomics with siRNA screening identifies novel mechanisms of trastuzumab resistance in HER2 amplified breast cancers
Boyer, Molecular & cellular proteomics : MCP 2013 - “...factor Transmembrane protein 165 BT474 SILAC experiment Q6VVX0 Q9UK99 Q9Y6S9 Q8N3P4 Q59H77 CYP2R1 FBXO3 RPS6KL1 VPS8 CCT3 P81605 Q13268 Q15303 P02452 Q13332...”
- SUMOylation of the Forkhead transcription factor FOXL2 promotes its stabilization/activation through transient recruitment to PML bodies.
Georges, PloS one 2011 - “...P38398 + RNF6 Q9Y252 + RBCK1 Q9BYM8 + MDM2 Q00987 + E6AP Q05086 + FBX3/SCF Q9UK99 + CULLIN1 Q13616 + SKP1 P63208 + PLZF Q05516 + UBP7 Q93009 Enzymes involved in post-translational modifications of proteins and described as associated with PML Nuclear Bodies, according to Van...”
XP_006234719 F-box only protein 3 isoform X2 from Rattus norvegicus
Aligns to 294:384 / 417 (21.8%), covers 97.7% of PF04379, 99.8 bits
NP_997598 F-box only protein 3 isoform 1 from Mus musculus
Q9DC63 F-box only protein 3 from Mus musculus
Aligns to 294:384 / 480 (19.0%), covers 97.7% of PF04379, 99.5 bits
D4ABP9 F-box only protein 3 from Rattus norvegicus
Aligns to 294:384 / 480 (19.0%), covers 97.7% of PF04379, 99.4 bits
NP_080665 polymerase delta-interacting protein 2 from Mus musculus
Q91VA6 Polymerase delta-interacting protein 2 from Mus musculus
Aligns to 252:338 / 368 (23.6%), covers 95.4% of PF04379, 93.4 bits
- Mitochondrial Protein Poldip2 (Polymerase Delta Interacting Protein 2) Controls Vascular Smooth Muscle Differentiated Phenotype by O-Linked GlcNAc (N-Acetylglucosamine) Transferase-Dependent Inhibition of a Ubiquitin Proteasome System.
Paredes, Circulation research 2020 - GeneRIF: Preservation of the differentiated phenotype in Poldip2+/- mice inhibits neointima formation after injury. Poldip2 deficiency induces a highly differentiated phenotype in VSMCs through a mechanism that involves regulation of metabolism and proteostasis.
- Poldip2 deficiency protects against lung edema and vascular inflammation in a model of acute respiratory distress syndrome.
Forrester, Clinical science (London, England : 1979) 2019 (PubMed)- GeneRIF: Heterozygous deletion of Poldip2 protects against lung edema and vascular inflammation in a model of acute respiratory distress syndrome.
- Hepatic deficiency of Poldip2 in type 2 diabetes dampens lipid and glucose homeostasis.
Jiang, Metabolism: clinical and experimental 2019 (PubMed)- GeneRIF: hepatic dysregulation of Poldip2 may contribute to diabetic dyslipidemia and hyperglycemia
- Poldip2 mediates blood-brain barrier disruption in a model of sepsis-associated encephalopathy.
Kikuchi, Journal of neuroinflammation 2019 - GeneRIF: These data suggest Poldip2 mediates LPS-induced blood-brain barrier disruption by regulating NF-kappaBeta subunit p65 activation and Cox-2 and prostaglandin E2 induction.
- Poldip2 is an oxygen-sensitive protein that controls PDH and αKGDH lipoylation and activation to support metabolic adaptation in hypoxia and cancer.
Paredes, Proceedings of the National Academy of Sciences of the United States of America 2018 - GeneRIF: Poldip2 expression is down-regulated by hypoxia in a variety of cell types and basally repressed in triple-negative cancer cells, leading to inhibition of lipoylation of the pyruvate and alpha-KDH complexes and mitochondrial dysfunction.
- Polymerase delta-interacting protein 2 deficiency protects against blood-brain barrier permeability in the ischemic brain.
Hernandes, Journal of neuroinflammation 2018 - GeneRIF: Polidip2 is up-regulated following cerebral ischemia and mediates the breakdown of the blood-brain barrier.
- Polymerase delta-interacting protein 2 regulates collagen accumulation via activation of the Akt/mTOR pathway in vascular smooth muscle cells.
Fujii, Journal of molecular and cellular cardiology 2016 - GeneRIF: the rate of collagen I degradation was increased in Poldip2(+/-) vs. Poldip2(+/+) MASMs. Conversely, activation of the PI3K/Akt/mTOR signaling pathway, involved in regulation of protein synthesis, was significantly elevated in Poldip2(+/-) MASMs as was beta1-integrin expression.
- Poldip2 knockout results in perinatal lethality, reduced cellular growth and increased autophagy of mouse embryonic fibroblasts.
Brown, PloS one 2014 - GeneRIF: Poldip2 is an essential protein in development, and underline its importance in cell viability and proliferation
- More
- Evolutionary constraints of phosphorylation in eukaryotes, prokaryotes, and mitochondria
Gnad, Molecular & cellular proteomics : MCP 2010 - “...Q01279 Q60932 Q60932 Q02013 A2APH4 Q9WTQ5 P97315 Q924Z4 Q91VA6 Q8C064 P14602 Q03265 Q9Z1T1 O88587 Q9CQF4 P67778 Q9CRD0 Q63918 P53986 Tsfm Glud1 Pc Hars2 Sntb1...”
NP_001277074 polymerase delta-interacting protein 2 isoform 2 from Homo sapiens
Aligns to 234:320 / 350 (24.9%), covers 95.4% of PF04379, 93.4 bits
- Mitochondrial Protein Poldip2 (Polymerase Delta Interacting Protein 2) Controls Vascular Smooth Muscle Differentiated Phenotype by O-Linked GlcNAc (N-Acetylglucosamine) Transferase-Dependent Inhibition of a Ubiquitin Proteasome System.
Paredes, Circulation research 2020 - GeneRIF: Poldip2 deficiency in human aortic vascular smooth muscle in vitro induces the expression of the SRF , myocardin, and MRTFA and dramatically represses KLF4. Poldip2 deficiency upregulates the hexosamine biosynthetic pathway and OGT (O-linked N-acetylglucosamine transferase)-mediated protein O-GlcNAcylation. Poldip2 deficiency induces a highly differentiated phenotype in VSMCs by regulating metabolism and proteostasis.
- A Multifunctional Protein PolDIP2 in DNA Translesion Synthesis.
Gagarinskaya, Advances in experimental medicine and biology 2020 (PubMed)- GeneRIF: functional interaction of PolDIP2 with human DNA polymerases and the possible functions in DNA damage response
- Polymerase-δ-interacting protein 2 activates the RhoGEF epithelial cell transforming sequence 2 in vascular smooth muscle cells.
Huff, American journal of physiology. Cell physiology 2019 - GeneRIF: Poldip2 and Ect2 are both essential for vascular smooth muscle cell cytokinesis and proliferation.
- PDIP38/PolDIP2 controls the DNA damage tolerance pathways by increasing the relative usage of translesion DNA synthesis over template switching.
Tsuda, PloS one 2019 - GeneRIF: The loss of PDIP38 consistently causes a shift in DNA damage tolerance (DDT) from error-prone translesion DNA synthesis (TLS) to error-free template switching (TS) without enhancing cellular sensitivity to DNA damage. We propose that PDIP38 controls the relative usage of TLS and TS increasing usage of TLS without changing the overall capability of DDT.
- Poldip2 is an oxygen-sensitive protein that controls PDH and αKGDH lipoylation and activation to support metabolic adaptation in hypoxia and cancer.
Paredes, Proceedings of the National Academy of Sciences of the United States of America 2018 - GeneRIF: Increasing mitochondrial lipoylation by forced expression of Poldip2 increases respiration and reduces the growth rate of cancer cells. Study unveils a regulatory mechanism of catabolic enzymes required for metabolic plasticity and highlights the role of Poldip2 as key during hypoxia and cancer cell metabolic adaptation.
- Knockdown of POLDIP2 suppresses tumor growth and invasion capacity and is linked to unfavorable transformation ability and metastatic feature in non-small cell lung cancer.
Chen, Experimental cell research 2018 (PubMed)- GeneRIF: that demonstrated that POLDIP2 gene was function as an oncogene in NSCLC and implied the oncogenic ability might be through promoting cell proliferation or Epithelial-mesenchymal transition
- NOX4 (NADPH Oxidase 4) and Poldip2 (Polymerase δ-Interacting Protein 2) Induce Filamentous Actin Oxidation and Promote Its Interaction With Vinculin During Integrin-Mediated Cell Adhesion.
Vukelic, Arteriosclerosis, thrombosis, and vascular biology 2018 - GeneRIF: Integrin engagement during cell attachment activates Poldip2/Nox4 to oxidize actin, which modulates filamentous actin assembly and its interaction with vinculin.
- PolDIP2 interacts with human PrimPol and enhances its DNA polymerase activities.
Guilliam, Nucleic acids research 2016 - GeneRIF: findings establish that PolDIP2 can regulate the translesion synthesis polymerase and primer extension activities of PrimPol
- More
PDIP2_HUMAN / Q9Y2S7 Polymerase delta-interacting protein 2; 38 kDa DNA polymerase delta interaction protein; p38 from Homo sapiens (Human) (see 5 papers)
Aligns to 252:338 / 368 (23.6%), covers 95.4% of PF04379, 93.3 bits
G3GTP7 Vitronectin from Cricetulus griseus
Aligns to 760:846 / 876 (9.9%), covers 94.3% of PF04379, 91.9 bits
LOC100809876 uncharacterized protein LOC100809876 from Glycine max
Aligns to 322:416 / 443 (21.4%), covers 92.0% of PF04379, 88.0 bits
SKI16_ARATH / Q9LND7 F-box protein SKIP16; SKP1-interacting partner 16 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT1G06110 SKIP16 (SKP1/ASK-interacting protein 16); protein binding (RefSeq) from Arabidopsis thaliana
Aligns to 314:409 / 436 (22.0%), covers 93.1% of PF04379, 87.1 bits
- function: Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
subunit: Part of a SCF (ASK-cullin-F-box) protein ligase complex (By similarity). Interacts with SKP1A/ASK1, SKP1B/ASK2, ASK4, ASK11 and ASK13. - Identification and Validation of Reference Genes for RT-qPCR Analysis in Non-Heading Chinese Cabbage Flowers
Wang, Frontiers in Plant Science 2016 - “...) KU851930 AT3G13410 TAATAGCACCGTTGGAGTT/CACTGATGAGGATGAGAAGA 110 60.3/60.3 105.6 0.992 SKP1/Ask-interacting protein 16 ( SKIP16 ) KU851931 AT1G06110 CTCAACATCACTACTCCTCTC/AATGGCTAACACGCTTCA 124 61.1/61.1 97.5 0.996 Clathrin adaptor complex ( CAC ) KU851932 AT5G46630 CTGCTCCTTCGTCTACAT/AGTCCATAATCTCGTCTAACA 200 59.9/59.8 97.3 0.996 Protein phosphatase 2A ( PP2A ) KU851933 AT1G10430 ACCGTGGCTACTATTCAG/GCAGTAAGAGGAAGATAATCG 208 59.9/59.7 104.1...”
- Evaluation of putative reference genes for gene expression normalization in soybean by quantitative real-time RT-PCR
Hu, BMC molecular biology 2009 - “...Glyma08g05480.1 CK768960 Gma.34482 AT1G58050 Nuclear helicase Unwinding of the DNA double-helix SKIP16 Glyma12g05510.1 CD397253 Gma.6079 AT1G06110 SKP1/Ask-Interacting Protein 16 Protein binding MTP Glyma03g29350.2 CF808703 Gma.7635 AT2G41790 Metalloprotease, Insulin degrading enzyme Protein degradation PEPKR1 Glyma10g38460.1 AW396185 Gma.23799 AT1G12580 Phosphoenolpyruvate Carboxylase-Related Kinase 1 Protein phosphorylation TIP41 Glyma20g26690.1 EV263725...”
- “...( At4G34270 ), HDC ( At1G58050 ) and UKN2 ( At4G33380 ); and SKIP16 ( At1G06110 ), MTP ( At2G41790 ), PEPKR1 ( At1G12580 ) and UKN1 ( At3G13410 ), which were identified as potential reference genes via a soybean microarray gene expression analysis [ 37...”
F6SQH7 Polymerase delta-interacting protein 2 (Fragment) from Mus musculus
Aligns to 218:278 / 284 (21.5%), covers 65.5% of PF04379, 52.2 bits
Or search for genetic data about PF04379 in the Fitness Browser
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory