Family Search for PF09431 (SPIN90_LRD)

April 2024: See Interactive Tools for Functional Annotation of Bacterial Genomes for advice on using these tools.

PF09431 hits 6 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.

CND05310 hypothetical protein from Cryptococcus neoformans var. neoformans JEC21
Aligns to 298:437 / 673 (20.8%), covers 87.6% of PF09431, 167.2 bits

• Unisexual reproduction drives meiotic recombination and phenotypic and karyotypic plasticity in Cryptococcus neoformans
  Sun, PLoS genetics 2014
  • “...EcoRV Inter- CND05010 CND05020 25 1372992 JOHE27500 JOHE27501 HinfI CND05140 26 1407510 JOHE23367 JOHE23368 TfiI CND05310 27 1447724 JOHE23369 JOHE23370 AccI Inter- CND05360 CND05370 28 1469659 JOHE40007 JOHE40008 NciI Inter- CND05440 CND05450 29 10 1480737 JOHE40021 JOHE40022 Sau96I Inter- CND05590 CND05600 30 11 1514191 JOHE40043 JOHE40044...”
  • “...CND05020 0 7 >70 2 25/26 Inter- CND05010 CND05020 CND05140 2.2 35 15.91 26/27 CND05140 CND05310 2.2 40 18.18 27/28 CND05310 Inter- CND05360 CND05370 0 22 >220 2 28/29 Inter- CND05360 CND05370 Inter- CND05440 CND05450 0 11 >110 2 29/30 Inter- CND05440 CND05450 Inter- CND05590 CND05600...”
• Gene conversion occurs within the mating-type locus of Cryptococcus neoformans during sexual reproduction
  Sun, PLoS genetics 2012
  • “...d 5100 e CND03670 f CND03960 f CND04120 f CND04340 f CND04540 f CND05140 f CND05310 f SXI1/SXI2 g Number of crossing-overs between the CND03670 gene and the SXI1/SXI2 gene JEC169 a T G T G G G G G a a a a a a...”
  • “.... Shown here are the gel separations of the restriction enzyme digestion products of markers CND05310 (A1), CND04540 (A2), CND03960 (A3), and CND04340 (A4). For each marker, from left to right, are the digestions of PCR products using genomic DNA of JEC169, S13, and a mixture...”

LDB17_YEAST / Q12342 Protein LDB17; Low dye-binding protein 17 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
YDL146W Ldb17p from Saccharomyces cerevisiae
Aligns to 235:372 / 491 (28.1%), covers 100.0% of PF09431, 157.3 bits

• function: May be involved in protein-linked oligosaccharide phosphorylation since the deletion reduces the negative charge of the cell surface.
• Actin and endocytosis in budding yeast
  Goode, Genetics 2015
  • “..., MDP2 , YLR337w 4 (Nonessential gene deletion collection) RVS167 RVS167 YDR388w 8 LDB17 LDB17 YDL146w 10 SLA1 SLA1 YBL007c 12 ARC18 ARC18 YLR370c 18 YAP1801 YAP1801 YHR161c 29 EDE1 EDE1 BUD15 , YBL047c 31 YAP1802 YAP1802 YGR241c 42 CAP1 CAP1 YKL007w 45 TPM1 TPM1 YNL079c...”
• Predicting multiplex subcellular localization of proteins using protein-protein interaction network: a comparative study
  Jiang, BMC bioinformatics 2012
  • “...conflicts with our prediction and experimental observation. On the contrary, our predictions of two proteins YDL146W and YDR309C in the Mismatch case, "actin", could be found in their annotations in SGD database (Table 4 ). Table 4 Top 5 predictions of each type for the first...”
  • “...pole body (IDA) YBL105C ambiguous; cytoplasm; bud neck;bud actin cytoplasm (IDA) cytoskeleton (IDA) nucleus (IDA) YDL146W ambiguous; cell periphery; cytoplasm; bud neck;bud actin Bud. Cytoplasm Bud neck colocalizes with actin cortical patch (IDA) cellular bud (IDA) cytoplasm (IDA) cellular bud neck (IDA) YDR309C ambiguous; cytoplasm; bud...”
• A genome-wide screen in Saccharomyces cerevisiae reveals pathways affected by arsenic toxicity
  Zhou, Genomics 2009
  • “...induction of Rnr3p and DNA repair genes after DNA damage 0.9116 O96017 Serine/threonine-protein kinase Chk2 YDL146W LDB17 Protein of unknown function 0.912 AAH16052 NCK interacting protein with SH3 domain YDR358W GGA1 Golgi-localized protein with homology to gamma- adaptin, interacts with and regulates Arf1p and Arf2p in...”
• Identification of putative regulatory upstream ORFs in the yeast genome using heuristics and evolutionary conservation
  Cvijović, BMC bioinformatics 2007
  • “...(nt) relative to start codon of main ORF Predicted length (nt) of 5'-UTR [20] a YDL146W LDB17 489 uORF1(3 ) -53 514 YDL176W Uncharacterised 376 uORF1(9) -104 157 YDL205C HEM3 860 uORF1(8) -130 183 YEL061C CIN8 509 uORF1(4) -109 128 YER167W BCK2 757 uORF1(7) -245 286...”
• A genome-wide screen for Saccharomyces cerevisiae nonessential genes involved in mannosyl phosphate transfer to mannoprotein-linked oligosaccharides
  Corbacho, Fungal genetics and biology : FG & B 2005 (PubMed)
  • “...ORFs identified in this study: YCL005W, LDB16; YDL146W, LDB17; YLL049W, LDB18; and YOR322C, LDB19. 0 false false Saccharomyces cerevisiae Genome analysis...”
  • “...CYC8 3 R4 YCL007C CWH36 Dubious VMA9/LDB10 2 R1 YDL146W Uncharacterized 3 WT LDB17 YDR149C Dubious NUM1 3 WT YDR199w Dubious VPS64 3 WT YEL059W Dubious 1()...”
• Trinucleotide repeats are clustered in regulatory genes in Saccharomyces cerevisiae
  Young, Genetics 2000
  • “...YLR177W YLR206W YLR437C YMR124W YMR135C YNR014W YPL184C YDL146W YJL123C YOR223W YDR153C YDR289C YDR333C YDR365C YER033C YHR131C YIL112W YJL149W YLR114C YML034W...”
• The complete set of predicted genes from Saccharomyces cerevisiae in a readily usable form
  Hudson, Genome research 1997
  • “...bp), YDL160c (1521 bp), YDL159w (1548 bp), YDL156w (1569 bp), YDL146w (1476 bp), and YDL143w (1587 bp). The DNA size marker in the right lane has fragments of...”

DIP1_SCHPO / O74771 Protein dip1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
SPBC24C6.10c conserved eukaryotic protein from Schizosaccharomyces pombe
Aligns to 189:328 / 374 (37.4%), covers 93.4% of PF09431, 142.5 bits

• function: May be involved in protein-linked oligosaccharide phosphorylation.
• A functional genome-wide genetic screening identifies new pathways controlling the G1/S transcriptional wave
  Gaspa, Cell cycle (Georgetown, Tex.) 2016
  • “...SPBC19G7.06 SPBC354.12 SPAC16E8.01 SPBC337.03 SPBC19C7.12c SPAC4F10.13c SPAC694.06c SPBC24C6.10c SPCC162.11c nrm1 yox1 ddb1 exo2 csn1 csn2 atp18 mug83 pof3 res2...”
• Characterization of dip1p reveals a switch in Arp2/3-dependent actin assembly for fission yeast endocytosis
  Basu, Current biology : CB 2011
  • “...endocytosis. Results Dip1p regulates actin patch formation and endocytosis The sequence of S. pombe dip1p (SPBC24c6.10c) predicts that it is a 43.6 kDa protein that contains the conserved leucine-rich region (Pfam domain of unknown function 2013), but is missing the SH3 and proline-rich domains found in...”

Q9ESJ4 NCK-interacting protein with SH3 domain from Mus musculus
Aligns to 539:675 / 714 (19.2%), covers 98.5% of PF09431, 121.2 bits

• Comprehensive and Quantitative Analysis of the Changes in Proteomic and Phosphoproteomic Profiles during Stimulation and Repression of Steroidogenesis in MA-10 Leydig Cells
  Demmouche, International journal of molecular sciences 2022
  • “...protein tau Mapt 4.88 10 7 2.12 10 6 22.99 2.50 10 -3 Up APSPEPPTEEVAAETNSTPDDLEAQDALSPETTEEK Q9ESJ4 NCK-interacting protein with SH3 domain Nckipsd 4.73 10 7 2.12 10 6 22.26 2.50 10 -3 Up SSSPSASLTEHEVSDSPGDEPSESPYESADETQTEASVSSK Q8BVE8 Histone-lysine N-methyltransferase NSD2 Whsc1 3.40 10 7 2.12 10 6 16.00...”

XP_006243816 NCK-interacting protein with SH3 domain isoform X2 from Rattus norvegicus
Aligns to 481:617 / 656 (20.9%), covers 98.5% of PF09431, 120.5 bits

• Control of growth cone motility and neurite outgrowth by SPIN90.
  Kim, Experimental cell research 2011 (PubMed)
  • GeneRIF: SPIN90 plays critical roles in controlling growth cone dynamics and neurite outgrowth during neuronal development.
• SPIN90/WISH interacts with PSD-95 and regulates dendritic spinogenesis via an N-WASP-independent mechanism.
  Lee, The EMBO journal 2006
  • GeneRIF: SPIN90/WISH is a downstream effector of PSD-95-dependent synaptic remodeling.
• Interaction of SPIN90 with syndapin is implicated in clathrin-mediated endocytic pathway in fibroblasts.
  Kim, Genes to cells : devoted to molecular & cellular mechanisms 2006 (PubMed)
  • GeneRIF: SPIN90-PRD, a syndapin-binding domain, significantly inhibited endocytosis, and the inhibition was reversed by co-expression of syndapin.
• Interaction of SPIN90 with dynamin I and its participation in synaptic vesicle endocytosis.
  Kim, The Journal of neuroscience : the official journal of the Society for Neuroscience 2005
  • GeneRIF: 90 kDa SH3 protein interacting with Nck (SPIN90) can modulate the interactions of dynamin I with other endocytic proteins that cooperate in the coated vesicle formation, thus regulating synaptic vesicle endocytosis.

SPN90_HUMAN / Q9NZQ3 NCK-interacting protein with SH3 domain; 54 kDa VacA-interacting protein; 54 kDa vimentin-interacting protein; VIP54; 90 kDa SH3 protein interacting with Nck; AF3p21; Dia-interacting protein 1; DIP-1; Diaphanous protein-interacting protein; SH3 adapter protein SPIN90; WASP-interacting SH3-domain protein; WISH; Wiskott-Aldrich syndrome protein-interacting protein from Homo sapiens (Human) (see 5 papers)
Aligns to 547:683 / 722 (19.0%), covers 98.5% of PF09431, 115.0 bits

• function: Has an important role in stress fiber formation induced by active diaphanous protein homolog 1 (DRF1). Induces microspike formation, in vivo (By similarity). In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42 (By similarity). May play an important role in the maintenance of sarcomeres and/or in the assembly of myofibrils into sarcomeres. Implicated in regulation of actin polymerization and cell adhesion. Plays a role in angiogenesis.
  subunit: Associates with the intermediate filaments, vimentin and desmin. Binds the first and third SH3 domains of NCK. Binds the proline-rich domains of N-WASP through its SH3 domain (By similarity). Similarly, binds diaphanous protein homolog 1 (DRF1). Binds the SH3 domains of GRB2 through its proline-rich domains. Interacts with Helicobacter pylori toxin vacA. Isoform 4 interacts with FHOD1. Interacts with FASLG. Interacts with TMIGD2.
• Quantitative proteomics analysis in small cell carcinoma of cervix reveals novel therapeutic targets.
  Qiu, Clinical proteomics 2023
  • “...1.726571422 0.03167421 P49189 ALDH9A1 4-trimethylaminobutyraldehyde dehydrogenase AL9A1_HUMAN 1.823805109 0.008883657 P15586 GNS N-acetylglucosamine-6-sulfatase GNS_HUMAN 1.828353696 0.014993157 Q9NZQ3 NCKIPSD NCK-interacting protein with SH3 domain SPN90_HUMAN 1.848501531 0.048522891 Q92575 UBXN4 UBX domain-containing protein 4 UBXN4_HUMAN 1.874007659 0.010803221 Q6IPR1 ETFRF1 Electron transfer flavoprotein regulatory factor 1 ETFR1_HUMAN 1.899684535 0.026710264 P31939...”
• Nucleation, stabilization, and disassembly of branched actin networks.
  Gautreau, Trends in cell biology 2022
  • “...WASH (A8K0Z3); N-WASP (O00401); WHAMM (Q8TF30); JMY (Q8N9B5); Cortactin (Q14247); GMF (O60234); Cofilin (P23528); SPIN90 (Q9NZQ3); Arpin (Q7Z6K5); Gadkin (Q63HQ0); Coronin 1A (P31146); Coronin 2A (Q92828); Coronin 7 (P57737). Ribbon diagrams of determined structures of domains of these proteins are shown along with the PDB accession...”
• Enrichment of Phosphorylated Tau (Thr181) and Functionally Interacting Molecules in Chronic Traumatic Encephalopathy Brain-derived Extracellular Vesicles
  Muraoka, Aging and disease 2021
  • “...SH3GL2 0.386 0.114 P62937 PPIA 0.381 0.118 Q12860 CNTN1 -0.381 0.119 P63261 ACTG1 0.373 0.1277 Q9NZQ3 NCKIPSD 0.349 0.155 Q7Z3U7 MON2 -0.344 0.162 P68366 TUBA4A 0.335 0.175 P45974 USP5 0.327 0.185 P78357 CNTNAP1 -0.315 0.204 P28331 NDUFS1 0.312 0.208 P13591 NCAM1 -0.290 0.244 Q71U36 TUBA1A 0.287...”
• Granule Cell Dispersion in Human Temporal Lobe Epilepsy: Proteomics Investigation of Neurodevelopmental Migratory Pathways.
  Liu, Frontiers in cellular neuroscience 2020
  • “...type 1-L Q15691 MAPRE1 Microtubule-associated protein RP/EB family member 1 Q9Y2A7 NCKAP1 Nck-associated protein 1 Q9NZQ3 NCKIPSD NCK-interacting protein with SH3 domain P35080 PFN2 Profilin-2 P62140 PPP1CB Serine/threonine-protein phosphatase PP1-beta catalytic C9J9C1 PPP2R1A Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A P63000 RAC1 Ras-related C3 botulinum...”
• New insights into meningitic Escherichia coli infection of brain microvascular endothelial cells from quantitative proteomics analysis.
  Liu, Journal of neuroinflammation 2018
  • “...PDS5 homolog B 164.6 0.826 0.003399** Q9NWU5 39S ribosomal protein L22, mitochondrial 23.6 0.812 0.016677* Q9NZQ3 NCK-interacting protein with SH3 domain 78.9 0.661 0.00317** Q9P0V3 SH3 domain-binding protein 4 107.4 0.797 0.001833** Q9UBL6 Copine-7 70.2 0.823 2.73E05*** Q9UJW0 Dynactin subunit 4 52.3 0.823 0.012604* Q9UNP9 Peptidyl-prolyl...”
• A Systematic In-silico Analysis of Helicobacter pylori Pathogenic Islands for Identification of Novel Drug Target Candidates.
  Nammi, Current genomics 2017
  • “...4 ; (Fig. 7A ). Tyrosinase-protein phosphatase non-receptor type II (Q06124), serine/threonine protein kinase MARK2 (Q9NZQ3), mitogen-activated protein kinase kinase kinase 7 (MAPKKK7) (O43318), TNF receptor associated factor 6 (Q9Y4K3) of host interacted with cytotoxin associated immunodominant antigen with protein ID's P80200, P55980, B5Z6S0, Q9ZLT1 of...”
  • “...respectively Table 4 ; (Fig. 7A ). PHISTO also predicted NCK-interacting protein with SH3 domain (Q9NZQ3) of host interacting with vacuolating cytotoxin A (Q8RNUI) of pathogen Table 4 ; (Fig. 7A ). HPIDB visualized interactions between 54 proteins from different pathogens with three human proteins (Table...”
• Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
  Voss, BMC immunology 2009
  • “...2 1 1 P46108 CRK proto-oncogene c-Crk/p38 A MA, CYT NL 2/1 1 0 1 Q9NZQ3 SPN90 SH3 adapter protein SPIN90 A, CA NUC UBI 1/1 1 0 1 Q5TCZ1 SPD2A SH3 and PX domain containing protein 2A A CYT, MA UBI 5/5 1 0 1...”
• A global proteomics approach identifies novel phosphorylated signaling proteins in GPVI-activated platelets: involvement of G6f, a novel platelet Grb2-binding membrane adapter.
  García, Proteomics 2006
  • “...P07355 15 Calcium/phospholipid-binding protein. Annexin A5 P08758 15 Calcium/phospholipid-binding protein. DIP-1 [Dia interacting protein-1] (SPIN90) Q9NZQ3 6 Adapter protein implicated in regulation of actin polymerization. Gads [Grb2-related adaptor protein 2] O75791 14 Supports activation of PLC2 by GPVI. Constitutively bound to SLP-76. Tyrosine phosphorylation shown in...”

Or search for genetic data about PF09431 in the Fitness Browser