Family Search for PF12130 (bMERB_dom)
April 2024: See Interactive Tools for Functional Annotation of Bacterial Genomes for advice on using these tools.
Running HMMer for PF12130
PF12130 hits 50 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.
MILK1_BOVIN / E1BBG2 MICAL-like protein 1 from Bos taurus (Bovine) (see 3 papers)
Aligns to 674:806 / 853 (15.6%), covers 99.3% of PF12130, 151.5 bits
- function: Probable lipid-binding protein with higher affinity for phosphatidic acid, a lipid enriched in recycling endosome membranes. On endosome membranes, may act as a downstream effector of Rab proteins recruiting cytosolic proteins to regulate membrane tubulation. May be involved in a late step of receptor-mediated endocytosis regulating for instance endocytosed-EGF receptor trafficking. Alternatively, may regulate slow endocytic recycling of endocytosed proteins back to the plasma membrane. May indirectly play a role in neurite outgrowth (By similarity).
subunit: Homooligomer (Probable). Interacts (via NPF1 motif) with EHD1 (via EH domain); the interaction is direct and probably recruits EHD1 to membranes. Interacts with EHD3 (via EH domain). Interacts with RAB35 (GTP-bound form); the interaction is direct and probably recruits MICALL1 to membranes. Interacts with ACAP2; the interaction is indirect through RAB35. Interacts with RAB8A (GTP-bound form); regulates RAB8A association with recycling endosomes. Interacts with RAB13 (GTP-bound form). Interacts with ARF6 (GTP-bound form). Interacts with PACSIN2 (via the SH3 domain). Interacts with DPYSL2. - Comparative milk proteome analysis of Kashmiri and Jersey cattle identifies differential expression of key proteins involved in immune system regulation and milk quality.
Bhat, BMC genomics 2020 - “...0.09671 0.1897 0.049 P11017, P62871 GNB2, GNB1 Integrin signalling pathway (P00034) 2 0.0823 0.353 P63258, E1BBG2 ACTG1, MICALL1 Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway (P00026) 2 0.0658 0.298 P11017, P62871 GNB2, GNB1 Wnt signaling pathway (P00057) 3 0.0388 0.197 P63258, P11017, P62871...”
XP_001922175 MICAL-like protein 1 isoform X1 from Danio rerio
Aligns to 687:819 / 867 (15.3%), covers 99.3% of PF12130, 151.5 bits
MILK1_MOUSE / Q8BGT6 MICAL-like protein 1; Molecule interacting with Rab13; MIRab13 from Mus musculus (Mouse) (see 2 papers)
Aligns to 691:823 / 870 (15.3%), covers 98.5% of PF12130, 151.3 bits
- function: Probable lipid-binding protein with higher affinity for phosphatidic acid, a lipid enriched in recycling endosome membranes. On endosome membranes, may act as a downstream effector of Rab proteins recruiting cytosolic proteins to regulate membrane tubulation. May be involved in a late step of receptor-mediated endocytosis regulating for instance endocytosed-EGF receptor trafficking. Alternatively, may regulate slow endocytic recycling of endocytosed proteins back to the plasma membrane. May indirectly play a role in neurite outgrowth.
subunit: Homooligomer (Probable). Interacts (via NPF1 motif) with EHD1 (via EH domain); the interaction is direct and probably recruits EHD1 to membranes. Interacts with EHD3 (via EH domain). Interacts with RAB35 (GTP-bound form); the interaction is direct and probably recruits MICALL1 to membranes. Interacts with ACAP2; the interaction is indirect through RAB35. Interacts with RAB8A (GTP-bound form); regulates RAB8A association with recycling endosomes. Interacts with RAB13 (GTP-bound form). Interacts with ARF6 (GTP-bound form). Interacts with PACSIN2 (via the SH3 domain). Interacts with DPYSL2. - Label-Free Proteomic Analysis of Protein Changes in the Striatum during Chronic Ethanol Use and Early Withdrawal.
Ayers-Ringler, Frontiers in behavioral neuroscience 2016 - “...P32261 5.965 GPX3 Glutathione peroxidase 3 P46412 4.745 TTR Transthyretin P07309 4.582 MICALL1 MICAL-like 1 Q8BGT6 4.460 CX3CL1 Chemokine (C-X3-C motif) ligand 1 O35188 3.020 TP53I11 Tumor protein p53 inducible protein 11 Q4QQM4 2.898 SERPINF2 Serpin peptidase inhibitor, clade F (alpha2 antiplasmin, pigment epithelium derived factor),...”
- Quantitative phosphoproteomics reveals crosstalk between phosphorylation and O-GlcNAc in the DNA damage response pathway.
Zhong, Proteomics 2015 - “...Mcm6 DNA replication licensing factor MCM6 P97311 S13 2.1 S704 2.0 Micall1 MICAL-like protein 1 Q8BGT6 S137 1.6 Nbn Nibrin Q9R207 S398 2.2 Pafah1b2 Platelet-activating factor acetylhydrolase IB subunit beta Q61206 S2 3.0 Pdha1 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial P35486 S300 2.0...”
- CIN85 interacting proteins in B cells-specific role for SHIP-1
Büchse, Molecular & cellular proteomics : MCP 2011 - “...29 AP-2 1 Q6A0C9 30 Ap-2 1 31 MIRab13 Q8BGT6 32 Septin-9 (Sint1) Q80UG5 33 Clathrin heavy chain Q68FD5 34 Tsg101 Q3UCW0 Cytoskeletal rearrangement 35 WIP Q8K1I7...”
MILK1_RAT / D3ZQL6 MICAL-like protein 1 from Rattus norvegicus (Rat) (see paper)
Aligns to 676:808 / 855 (15.6%), covers 98.5% of PF12130, 151.1 bits
- function: Probable lipid-binding protein with higher affinity for phosphatidic acid, a lipid enriched in recycling endosome membranes. On endosome membranes, may act as a downstream effector of Rab proteins recruiting cytosolic proteins to regulate membrane tubulation. May be involved in a late step of receptor-mediated endocytosis regulating for instance endocytosed-EGF receptor trafficking. Alternatively, may regulate slow endocytic recycling of endocytosed proteins back to the plasma membrane. May indirectly play a role in neurite outgrowth.
subunit: Homooligomer (Probable). Interacts (via NPF1 motif) with EHD1 (via EH domain); the interaction is direct and probably recruits EHD1 to membranes. Interacts with EHD3 (via EH domain). Interacts with RAB35 (GTP-bound form); the interaction is direct and probably recruits MICALL1 to membranes. Interacts with ACAP2; the interaction is indirect through RAB35. Interacts with RAB8A (GTP-bound form); regulates RAB8A association with recycling endosomes. Interacts with RAB13 (GTP-bound form). Interacts with ARF6 (GTP-bound form). Interacts with PACSIN2 (via the SH3 domain). Interacts with DPYSL2.
MILK1_HUMAN / Q8N3F8 MICAL-like protein 1; Molecule interacting with Rab13; MIRab13 from Homo sapiens (Human) (see 6 papers)
NP_203744 MICAL-like protein 1 isoform 3 from Homo sapiens
Aligns to 684:816 / 863 (15.4%), covers 99.3% of PF12130, 151.0 bits
- function: Probable lipid-binding protein with higher affinity for phosphatidic acid, a lipid enriched in recycling endosome membranes. On endosome membranes, may act as a downstream effector of Rab proteins recruiting cytosolic proteins to regulate membrane tubulation. May be involved in a late step of receptor-mediated endocytosis regulating for instance endocytosed-EGF receptor trafficking. Alternatively, may regulate slow endocytic recycling of endocytosed proteins back to the plasma membrane. May indirectly play a role in neurite outgrowth.
subunit: Homooligomer (Probable). Interacts (via NPF1 motif) with EHD1 (via EH domain); the interaction is direct and probably recruits EHD1 to membranes. Interacts with EHD3 (via EH domain). Interacts with RAB35 (GTP-bound form); the interaction is direct and probably recruits MICALL1 to membranes. Interacts with ACAP2; the interaction is indirect through RAB35. Interacts with RAB8A (GTP-bound form); regulates RAB8A association with recycling endosomes. Interacts with RAB13 (GTP-bound form). Interacts with ARF6 (GTP-bound form). Interacts with PACSIN2 (via the SH3 domain). Interacts with DPYSL2. - A junctional PACSIN2/EHD4/MICAL-L1 complex coordinates VE-cadherin trafficking for endothelial migration and angiogenesis.
Malinova, Nature communications 2021 - GeneRIF: A junctional PACSIN2/EHD4/MICAL-L1 complex coordinates VE-cadherin trafficking for endothelial migration and angiogenesis.
- MICAL-L1 is required for cargo protein delivery to the cell surface.
Sikora, Biology open 2021 - GeneRIF: MICAL-L1 is required for cargo protein delivery to the cell surface.
- MICAL-L1 coordinates ciliogenesis by recruiting EHD1 to the primary cilium.
Xie, Journal of cell science 2019 - GeneRIF: Data support the notion that a pool of centriolar gamma-tubulin and/or alpha-tubulin-beta-tubulin heterodimers anchor MICAL-L1 to the centriole, where it might recruit EHD1 to promote ciliogenesis.
- Regulation of tubular recycling endosome biogenesis by the p53-MICALL1 pathway.
Takahashi, International journal of oncology 2017 (PubMed)- GeneRIF: Findings found that ectopic expression of MICALL1 significantly inhibited the proliferation of HCT116 colorectal cancer cells. Also, MICALL1 expression was found to be suppressed in colorectal cancer with p53 mutations.
- Novel functions for the endocytic regulatory proteins MICAL-L1 and EHD1 in mitosis.
Reinecke, Traffic (Copenhagen, Denmark) 2015 - GeneRIF: suggesting an EHD1-independent function for MICAL-L1 earlier in mitosis
- Regulation of Src trafficking and activation by the endocytic regulatory proteins MICAL-L1 and EHD1.
Reinecke, Journal of cell science 2014 - GeneRIF: MICAL-L1-mediated recruitment of EHD1 to Src-containing recycling endosomes is required for the release of Src from the perinuclear endocytic recycling compartment in response to growth factor stimulation.
- Diacylglycerol kinase α regulates tubular recycling endosome biogenesis and major histocompatibility complex class I recycling.
Xie, The Journal of biological chemistry 2014 - GeneRIF: DGKalpha generates phosphatidic acid to drive its own recruitment to tubular recycling endosomes via its interaction with MICAL-L1
- Cooperation of MICAL-L1, syndapin2, and phosphatidic acid in tubular recycling endosome biogenesis.
Giridharan, Molecular biology of the cell 2013 - GeneRIF: Cooperation of MICAL-L1, pacsin 2 (syndapin2), and phosphatidic acid in tubular recycling endosome biogenesis.
- More
- Temporal modulation of the NF-κB RelA network in response to different types of DNA damage
Campbell, The Biochemical journal 2021 - “...Peroxiredoxin-like 2C Q99956 Dual specificity protein phosphatase 9 Hydroxyurea Q9BY44 Eukaryotic translation initiation factor 2A Q8N3F8 MICAL-like protein 1 Q4G0J3 La-related protein 7 O94979 Protein transport protein Sec31A Q12931 Heat shock protein 75kDa, mitochondrial E9PRG8 Uncharacterized protein C11orf98 O75113 NEDD4-binding protein 1 P12270 Nucleoprotein TPR Proteins...”
- bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
Rai, eLife 2016 - “...are indicated for isoform 1 (Mical-1: Uniprot ID Q8TDZ2, genomic location 6q21; Mical-L1: Uniprot ID Q8N3F8, genomic location 22q13.1; Mical-L2: Uniprot ID Q8IY33, genomic location 7p22.3; Mical-3: Uniprot ID Q7RTP6, genomic location 22q11.21; Mical-cL: Uniprot ID Q6ZW33, genomic location 11p15.3; EHBP1: Uniprot ID Q8NDI1, genomic location...”
- “...halves are again colored in blue and green, respectively). Uniprot accession IDs are Q8TDZ2 (Mical-1), Q8N3F8 (Mical-L1), Q8IY33 (Mical-L2), Q7RTP6 (Mical-3), Q6ZW33 (Mical-cL), Q8NDI1 (EHBP1) and Q8N3D4 (EHBP1L1). DOI: http://dx.doi.org/10.7554/eLife.18675.015 10.7554/eLife.18675.016 Figure 6figure supplement 2. Structural comparison of the individual Rab binding sites in Mical-1. (...”
- MicroRNA-7 protects against 1-methyl-4-phenylpyridinium-induced cell death by targeting RelA.
Choi, The Journal of neuroscience : the official journal of the Society for Neuroscience 2014 - Charge effects in the selection of NPF motifs by the EH domain of EHD1.
Henry, Biochemistry 2010 - “...Q9UNF0 3 fsstdangds_NPFDDD_atsgtevrvr 417422 SNAP29 msaypksy_NPFDDD_gedegarpap 914 O95721 1 ( 15 ) MICAL-L1 ptasleskpy_NPFEEE_eedkeeeapa 425430 Q8N3F8 2 ( 53 ) AP2-associated protein kinase 1 vynpsegstw_NPFDDD_nfskltaeel 696701 Q2M2I8 1 Exocyst complex component 8 gppqvtskat_NPFEDD_eeeepavpev 310315 Q8IYI6 1 Pygopus homolog 2 tpmvdhlvas_NPFEDD_fgapkvgvaa 7681 Q9BRQ0 1 Makorin-4 weffeegans_NPFDDE_eeavtfelge 465470...”
NP_001299826 protein-methionine sulfoxide oxidase mical2b from Danio rerio
Aligns to 613:749 / 783 (17.5%), covers 100.0% of PF12130, 150.3 bits
NP_001178014 F-actin-monooxygenase MICAL3 from Rattus norvegicus
D3ZGN7 F-actin monooxygenase from Rattus norvegicus
Aligns to 1849:1983 / 1997 (6.8%), covers 100.0% of PF12130, 149.0 bits
MICA3_HUMAN / Q7RTP6 [F-actin]-monooxygenase MICAL3; Molecule interacting with CasL protein 3; MICAL-3; EC 1.14.13.225 from Homo sapiens (Human) (see 6 papers)
NP_056056 [F-actin]-monooxygenase MICAL3 isoform 1 from Homo sapiens
Aligns to 1854:1988 / 2002 (6.7%), covers 100.0% of PF12130, 148.6 bits
- function: Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin to form methionine-sulfoxide, resulting in actin filament disassembly and preventing repolymerization. In the absence of actin, it also functions as a NADPH oxidase producing H(2)O(2). Seems to act as Rab effector protein and plays a role in vesicle trafficking. Involved in exocytic vesicles tethering and fusion: the monooxygenase activity is required for this process and implicates RAB8A associated with exocytotic vesicles. Required for cytokinesis. Contributes to stabilization and/or maturation of the intercellular bridge independently of its monooxygenase activity. Promotes recruitment of Rab8 and ERC1 to the intercellular bridge, and together these proteins are proposed to function in timely abscission.
catalytic activity: H(+) + L-methionyl-[F-actin] + NADPH + O2 = H2O + L-methionyl- (R)-S-oxide-[F-actin] + NADP(+) (RHEA:51308)
cofactor: FAD
subunit: Interacts with RAB1B, RAB8A, RAB10, RAB13 and RAB15 (in their GTP-bound forms); binding to RAB1B is of low affinity compared to other Rab proteins; at least in case of RAB8A can bind 2 molecules of RAB8A simultaneously through a high and a low affinity binding site, respectively. Interacts with ERC1 and RAB8A; may bridge ERC1 with RAB8A. Interacts with KIF23 and ERC1; enhances the interaction between KIF23 and ERC1. Interacts with NINL isoform 2. - Afatinib Reverses EMT via Inhibiting CD44-Stat3 Axis to Promote Radiosensitivity in Nasopharyngeal Carcinoma.
Huang, Pharmaceuticals (Basel, Switzerland) 2022 - “...STAT3 0.476 0.029 O94921 CDK14 1.46 0.004 Q86X27 RALGPS2 0.497 0.012 Q14669 TRIP12 1.443 0.02 Q7RTP6 MICAL3 0.504 0.008 O15355 PPM1G 1.432 0.007 Q09666 AHNAK 0.509 0.043 Q9H3H3 C11orf68 1.429 <0.001 Q9H2G2 SLK 0.512 0.007 P18433 PTPRA 1.423 0.006 Q9BRS8 LARP6 0.524 0.021 P13796 LCP1 1.401...”
- bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
Rai, eLife 2016 - “...ID Q8N3F8, genomic location 22q13.1; Mical-L2: Uniprot ID Q8IY33, genomic location 7p22.3; Mical-3: Uniprot ID Q7RTP6, genomic location 22q11.21; Mical-cL: Uniprot ID Q6ZW33, genomic location 11p15.3; EHBP1: Uniprot ID Q8NDI1, genomic location 2p15; EHBP1L1 Uniprot ID Q8N3D4, genomic location 11q13.1). The reader is referred to the...”
- “...in blue and green, respectively). Uniprot accession IDs are Q8TDZ2 (Mical-1), Q8N3F8 (Mical-L1), Q8IY33 (Mical-L2), Q7RTP6 (Mical-3), Q6ZW33 (Mical-cL), Q8NDI1 (EHBP1) and Q8N3D4 (EHBP1L1). DOI: http://dx.doi.org/10.7554/eLife.18675.015 10.7554/eLife.18675.016 Figure 6figure supplement 2. Structural comparison of the individual Rab binding sites in Mical-1. ( a ) Cartoon representation...”
- Increased diversity of the HLA-B40 ligandome by the presentation of peptides phosphorylated at their main anchor residue
Marcilla, Molecular & cellular proteomics : MCP 2014 - “...SERIMQLpSL RpSFPTLPTL KESpSPIPSP SEpSGSNLHAL KELARQIpSF KENpTPPAL Q9H3D4 Q7RTP6 Q5VV52 Q9H8U3 P22695 Q9NQS7 Q14155 P51825 Q9Y2F5 O60336 Q7Z417 P30050 Q9ULL5-3...”
- MICAL, the flavoenzyme participating in cytoskeleton dynamics.
Vanoni, International journal of molecular sciences 2013 - “...11p15 NM_014632 NP_055447 1124 9645 O94851 Figure 4 MICAL3 human 22q11.21 NM_015241 NP_056056 2002 57553 Q7RTP6 Figure 4 MICAL1 mouse 10 B1-B2 NM_138315 NP_612188 1048 171580 Q8VDP3 Figure 4 MICAL2 mouse 7E3 NM_001193305 NP_001180234 1102 320878 8QBML1 isoform A; Figure 4 MICAL3 mouse 6F1 NM_001270475 NP_001257404...”
- Minimizing back exchange in 18O/16O quantitative proteomics experiments by incorporation of immobilized trypsin into the initial digestion step.
Sevinsky, Analytical chemistry 2007 - Semaphorin signaling via MICAL3 induces symmetric cell division to expand breast cancer stem-like cells.
Tominaga, Proceedings of the National Academy of Sciences of the United States of America 2019 - GeneRIF: the niche factor Sema3-stimulated NP1/MICAL3/CRMP2/Numb axis appears to expand Cancer stem-like cells (CSCs) at least partly through increased frequency of MICAL3-mediated symmetric division of CSCs.
- MICAL3 Flavoprotein Monooxygenase Forms a Complex with Centralspindlin and Regulates Cytokinesis.
Liu, The Journal of biological chemistry 2016 - GeneRIF: MICAL3 acts as a midbody-associated scaffold for vesicle targeting, which promotes maturation of the intercellular bridge and abscission.
- MicroRNA 648 Targets ET-1 mRNA and is cotranscriptionally regulated with MICAL3 by PAX5.
Li, Molecular and cellular biology 2015 - GeneRIF: a novel link wherein placenta growth factor-mediated downregulation of paired box protein 5 attenuates miR-648 expression leading to increased endothelin-1 levels that are known to induce Pulmonary hypertension in sickle cell anemia
- The Ciliopathy Protein CC2D2A Associates with NINL and Functions in RAB8-MICAL3-Regulated Vesicle Trafficking.
Bachmann-Gagescu, PLoS genetics 2015 - GeneRIF: Further exploration of the NINL-associated interactome identifies MICAL3, a protein known to interact with Rab8 and to play an important role in vesicle docking and fusion.
- Allelic expression analysis of the osteoarthritis susceptibility locus that maps to MICAL3.
Ratnayake, BMC medical genetics 2012 - GeneRIF: data do not support our hypothesis that the association between rs2277831 and primary osteoarthriti is due to the effect this SNP has on MICAL3, BCL2L13 or BID gene expression
- Rab6, Rab8, and MICAL3 cooperate in controlling docking and fusion of exocytotic carriers.
Grigoriev, Current biology : CB 2011 (PubMed)- GeneRIF: The monooxygenase activity of MICAL3 is required to regulate its own turnover and the concomitant remodeling of vesicle-docking protein complexes.
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
Rose, Molecular medicine (Cambridge, Mass.) - GeneRIF: Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
Q8CJ19 [F-actin]-monooxygenase MICAL3 from Mus musculus
Aligns to 1845:1979 / 1993 (6.8%), covers 100.0% of PF12130, 148.2 bits
NP_001314716 MICAL-like protein 2 from Danio rerio
Aligns to 628:764 / 799 (17.1%), covers 100.0% of PF12130, 144.6 bits
MILK2_RAT / D3ZEN0 MICAL-like protein 2; Junctional Rab13-binding protein; Molecule interacting with CasL-like 2; MICAL-L2 from Rattus norvegicus (Rat) (see paper)
Aligns to 851:983 / 1014 (13.1%), covers 98.5% of PF12130, 143.6 bits
- function: Effector of small Rab GTPases which is involved in junctional complexes assembly through the regulation of cell adhesion molecules transport to the plasma membrane and actin cytoskeleton reorganization. Regulates the endocytic recycling of occludins, claudins and E-cadherin to the plasma membrane and may thereby regulate the establishment of tight junctions and adherens junctions. In parallel, may regulate actin cytoskeleton reorganization directly through interaction with F-actin or indirectly through actinins and filamins. Most probably involved in the processes of epithelial cell differentiation, cell spreading and neurite outgrowth.
subunit: Interacts with RAB13 (GTP-bound form); competes with RAB8A and is involved in tight junctions assembly. Interacts with RAB8A; competes with RAB13 and is involved in E-cadherin endocytic recycling. Interacts with RAB8B. Interacts (preferentially in opened conformation) with ACTN1 and ACTN4; stimulated by RAB13 activation. Interacts (via calponin-homology (CH) domain) with the filamins FLNA, FLNB and FLNC (via actin-binding domain) (By similarity). - Conformational plasticity of JRAB/MICAL-L2 provides "law and order" in collective cell migration
Sakane, Molecular biology of the cell 2016 - “...G5BUG1 [ Heterocephalus glaber ], Q3TN34 [ Mus musculus ], G3GVG4 [ Cricetulus griseus ], D3ZEN0 [ Rattus norvegicus ], L5KC08 [ Pteropus alecto ], and L8Y7J9 [ Tupaia chinensis ]) using ClustalW ( Thompson et al. , 1994 ). Alignment of the effectors with the...”
- Quantitative proteomics reveals novel protein interaction partners of PP2A catalytic subunit in pancreatic β-cells.
Zhang, Molecular and cellular endocrinology 2016 - “...0.0017 12.9 Limk1 G3V663 LIM motif-containing protein kinase 1, isoform CRA_a 72.6 0.0010 9.8 Micall2 D3ZEN0 Protein Micall2 107.8 0.0043 6.6 Mrpl35 D3ZE10 Mitochondrial ribosomal protein L35 (Predicted), isoform CRA_a 21.5 0.0065 13.1 Ncor1 F1LSA0 Nuclear receptor corepressor 1 271.2 0.0074 7.6 Prph P21807 Peripherin 53.5...”
XP_011239276 MICAL-like protein 2 isoform X1 from Mus musculus
Aligns to 763:895 / 926 (14.4%), covers 98.5% of PF12130, 142.4 bits
- Actin Cytoskeletal Reorganization Function of JRAB/MICAL-L2 Is Fine-tuned by Intramolecular Interaction between First LIM Zinc Finger and C-terminal Coiled-coil Domains.
Miyake, Scientific reports 2019 - GeneRIF: the LIM domain, independent of the C-terminus, is necessary for the function of open-form JRAB/MICAL-L2
- Junctional Rab13-binding protein (JRAB) regulates cell spreading via filamins.
Sakane, Genes to cells : devoted to molecular & cellular mechanisms 2013 (PubMed)- GeneRIF: Interaction between JRAB and filamin regulates JRABDeltaCC-induced cell spreading.
- Rab13 small G protein and junctional Rab13-binding protein (JRAB) orchestrate actin cytoskeletal organization during epithelial junctional development.
Sakane, The Journal of biological chemistry 2012 - GeneRIF: Rab13 and JRAB regulate reorganization of the actin cytoskeleton throughout epithelial junctional development.
- Rab13 regulates neurite outgrowth in PC12 cells through its effector protein, JRAB/MICAL-L2.
Sakane, Molecular and cellular biology 2010 - GeneRIF: show that Rab13 regulates neurite outgrowth in the rat pheochromocytoma cell line PC12 through an interaction with JRAB/MICAL-L2.
- The interaction of JRAB/MICAL-L2 with Rab8 and Rab13 coordinates the assembly of tight junctions and adherens junctions.
Yamamura, Molecular biology of the cell 2008 - GeneRIF: These results suggest that the interaction of JRAB/MICAL-L2 with Rab8 and Rab13 coordinates the assembly of tight junctions and adherens junctions.
- Involvement of actinin-4 in the recruitment of JRAB/MICAL-L2 to cell-cell junctions and the formation of functional tight junctions.
Nakatsuji, Molecular and cellular biology 2008 - GeneRIF: Although actinin-4 bound to JRAB/MICAL-L2 without Rab13, the actinin-4-JRAB/MICAL-L2 interaction was enhanced by Rab13 activation.
- JRAB/MICAL-L2 is a junctional Rab13-binding protein mediating the endocytic recycling of occludin.
Terai, Molecular biology of the cell 2006 - GeneRIF: JRAB/MICAL-L2 mediates the endocytic recycling of occludin and the formation of functional TJs by linking Rab13 to actin cytoskeleton.
MILK2_MOUSE / Q3TN34 MICAL-like protein 2; Junctional Rab13-binding protein; Molecule interacting with CasL-like 2; MICAL-L2 from Mus musculus (Mouse) (see 6 papers)
Aligns to 846:978 / 1009 (13.2%), covers 98.5% of PF12130, 142.3 bits
- function: Effector of small Rab GTPases which is involved in junctional complexes assembly through the regulation of cell adhesion molecules transport to the plasma membrane and actin cytoskeleton reorganization. Regulates the endocytic recycling of occludins, claudins and E-cadherin to the plasma membrane and may thereby regulate the establishment of tight junctions and adherens junctions. In parallel, may regulate actin cytoskeleton reorganization directly through interaction with F-actin or indirectly through actinins and filamins. Most probably involved in the processes of epithelial cell differentiation, cell spreading and neurite outgrowth.
subunit: Interacts with RAB13 (GTP-bound form); competes with RAB8A and is involved in tight junctions assembly. Interacts with RAB8A; competes with RAB13 and is involved in E-cadherin endocytic recycling. Interacts with RAB8B. Interacts (preferentially in opened conformation) with ACTN1 and ACTN4; stimulated by RAB13 activation. Interacts (via calponin-homology (CH) domain) with the filamins FLNA, FLNB and FLNC (via actin-binding domain). - Actin Cytoskeletal Reorganization Function of JRAB/MICAL-L2 Is Fine-tuned by Intramolecular Interaction between First LIM Zinc Finger and C-terminal Coiled-coil Domains.
Miyake, Scientific reports 2019 - “...(80.8%). First, the sequence of JRAB-C (the C-terminal domain of JRAB/MICAL-L2, UniProt ID of JRAB: Q3TN34) was aligned to that of human MICAL-CL (UniProt ID: Q6ZW33) using Ssearch with the MIQS matrix 29 , with the gap-open penalty set to 13. Then, the structural model was...”
- Conformational plasticity of JRAB/MICAL-L2 provides "law and order" in collective cell migration
Sakane, Molecular biology of the cell 2016 - “...from seven species (UniProt ID: Q8IY33 [ Homo sapiens ], G5BUG1 [ Heterocephalus glaber ], Q3TN34 [ Mus musculus ], G3GVG4 [ Cricetulus griseus ], D3ZEN0 [ Rattus norvegicus ], L5KC08 [ Pteropus alecto ], and L8Y7J9 [ Tupaia chinensis ]) using ClustalW ( Thompson et...”
NP_001092402 MICAL-like protein 2 from Bos taurus
Aligns to 713:845 / 883 (15.1%), covers 98.5% of PF12130, 142.1 bits
L5KC08 MICAL-like protein 2 from Pteropus alecto
Aligns to 522:654 / 686 (19.4%), covers 99.3% of PF12130, 140.9 bits
D6X075 MICAL-like protein 1 from Tribolium castaneum
Aligns to 733:875 / 942 (15.2%), covers 98.5% of PF12130, 140.2 bits
MILK2_HUMAN / Q8IY33 MICAL-like protein 2; Junctional Rab13-binding protein; Molecule interacting with CasL-like 2; MICAL-L2 from Homo sapiens (Human) (see 2 papers)
Aligns to 740:872 / 904 (14.7%), covers 99.3% of PF12130, 139.4 bits
- function: Effector of small Rab GTPases which is involved in junctional complexes assembly through the regulation of cell adhesion molecules transport to the plasma membrane and actin cytoskeleton reorganization. Regulates the endocytic recycling of occludins, claudins and E-cadherin to the plasma membrane and may thereby regulate the establishment of tight junctions and adherens junctions. In parallel, may regulate actin cytoskeleton reorganization directly through interaction with F-actin or indirectly through actinins and filamins. Most probably involved in the processes of epithelial cell differentiation, cell spreading and neurite outgrowth (By similarity).
subunit: Interacts with RAB13 (GTP-bound form); competes with RAB8A and is involved in tight junctions assembly. Interacts with RAB8A; competes with RAB13 and is involved in E-cadherin endocytic recycling (By similarity). Interacts with RAB8B (By similarity). Interacts (preferentially in opened conformation) with ACTN1 and ACTN4; stimulated by RAB13 activation (By similarity). Interacts (via calponin-homology (CH) domain) with the filamins FLNA, FLNB and FLNC (via actin-binding domain). - 20S proteasomes secreted by the malaria parasite promote its growth
Dekel, Nature communications 2021 - “...0 2 S E9PHG0 Kell blood group, metallo-endopeptidase 28 KEL 3 5 0 3 S Q8IY33 Mical like 2 143 MICALL2 5 6 3 1 S Q00013 Membrane palmitoylated protein 1 16 MPP1 0 3 0 0 T C9J6D1 Nucleosome assembly protein 1 like 4 53...”
- Adipose-Derived Mesenchymal Stem Cells Enhance Ovarian Cancer Growth and Metastasis by Increasing Thymosin Beta 4X-Linked Expression
Chu, Stem cells international 2019 - “...2.53 0.00338 Q9BY12 S phase cyclin A-associated protein in the endoplasmic reticulum SCAPER 2.48 0.00085 Q8IY33 MICAL-like protein 2 MICALL2 2.45 0.00080 Q9Y4F3 Meiosis regulator and mRNA stability factor 1 MARF1 2.37 0.00044 Q9UK12 Zinc finger protein 222 ZNF222 2.28 0.00085 J3QRZ1 Nuclear distribution protein nudE-like...”
- Specificity of Phosphorylation Responses to Mitogen Activated Protein (MAP) Kinase Pathway Inhibitors in Melanoma Cells.
Basken, Molecular & cellular proteomics : MCP 2018 - Conformational plasticity of JRAB/MICAL-L2 provides "law and order" in collective cell migration
Sakane, Molecular biology of the cell 2016 - “...structural features. We next generated a sequence alignment of JRAB/MICAL-L2 from seven species (UniProt ID: Q8IY33 [ Homo sapiens ], G5BUG1 [ Heterocephalus glaber ], Q3TN34 [ Mus musculus ], G3GVG4 [ Cricetulus griseus ], D3ZEN0 [ Rattus norvegicus ], L5KC08 [ Pteropus alecto ], and...”
- bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
Rai, eLife 2016 - “...ID Q8TDZ2, genomic location 6q21; Mical-L1: Uniprot ID Q8N3F8, genomic location 22q13.1; Mical-L2: Uniprot ID Q8IY33, genomic location 7p22.3; Mical-3: Uniprot ID Q7RTP6, genomic location 22q11.21; Mical-cL: Uniprot ID Q6ZW33, genomic location 11p15.3; EHBP1: Uniprot ID Q8NDI1, genomic location 2p15; EHBP1L1 Uniprot ID Q8N3D4, genomic location...”
- “...again colored in blue and green, respectively). Uniprot accession IDs are Q8TDZ2 (Mical-1), Q8N3F8 (Mical-L1), Q8IY33 (Mical-L2), Q7RTP6 (Mical-3), Q6ZW33 (Mical-cL), Q8NDI1 (EHBP1) and Q8N3D4 (EHBP1L1). DOI: http://dx.doi.org/10.7554/eLife.18675.015 10.7554/eLife.18675.016 Figure 6figure supplement 2. Structural comparison of the individual Rab binding sites in Mical-1. ( a )...”
MCA2B_DANRE / F1RA39 [F-actin]-monooxygenase mical2b; Molecule interacting with CasL protein 2B; MICAL-2; EC 1.14.13.225 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
XP_005174396 protein-methionine sulfoxide oxidase mical2b isoform X1 from Danio rerio
Aligns to 1530:1665 / 1679 (8.1%), covers 99.3% of PF12130, 139.3 bits
- function: Nuclear monooxygenase that promotes depolymerization of F- actin by mediating oxidation of specific methionine residues on actin and regulates the srf signaling. Acts by modifying nuclear actin subunits through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament severing and prevent repolymerization (By similarity). Acts as a key regulator of the srf signaling pathway elicited by nerve growth factor and serum: mediates oxidation and subsequent depolymerization of nuclear actin, leading to increase mkl1/mrtf-a presence in the nucleus and promote srf:mkl1/mrtf-a- dependent gene transcription (PubMed:24440334).
catalytic activity: H(+) + L-methionyl-[F-actin] + NADPH + O2 = H2O + L-methionyl- (R)-S-oxide-[F-actin] + NADP(+) (RHEA:51308)
cofactor: FAD
disruption phenotype: Small hearts that fail to undergo normal looping at 24 hours post-fertilization (hpf) with thin, linear morphology compared to wild-type hearts at 48 hpf. moreover, cardiomyocytes hearts are spatially disorganized. Defects in srf:mkl1/mrtf-a-dependent gene transcription. - Identification and expression analysis of mical family genes in zebrafish.
Xue, Journal of genetics and genomics = Yi chuan xue bao 2010 (PubMed)- GeneRIF: Data established an important basis for further functional studies of mical family genes in zebrafish, and suggest a possible role for mical genes in cardiovascular development.
G3GVG4 MICAL-like protein 2 (Fragment) from Cricetulus griseus
Aligns to 749:881 / 912 (14.6%), covers 98.5% of PF12130, 138.8 bits
G5BUG1 MICAL-like protein 2 (Fragment) from Heterocephalus glaber
Aligns to 752:884 / 913 (14.6%), covers 98.5% of PF12130, 136.9 bits
MICA2_HUMAN / O94851 [F-actin]-monooxygenase MICAL2; MICAL C-terminal-like protein; Mical-cL; Molecule interacting with CasL protein 2; MICAL-2; EC 1.14.13.225 from Homo sapiens (Human) (see 5 papers)
Aligns to 1809:1943 / 1957 (6.9%), covers 99.3% of PF12130, 136.8 bits
- function: Methionine monooxygenase that promotes depolymerization of F- actin by mediating oxidation of residues 'Met-44' and 'Met-47' on actin to form methionine-sulfoxide, resulting in actin filament disassembly and preventing repolymerization (PubMed:24440334, PubMed:29343822). Regulates the disassembly of branched actin networks also by oxidizing ARP3B-containing ARP2/3 complexes leading to ARP3B dissociation from the network (PubMed:34106209). Acts as a key regulator of the SRF signaling pathway elicited by nerve growth factor and serum: mediates oxidation and subsequent depolymerization of nuclear actin, leading to increase MKL1/MRTF-A presence in the nucleus and promote SRF:MKL1/MRTF- A-dependent gene transcription. Does not activate SRF:MKL1/MRTF-A through RhoA (PubMed:24440334).
catalytic activity: H(+) + L-methionyl-[F-actin] + NADPH + O2 = H2O + L-methionyl- (R)-S-oxide-[F-actin] + NADP(+) (RHEA:51308)
cofactor: FAD
subunit: Interacts with PLXNA4 (By similarity). Interacts with RAB1B (PubMed:15694364, PubMed:27552051). Interacts with MAPK1/ERK2 (By similarity). Interacts with RAB35, RAB8A, RAB10, RAB13 and RAB15 (in their GTP-bound forms); binding to RAB35 is of low affinity compared to other Rab proteins; at least in case of RAB8A may bind 2 molecules of RAB8A simultaneously through a high and a low affinity binding site, respectively (PubMed:27552051). May interact with MAPK1/ERK2 (By similarity). Interacts with CORO1C; this interaction recruits MICAL2 to the actin filaments (PubMed:34106209). - Defining regorafenib as a senomorphic drug: therapeutic potential in the age-related lung disease emphysema.
Park, Experimental & molecular medicine 2023 - “...KRT9 1.10 1.95 P04264 KRT1 0.95 1.55 Q01581 HMGCS 0.64 3.37 Q99988 GDF15 0.59 2.36 O94851 MICAL2 0.55 2.92 Q4L180 COL4A3BPIP 0.52 2.59 P62987 UBA52 0.52 2.46 P02795 MT2A 0.51 2.41 Q96NE9 FRMD6 0.51 1.98 Q96PD2 DCBLD2 0.49 2.32 Q8IVM0 CCDC50 0.49 1.65 P05121 PAI-1 0.48...”
- MICAL, the flavoenzyme participating in cytoskeleton dynamics.
Vanoni, International journal of molecular sciences 2013 - “...6q21 NM_022765 NP_073602 1067 64780 Q8TDZ2 Figure 4 MICAL2 human 11p15 NM_014632 NP_055447 1124 9645 O94851 Figure 4 MICAL3 human 22q11.21 NM_015241 NP_056056 2002 57553 Q7RTP6 Figure 4 MICAL1 mouse 10 B1-B2 NM_138315 NP_612188 1048 171580 Q8VDP3 Figure 4 MICAL2 mouse 7E3 NM_001193305 NP_001180234 1102 320878...”
- Protein profiling of human nonpigmented ciliary epithelium cell secretome: the differentiation factors characterization for retinal ganglion cell line.
Yang, Journal of biomedicine & biotechnology 2011 - “...growth, neuron differentiation 1-31 Q8WUT4 Uncharacterized protein C20orf75 precursor 78794 37 Membrane 5% Protein binding O94851 Protein MICAL-2 126609 40 Cytoplasm 1% Monooxygenase activity, zinc ion binding Metabolic process Q9Y333 U6 snRNA-associated Sm-like protein LSm2 10828 69 Nucleus 20% Protein/U6 snRNA binding Nuclear mRNA splicing These...”
- “...mitochondria. Has a microtubule plus end-directed motility O75095 Multiple epidermal growth factor-like domains 6 precursor O94851 Protein MICAL-2 O94985 Calsyntenin-1 precursor Induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, stabilizes APP metabolism and enhances...”
XP_003201274 F-actin-methionine sulfoxide oxidase mical1 isoform X1 from Danio rerio
E7F9T0 [F-actin]-monooxygenase mical1 from Danio rerio
Aligns to 1066:1197 / 1214 (10.9%), covers 97.8% of PF12130, 135.6 bits
- MICAL, the flavoenzyme participating in cytoskeleton dynamics
Vanoni, International journal of molecular sciences 2013 - “...4 MICAL3 macaque 10 XM_001103660 XP_001103660 2001 710292 Figure 4 MICAL1 D. rerio 23 XM_003201226 XP_003201274 1214 568573 E7F9T0 Predicted as MICAL3, Figure 4 MICAL2 D. rerio 25 JX291155 AFS28884 1120 569564 Figure 4 MICAL3 D. rerio 18 1994 567456 F1QH17.2 Authentic according to UniPro; Figure...”
- MICAL, the flavoenzyme participating in cytoskeleton dynamics
Vanoni, International journal of molecular sciences 2013 - “...10 XM_001103660 XP_001103660 2001 710292 Figure 4 MICAL1 D. rerio 23 XM_003201226 XP_003201274 1214 568573 E7F9T0 Predicted as MICAL3, Figure 4 MICAL2 D. rerio 25 JX291155 AFS28884 1120 569564 Figure 4 MICAL3 D. rerio 18 1994 567456 F1QH17.2 Authentic according to UniPro; Figure 4 MICAL drosophila...”
MICA2_MOUSE / Q8BML1 [F-actin]-monooxygenase MICAL2; ERK2-binding testicular protein 1; MICAL C-terminal-like protein; Mical-cL; Molecule interacting with CasL protein 2; MICAL-2; mMical2; EC 1.14.13.225 from Mus musculus (Mouse) (see 5 papers)
Q8BML1 F-actin monooxygenase (EC 1.14.13.225) from Mus musculus (see paper)
Aligns to 1802:1937 / 1951 (7.0%), covers 99.3% of PF12130, 134.1 bits
- function: Methionine monooxygenase that promotes depolymerization of F- actin by mediating oxidation of residues 'Met-44' and 'Met-47' on actin to form methionine-sulfoxide, resulting in actin filament disassembly and preventing repolymerization (PubMed:23911929, PubMed:23927065). Regulates the disassembly of branched actin networks also by oxidizing ARP3B-containing ARP2/3 complexes leading to ARP3B dissociation from the network. Acts as a key regulator of the SRF signaling pathway elicited by nerve growth factor and serum: mediates oxidation and subsequent depolymerization of nuclear actin, leading to increase MKL1/MRTF-A presence in the nucleus and promote SRF:MKL1/MRTF-A- dependent gene transcription. Does not activate SRF:MKL1/MRTF-A through RhoA (By similarity).
catalytic activity: H(+) + L-methionyl-[F-actin] + NADPH + O2 = H2O + L-methionyl- (R)-S-oxide-[F-actin] + NADP(+) (RHEA:51308)
cofactor: FAD
subunit: Interacts with PLXNA4 (PubMed:12110185). Interacts with RAB1B (By similarity). Interacts with MAPK1/ERK2 (PubMed:18241670, PubMed:18590835). Interacts with RAB1B, RAB35, RAB8A, RAB10, RAB13 and RAB15 (in their GTP-bound forms); binding to RAB1B and RAB35 is of low affinity compared to other Rab proteins; binding to RAB1B and RAB35 is of low affinity compared to other Rab proteins; at least in case of RAB8A may bind 2 molecules of RAB8A simultaneously through a high and a low affinity binding site, respectively (By similarity). - A quantitative proteomic approach to prion disease biomarker research: delving into the glycoproteome
Wei, Journal of proteome research 2011 - “...1 8 P02089 0, 0 Hemoglobin subunit beta-2 0.99 56.5 0.40 1.32 0.16 1 6 Q8BML1 2, 0 Protein MICAL-2 0.96 4 0.39 1.35 0.98 2 4 P12382 2, 0 6-phosphofructokinase, liver type 0.82 5 0.38 1.40 0.78 1 10 Q9CWS0 1, 0 N(G),N(G)-dimethylarginine dimethylaminohydrolase 1...”
NP_872610 [F-actin]-monooxygenase MICAL2 isoform 3 from Rattus norvegicus
Aligns to 539:673 / 687 (19.7%), covers 99.3% of PF12130, 133.6 bits
- Proteomic analysis of lamellar bodies isolated from rat lungs
Wang, BMC cell biology 2008 - “...Transferrin AAP97736 14 19 80 76346 Ferroxidase precursor A35210 11 9 122 120588 RSB-11-77 protein NP_872610 12 28 75 42058 Cytochrome b5 AAB67609 13 27 78 11400 The functional classification was performed by a literature search in the Pubmed database. The functional categories include calcium-binding proteins,...”
NP_001136087 EH domain-binding protein 1 isoform 3 from Homo sapiens
Aligns to 1003:1139 / 1160 (11.8%), covers 98.5% of PF12130, 131.9 bits
- Association study between common variations in some candidate genes and prostate adenocarcinoma predisposition through multi-stage approach in Iranian population.
Beikzadeh, BMC medical genetics 2020 - GeneRIF: The purpose of this study was to evaluate the association of rs16901979, rs4242382 and rs1447295 on 8q24 locus, rs2735839 (KLK3 gene) and rs721048 (EHBP1 gene) with prostate adenocarcinoma through multi-stage approach to identify the polymorphisms associated with prostate cancer and use them as screening factors
- The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members.
Rai, Nature communications 2020 - GeneRIF: The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members.
- Meta-analysis of genome-wide and replication association studies on prostate cancer.
Liu, The Prostate 2011 (PubMed)- GeneRIF: Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
- Evidence for an association between prostate cancer and chromosome 8q24 and 10q11 genetic variants in African American men: the Flint Men's Health Study.
Wang, The Prostate 2011 - GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- Inherited genetic markers discovered to date are able to identify a significant number of men at considerably elevated risk for prostate cancer.
Sun, The Prostate 2011 - GeneRIF: Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
- Validation of genome-wide prostate cancer associations in men of African descent.
Chang, Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2011 - GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- Association of 17 prostate cancer susceptibility loci with prostate cancer risk in Chinese men.
Zheng, The Prostate 2010 - GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- Replication of prostate cancer risk loci on 8q24, 11q13, 17q12, 19q33, and Xp11 in African Americans.
Hooker, The Prostate 2010 (PubMed)- GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- More
EHBP1_HUMAN / Q8NDI1 EH domain-binding protein 1 from Homo sapiens (Human) (see 3 papers)
Aligns to 1074:1210 / 1231 (11.1%), covers 98.5% of PF12130, 131.7 bits
- function: May play a role in actin reorganization. Links clathrin- mediated endocytosis to the actin cytoskeleton. May act as Rab effector protein and play a role in vesicle trafficking (PubMed:14676205, PubMed:27552051). Required for perinuclear sorting and insulin- regulated recycling of SLC2A4/GLUT4 in adipocytes (By similarity).
subunit: Interacts with EHD1 (By similarity). Interacts with EHD2. Interacts with RAB8A, RAB10, RAB13 and RAB15 (in their GTP-bound forms); at least in case of RAB8A may bind 2 molecules of RAB8A simultaneously through a high and a low affinity binding site, respectively. - Overexpression of SERPINA3 suppresses tumor progression by modulating SPOP/NF‑κB in lung cancer
Jin, International journal of oncology 2023 - “...region-related protein 97.598 1.250 0.037 Q96B97 SH3KBP1 SH3 domain-containing kinase-binding protein 1 73.126 1.240 0.031 Q8NDI1 EHBP1 EH domain-binding protein 1 140.017 1.238 0.011 Q99956 DUSP9 Dual specificity protein phosphatase 9 41.868 1.225 0.040 P10909 CLU Clusterin 52.495 1.217 0.024 Q69YN2 CWF19L1 CWF19-like protein 1 60.619...”
- Identifying proteomic risk factors for overall, aggressive and early onset prostate cancer using Mendelian randomization and tumor spatial transcriptomics.
Desai, medRxiv : the preprint server for health sciences 2023 - “...1.32E-165 1.00 0.83 (0.810.85) 0.85 (0.800.91) Phase I (Prostate Cancer therapy; PCK-3145) EHBP1 rs73934251 0.53% Q8NDI1 SomaScan 1.89 (1.63 2.19) 8.09E-18 0.98 2.09 (1.662.65) TPM3 rs72696208 0.68% P06753 SomaScan 0.64 (0.57 0.72) 2.72E-13 0.94 0.64 (0.530.77) Phenethyl Isothiocyanate PRSS3 rs2005617 14.50% P35030 SomaScan 0.91 (0.89 0.94)...”
- “...P00747 SomaScan 0.26 (0.140.46) 4.07E-06 1.00 IVW P00747 SomaScan 0.57 (0.360.91) 1.60E-02 EHBP1 rs73934251 0.53% Q8NDI1 SomaScan 2.90 (2.04.2) 2.60E-08 0.98 TPM3 rs72696208 0.68% P06753 SomaScan 0.47 (0.340.64) 1.92E-06 0.95 Phenethyl Isothiocyanate 1 Drug discontinued (Neurological Cancer therapy; anisi PYY rs8074783 0.00% P10082 SomaScan 1.87 (1.432.44)...”
- Hepatitis C virus alters the morphology and function of peroxisomes.
Martin, Frontiers in microbiology 2023 - “...and leucine-rich protein 1 Q8IZL8 119,701 2 0 0 0 2% EH domain-binding protein 1 Q8NDI1 140,021 2 0 0 0 2% Pre-B-cell leukemia transcription factor-interacting protein 1 Q96AQ6 80,643 2 0 0 0 3% Dedicator of cytokinesis protein 7 Q96N67 242,566 2 0 0 0...”
- Lactate Dehydrogenase B and Pyruvate Oxidation Pathway Associated With Carfilzomib-Related Cardiotoxicity in Multiple Myeloma Patients: Result of a Multi-Omics Integrative Analysis
Tantawy, Frontiers in cardiovascular medicine 2021 - “...Insulin-like growth factor-binding protein 2 7.67 0.00169 Q9Y5Z9 UbiA prenyltransferase domain-containing protein 1 1.66 0.00169 Q8NDI1 EH domain-binding protein 1 1.77 0.00252 B3KT58 cDNA FLJ37685 fis, clone BRHIP2013972 0.27 0.00268 Q96L14 Cep170-like protein 0.07 0.00308 A0A087WZT2 Methyltransferase-like protein 7B 0.25 0.00341 A6NKC6 Retinitis pigmenta 1-like 1...”
- Hepatitis C virus core protein targets 4E-BP1 expression and phosphorylation and potentiates Myc-induced liver carcinogenesis in transgenic mice.
Abdallah, Oncotarget 2017 - “...SRP72 O76094 Signal recognition particle 72 kDa protein TVSSPPTS(ph)PRPGS(ph)AATVSASTSNIIPPR S(0.31)S(0.354) S625/S630 _ 2.03 1.81 EHBP1 Q8NDI1 EH domain-binding protein 1 DLSTS(ph)PKPSPIPS(ph)PVLGR S(0.739)S(0.998) S428/S436 1.67 _ 2 DLSTS(ph)PKPS(ph)PIPS(ph)PVLGR S(0.401)S(1)S(1) S428/S432/S436 1.52 2.29 2 TMPO P42167 Lamina-associated polypeptide 2, isoforms beta/gamma GPPDFS(ph)S(ph)DEEREPT(ph)PVLGSGAAAAGR S(1)S(1)T(0.987) S66/S67/T74 _ 2.08 1.52 SEC16A...”
- Combining patient proteomics and in vitro cardiomyocyte phenotype testing to identify potential mediators of heart failure with preserved ejection fraction
Raphael, Journal of translational medicine 2016 - “...finger FYVE domain-containing protein 1 CJ076 Q5T2E6 UPF0668 protein C10orf76 STAB 1 Q9NY15 Stabilin-1 EHBP1 Q8NDI1 EH domain-binding protein 1 ANR24 Q8TF21 Ankyrin repeat domain-containing protein 24 FAHD1 Q6P587 Acylpyruvase FAHD1, mitochondrial IWS1 Q96ST2 Protein IWS1 homolog THAP2 Q9H0W7 THAP domain-containing protein 2 FNIP1 Q8TF40 Folliculin-interacting...”
- bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
Rai, eLife 2016 - “...ID Q7RTP6, genomic location 22q11.21; Mical-cL: Uniprot ID Q6ZW33, genomic location 11p15.3; EHBP1: Uniprot ID Q8NDI1, genomic location 2p15; EHBP1L1 Uniprot ID Q8N3D4, genomic location 11q13.1). The reader is referred to the main text for further details. DOI: http://dx.doi.org/10.7554/eLife.18675.002 According to the SMART database ( Schultz...”
- “...respectively). Uniprot accession IDs are Q8TDZ2 (Mical-1), Q8N3F8 (Mical-L1), Q8IY33 (Mical-L2), Q7RTP6 (Mical-3), Q6ZW33 (Mical-cL), Q8NDI1 (EHBP1) and Q8N3D4 (EHBP1L1). DOI: http://dx.doi.org/10.7554/eLife.18675.015 10.7554/eLife.18675.016 Figure 6figure supplement 2. Structural comparison of the individual Rab binding sites in Mical-1. ( a ) Cartoon representation of the Rab10:Mical-1:Rab10 complex...”
- Phyllanthus Suppresses Prostate Cancer Cell, PC-3, Proliferation and Induces Apoptosis through Multiple Signalling Pathways (MAPKs, PI3K/Akt, NFκB, and Hypoxia).
Tang, Evidence-based complementary and alternative medicine : eCAM 2013 - “...1.62 3 P63261 Actin, cytoplasmic 2 1.43 1.53 1.21 1.53 1.74 1.79 1.72 1.53 4 Q8NDI1 EH domain-binding protein 1 1.32 1.32 1.21 1.13 1.42 1.32 1.43 1.43 5 P04792 Heat shock protein beta-1 1.43 1.32 1.54 1.54 1.42 1.43 1.32 1.25 6 P35527 Keratin, type...”
F1LVX2 EH domain binding protein 1 from Rattus norvegicus
Aligns to 1070:1206 / 1227 (11.2%), covers 98.5% of PF12130, 130.8 bits
- Construction of the experimental rat model of gestational diabetes
Chen, PloS one 2022 - “...D3ZPF2 Malonyl-CoA-acyl carrier protein transacylase Mcat 0.00361 Up D4A7B6 Transmembrane protein 87B Tmem87b 0.01044 Up F1LVX2 EH domain-binding protein 1 Ehbp1 0.02359 Down F1LPV2 Very low-density lipoprotein receptor Vldlr 0.04171 Down G3V7V5 Peptidylprolyl isomerase Fkbp11 0.04352 Down M0RBK3 Zinc finger protein 36, C3H1 type-like 2-like LOC100911319...”
NP_001292059 EH domain-binding protein 1 from Rattus norvegicus
Aligns to 1045:1181 / 1202 (11.4%), covers 98.5% of PF12130, 130.8 bits
EHBP1_MOUSE / Q69ZW3 EH domain-binding protein 1 from Mus musculus (Mouse) (see paper)
Aligns to 1074:1210 / 1231 (11.1%), covers 98.5% of PF12130, 130.7 bits
- function: May play a role in actin reorganization. Links clathrin- mediated endocytosis to the actin cytoskeleton. May act as Rab effector protein and play a role in vesicle trafficking (By similarity). Required for perinuclear sorting and insulin-regulated recycling of SLC2A4/GLUT4 in adipocytes.
subunit: Interacts with EHD1 (PubMed:15247266). Interacts with EHD2. Interacts with RAB8A, RAB10, RAB13 and RAB15 (in their GTP-bound forms); at least in case of RAB8A may bind 2 molecules of RAB8A simultaneously through a high and a low affinity binding site, respectively (By similarity). - Integrated analysis of proteome and transcriptome changes in the mucopolysaccharidosis type VII mouse hippocampus
Parente, Molecular genetics and metabolism 2016 - “...Q5XJV6 Lmtk3 lemur tyrosine kinase 3 Q64152 Btf3 predicted gene 9308; basic transcription factor 3; Q69ZW3 Ehbp1 EH domain binding protein 1 Q6A065 Cep170 centrosomal protein 170 Q6NVE8 Wdr44 WD repeat domain 44 Q6PAR5 Gapvd1 GTPase activating protein and VPS9 domains 1 Q6PDI5 Ecm29 expressed sequence...”
- A quantitative proteomic approach to prion disease biomarker research: delving into the glycoproteome
Wei, Journal of proteome research 2011 - “...P47878 3, 3 Insulin-like growth factor-binding protein 3 0.99 21.6 0.46 1.12 0.31 1 2 Q69ZW3 7, 0 EH domain-binding protein 1 0.98 3.3 0.45 1.16 0.55 3 11 Q3TNU4 6, 0 Putative uncharacterized protein ENSP00000382790 homolog 0.96 4.1 0.42 1.26 0.00 1 1 Q9D306 4,...”
XP_011241983 EH domain-binding protein 1 isoform X1 from Mus musculus
Aligns to 1100:1236 / 1257 (10.9%), covers 98.5% of PF12130, 130.7 bits
XP_005273926 EH domain-binding protein 1-like protein 1 isoform X8 from Homo sapiens
Aligns to 675:811 / 835 (16.4%), covers 98.5% of PF12130, 130.0 bits
Q9VU34 LD45758p from Drosophila melanogaster
Aligns to 782:933 / 1010 (15.0%), covers 99.3% of PF12130, 129.0 bits
- The Roles of the LIM Domain Proteins in Drosophila Cardiac and Hematopoietic Morphogenesis
She, Frontiers in cardiovascular medicine 2021 - “...nuclei, Yolk nuclei, Zygotic Midgut, Muscle system, Morsal prothoracic, Pharyngeal muscle LIM protein FBgn0036333 Mical-like Q9VU34 API Malpighiantubule, Midgut, Trunk mesoderm LIM protein FBgn0265991 Zasp52 A1ZA47 , A0A0B4KER6 , A0A0B4KEW3 , A0A0B4KFR8 , A0A0B4LGL0 , C1C3E7 G3JX28 , G3JX25 G3JX27 , G3JX29 G3JX30 , G3JX31 ,...”
- Satellite DNA-like elements associated with genes within euchromatin of the beetle Tribolium castaneum
Brajković, G3 (Bethesda, Md.) 2012 - “...3 33,523 Q9VYB7 FBgn0086674 Satellite 222 0.6 D6X075 658603 MICAL-like protein 9 15 5 39,684 Q9VU34 FBgn0036333 Satellite 203 0.6 D6X1P2 658891 tiptop 9 15 3 142,821 Q9U3V5 FBgn0028979 Satellite 203 0.6 D6X095 659195 Troponin C 9 16 5 3922 P47947 FBgn0013348 Transposon 589 D6X0I1 659336...”
- Exploration of novel motifs derived from mouse cDNA sequences
Kawaji, Genome research 2002 - “...(DMEL)CG11259 [variant], AAK93415; DMEL)CG11259, Q9VU34; (MMU)EST57332, 4930438G05; (MMU)EST57332 [variant], 4933434L05; (HSA)KIAA1668, Q9BY92; (HSA)KIAA1668...”
EH1L1_HUMAN / Q8N3D4 EH domain-binding protein 1-like protein 1 from Homo sapiens (Human) (see paper)
Aligns to 1363:1499 / 1523 (9.0%), covers 98.5% of PF12130, 128.9 bits
- function: May act as Rab effector protein and play a role in vesicle trafficking.
subunit: Interacts with RAB8A, RAB10, RAB13 and RAB15 (in their GTP- bound forms); at least in case of RAB8A can bind 2 molecules of RAB8A simultaneously; ternary complex formation of RAB8A, RAB13 and EHBP1L1 is possible. - 20S proteasomes secreted by the malaria parasite promote its growth
Dekel, Nature communications 2021 - “...S Q7L9B9 Endonuclease/exonuclease/ phosphatase family domain containing 1 173 EEPD1 3 4 0 2 S Q8N3D4 EH domain binding protein 1 like 1 191 EHBP1L1 2 1 0 0 S E7EX73 Eukaryotic translation initiation factor 4gamma 1 1046 EIF4G1 2 1 0 0 S P11171 Erythrocyte...”
- Identification of Candidate Protein Markers in Skeletal Muscle of Laminin-211-Deficient CMD Type 1A-Patients
Kölbel, Frontiers in neurology 2019 - “...( HMGN3 ) Nucleus 2.45 1.29 Regulates chromatin-dependent processes such as transcription, DNA-replication and -repair Q8N3D4 3/3 0.04 EH domain-binding protein 1-like protein 1 ( EHBP1L1 ) Endosome 2.39 1.26 Rab effector protein playing a role in vesicle trafficking Q9UEY8 3/3 0.03 Gamma-adducin ( ADD3 )...”
- Standardization of a protocol for shotgun proteomic analysis of saliva
Ventura, Journal of applied oral science : revista FOB 2018 - “...DNA polymerase 269.07 5.03 Q5T4S7 E3 ubiquitin-protein ligase UBR4 22.83 2.70 Q92838 Ectodysplasin-A 258.64 15.86 Q8N3D4 EH domain-binding protein 1-like protein 1 260.45 4.33 Q6P179 Endoplasmic reticulum aminopeptidase 2 522.88 7.92 Q7L775 EPM2A-interacting protein 1 277.97 2.80 Q9H501 ESF1 homolog 205.30 12.22 A0A1B0GUN9 Espin 59.79 6.02...”
- Intrinsically disordered linkers determine the interplay between phase separation and gelation in multivalent proteins.
Harmon, eLife 2017 - “...Q7Z2Y5 NNRKGRGGNRGREFRGEENGIDCNQVDKPSDRGKRARGRG 0.45 0.15 0.76 Q5T6F2 QKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGFSRDAKM 0.40 0.10 0.75 Q9UMZ2 AEMKVLESPENKSGTFKAQEAEAGVLGNEKGKEAEGSLTE 0.35 0.10 0.78 Q8N3D4 MAAAESDKDSGFSDGSSECLSSAEQMESEDMLSALGWSRE 0.30 0.20 0.78 Q9C0C6 DHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSF 0.25 0.05 0.68 Q9NQI0 TAVSTSGPEDICSSSSSHERGGEATWSGSEFEVSFLDSPG 0.20 0.15 0.80 Q9BQQ3 FSTLGRLRNGIGGAAGIPRANASRTNFSSHTNQSGGSELR 0.15 0.10 0.73 Q9Y252 KSSSQTSGSLVSKSTSLASVSQLASKSSSQTSTSQLPSKS 0.10 0.10 0.85 Q9NXV6 *FCR: Fraction of charged residues...”
- bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
Rai, eLife 2016 - “...ID Q6ZW33, genomic location 11p15.3; EHBP1: Uniprot ID Q8NDI1, genomic location 2p15; EHBP1L1 Uniprot ID Q8N3D4, genomic location 11q13.1). The reader is referred to the main text for further details. DOI: http://dx.doi.org/10.7554/eLife.18675.002 According to the SMART database ( Schultz et al., 1998 ), this largely uncharacterized...”
- “...IDs are Q8TDZ2 (Mical-1), Q8N3F8 (Mical-L1), Q8IY33 (Mical-L2), Q7RTP6 (Mical-3), Q6ZW33 (Mical-cL), Q8NDI1 (EHBP1) and Q8N3D4 (EHBP1L1). DOI: http://dx.doi.org/10.7554/eLife.18675.015 10.7554/eLife.18675.016 Figure 6figure supplement 2. Structural comparison of the individual Rab binding sites in Mical-1. ( a ) Cartoon representation of the Rab10:Mical-1:Rab10 complex (centre) and selected...”
NP_001137683 Eps15 homology domain containing protein-binding protein 1, isoform I from Drosophila melanogaster
Aligns to 839:975 / 994 (13.8%), covers 100.0% of PF12130, 126.6 bits
Q5PQM3 Ehbp1l1 protein from Rattus norvegicus
Aligns to 602:738 / 762 (18.0%), covers 98.5% of PF12130, 126.4 bits
NP_001108067 EH domain-binding protein 1-like protein 1 isoform C from Mus musculus
Aligns to 602:738 / 762 (18.0%), covers 98.5% of PF12130, 126.0 bits
E9QP49 EH domain binding protein 1-like 1 from Mus musculus
Aligns to 1558:1694 / 1718 (8.0%), covers 98.5% of PF12130, 124.4 bits
EH1L1_MOUSE / Q99MS7 EH domain-binding protein 1-like protein 1; Tangerin from Mus musculus (Mouse) (see paper)
Aligns to 1556:1692 / 1716 (8.0%), covers 98.5% of PF12130, 124.4 bits
- function: May act as Rab effector protein and play a role in vesicle trafficking (By similarity). Involved in apical-directed transport in polarized epithelial cells; the functions seems to implicate Rab8, BIN1 and possibly DNM1 (PubMed:26833786).
subunit: Interacts with RAB8A, RAB8B, RAB10, RAB13 and RAB15 (in their GTP-bound forms); at least in case of RAB8A can bind 2 molecules of RAB8A simultaneously. Interacts with BIN1 and AMPH. Interacts with DNM1. - Comparative Proteomic Analysis of tPVAT during Ang II Infusion.
Liang, Biomedicines 2021 - “...Q9CRB8 MTFP1 Mitochondrial fission process protein 1 P51912 SLC1A5 Neutral amino acid transporter B (0) Q99MS7 EHBP1L1 EH domain-binding protein 1-like protein 1 Q8BPB5 EFEMP1 EGF-containing fibulin-like extracellular matrix protein 1 Q61029 TMPO Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma Q64373 BCL2L1 Bcl-2-like protein 1 Q91YU6 LZTS2 Leucine...”
- Use of Proteomic Imaging Coupled With Transcriptomic Analysis to Identify Biomolecules Responsive to Cochlear Injury
Noble, Frontiers in molecular neuroscience 2018 - “...Q62188 62 2 0 Dynamin-1 P39053 98 0 2 EH domain-binding protein 1-like protein 1 Q99MS7 185 0 2 Electron transfer flavoprotein subunit alpha, mitochondrial Q99LC5 35 1 2 Elongation factor 1-alpha 1 P10126 50 6 3 Elongation factor 2 P58252 95 2 0 Endoplasmin P08113...”
- Global phosphoproteomics identifies a major role for AKT and 14-3-3 in regulating EDC3.
Larance, Molecular & cellular proteomics : MCP 2010
H0V032 F-actin monooxygenase from Cavia porcellus
Aligns to 939:1068 / 1068 (12.2%), covers 94.8% of PF12130, 120.8 bits
- MICAL, the flavoenzyme participating in cytoskeleton dynamics.
Vanoni, International journal of molecular sciences 2013 - “...NM_001191085 NP_001178014 1997 362427 - Figure 4 MICAL1 guinea pig - XM_003466042 XP_003466090 1058 100715118 H0V032 Figure4 MICAL2 guinea pig - XM_003465749 XP_003465749 1105 100735168 - Figure 4 MICAL3 guinea pig - XM_003461762 XP_003461810 2005 100726239 Figure 4 MICAL1 macaque 4 XM_002803949 XP_002803995 1065 698737 Figure...”
MICA1_HUMAN / Q8TDZ2 [F-actin]-monooxygenase MICAL1; Molecule interacting with CasL protein 1; MICAL-1; NEDD9-interacting protein with calponin homology and LIM domains; EC 1.14.13.225; EC 1.6.3.1 from Homo sapiens (Human) (see 11 papers)
Q8TDZ2 F-actin monooxygenase (EC 1.14.13.225) from Homo sapiens (see 2 papers)
Aligns to 931:1061 / 1067 (12.3%), covers 94.8% of PF12130, 118.0 bits
- function: Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin to form methionine-sulfoxide, resulting in actin filament disassembly and preventing repolymerization (PubMed:29343822). In the absence of actin, it also functions as a NADPH oxidase producing H(2)O(2) (PubMed:21864500, PubMed:26845023, PubMed:29343822). Acts as a cytoskeletal regulator that connects NEDD9 to intermediate filaments. Also acts as a negative regulator of apoptosis via its interaction with STK38 and STK38L; acts by antagonizing STK38 and STK38L activation by MST1/STK4. Involved in regulation of lamina-specific connectivity in the nervous system such as the development of lamina-restricted hippocampal connections. Through redox regulation of the actin cytoskeleton controls the intracellular distribution of secretory vesicles containing L1/neurofascin/NgCAM family proteins in neurons, thereby regulating their cell surface levels (By similarity). May act as Rab effector protein and play a role in vesicle trafficking. Promotes endosomal tubule extension by associating with RAB8 (RAB8A or RAB8B), RAB10 and GRAF (GRAF1/ARHGAP26 or GRAF2/ARHGAP10) on the endosomal membrane which may connect GRAFs to Rabs, thereby participating in neosynthesized Rab8-Rab10-Rab11-dependent protein export (PubMed:32344433).
catalytic activity: H(+) + L-methionyl-[F-actin] + NADPH + O2 = H2O + L-methionyl- (R)-S-oxide-[F-actin] + NADP(+) (RHEA:51308)
catalytic activity: H(+) + NADPH + O2 = H2O2 + NADP(+) (RHEA:11260)
cofactor: FAD
subunit: Interacts with STK38 and STK38L (By similarity). Interacts with RAB1B, RAB8A, RAB10, RAB13 and RAB15 (in their GTP-bound forms); binding to RAB1B is of low affinity compared to other Rab proteins; at least in case of RAB8A and RAB10 can bind 2 molecules of the Rab proteins simultaneously; ternary complex formation of RAB8A, RAB13 and MICAL1 is possible. Associates with the SH3 domain of NEDD9. Interacts with VIM and PLXNA3. Interacts with RAB1B. Interacts with GRAF1/ARHGAP26, GRAF2/ARHGAP10, RAB8A, RAB8B and RAB10; may bind simultaneously to GRAFs and Rabs and connects GRAFs to Rabs (PubMed:32344433). Does not interact with RAB1 and RAB11A (PubMed:32344433). - Insight Into the Metabolic Adaptations of Electrically Pulse-Stimulated Human Myotubes Using Global Analysis of the Transcriptome and Proteome.
Mengeste, Frontiers in physiology 2022 - “...nucleotide-binding protein 1 4,66E-02 3,19 Q9UPY8;Q15555 MAPRE3 Microtubule-associated protein RP/EB family member 3 3,05E-03 3,15 Q8TDZ2 MICAL1 Protein-methionine sulfoxide oxidase MICAL1 8,06E-03 3,09 Q5BKX8 MURC Muscle-related coiled-coil protein 5,83E-03 3,04 P60891;P11908;P21108 PRPS1; PRPS2 Ribose-phosphate pyrophosphokinase 1;Ribose-phosphate pyrophosphokinase 2 3,86E-02 2,95 P21980 TGM2 Protein-glutamine gamma-glutamyltransferase 2 3,60E-02...”
- Proteomic analysis of the umbilical cord in fetal growth restriction and preeclampsia.
Conrad, PloS one 2022 - “...dehydrogenase [ubiquinone] iron-sulfur protein 3 1.79 P20810 Calpastatin 1.84 P52566 Rho GDP-dissociation inhibitor 2 1.88 Q8TDZ2 [F-actin]-monooxygenase MICAL1 1.94 P01236 Prolactin 2.00 P19827 Inter-alpha-trypsin inhibitor heavy chain H1 2.04 P12956 X-ray repair cross-complementing protein 6 2.04 P20700 Lamin-B1 2.12 P06702 Protein S100-A9 2.22 P07476 Involucrin 2.28...”
- Structural Characteristics, Binding Partners and Related Diseases of the Calponin Homology (CH) Domain.
Yin, Frontiers in cell and developmental biology 2020 - “...identifiers for CH1 (-actinin), CH2 (MICAL, Molecule interacting with CasL) and CH3 (calponin-1) are P12814, Q8TDZ2, P51911. (B) The tertiary fold of the calponin CH domain (PDB: 1H67). The CH domain contains in total six -helices. Helices III and VI are approximately parallel, while helix IV...”
- Actin Cytoskeletal Reorganization Function of JRAB/MICAL-L2 Is Fine-tuned by Intramolecular Interaction between First LIM Zinc Finger and C-terminal Coiled-coil Domains.
Miyake, Scientific reports 2019 - “...of the LIM domain in JRAB/MICAL-L2 was aligned to that of human MICAL-1 (UniProt ID: Q8TDZ2), which is 86.7% similar at the sequence level 29 . The structure was modeled based on the alignment and structure of the LIM domain of MICAL-1 (PDBID: 2CO8) 30 by...”
- Angiogenic and Immunologic Proteins Identified by Deep Proteomic Profiling of Human Retinal and Choroidal Vascular Endothelial Cells: Potential Targets for New Biologic Drugs.
Smith, American journal of ophthalmology 2018 - “...tyrosine phosphatase beta; R-PTP-beta) P23467 1.87 1.6689E-03 Ugl-Y3 P02751 2.07 3.9674E-04 Protein-methionine sulfoxide oxidase MICAL1 Q8TDZ2 1.92 4.7574E-03 Apolipoprotein L2 Q9BQE5 1.89 8.6603E-04 OCIA domain-containing protein 2 Q56VL3 1.92 1.8040E-03 Insulin-like growth factor-binding protein 7 (IBP-7; IGF- binding protein 7; IGFBP-7) Q16270 1.89 4.8961E-05 E3 ubiquitin-protein...”
- bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
Rai, eLife 2016 - “...with multiple known splice variants, domain boundaries are indicated for isoform 1 (Mical-1: Uniprot ID Q8TDZ2, genomic location 6q21; Mical-L1: Uniprot ID Q8N3F8, genomic location 22q13.1; Mical-L2: Uniprot ID Q8IY33, genomic location 7p22.3; Mical-3: Uniprot ID Q7RTP6, genomic location 22q11.21; Mical-cL: Uniprot ID Q6ZW33, genomic location...”
- “...and C-terminal halves are again colored in blue and green, respectively). Uniprot accession IDs are Q8TDZ2 (Mical-1), Q8N3F8 (Mical-L1), Q8IY33 (Mical-L2), Q7RTP6 (Mical-3), Q6ZW33 (Mical-cL), Q8NDI1 (EHBP1) and Q8N3D4 (EHBP1L1). DOI: http://dx.doi.org/10.7554/eLife.18675.015 10.7554/eLife.18675.016 Figure 6figure supplement 2. Structural comparison of the individual Rab binding sites in...”
- OTUB1 de-ubiquitinating enzyme promotes prostate cancer cell invasion in vitro and tumorigenesis in vivo.
Iglesias-Gato, Molecular cancer 2015 - “...1.56 (0.02) SNX2 O60749 0.82 1.84 1.33 (0.72) BLMH Q13867 1.44 1.09 1.27 (0.25) MICAL1 Q8TDZ2 1.02 1.43 1.23 (0.29) WDR7 Q9Y4E6 1.17 1.26 1.21 (0.06) MALT1 Q9UDY8 1.28 0.99 1.13 (0.2) RAB8A P61006 0.75 1.23 0.99 (0.34) NOC2L Q9Y3T9 1.04 0.89 0.96 (0.1) ARHGAP35 Q9NRY4...”
- MICAL, the flavoenzyme participating in cytoskeleton dynamics.
Vanoni, International journal of molecular sciences 2013 - “...Nucleotide Protein Length (residues) Gene ID UniPro/SwissProt Remarks MICAL1 human 6q21 NM_022765 NP_073602 1067 64780 Q8TDZ2 Figure 4 MICAL2 human 11p15 NM_014632 NP_055447 1124 9645 O94851 Figure 4 MICAL3 human 22q11.21 NM_015241 NP_056056 2002 57553 Q7RTP6 Figure 4 MICAL1 mouse 10 B1-B2 NM_138315 NP_612188 1048 171580...”
- More
NP_001273542 [F-actin]-monooxygenase MICAL1 isoform 3 from Homo sapiens
Aligns to 950:1080 / 1086 (12.1%), covers 94.8% of PF12130, 117.9 bits
- MICAL1 inhibits colorectal cancer cell migration and proliferation by regulating the EGR1/β-catenin signaling pathway.
Gu, Biochemical pharmacology 2022 (PubMed)- GeneRIF: MICAL1 inhibits colorectal cancer cell migration and proliferation by regulating the EGR1/beta-catenin signaling pathway.
- Mical modulates Tau toxicity via cysteine oxidation in vivo.
Prifti, Acta neuropathologica communications 2022 - GeneRIF: Mical modulates Tau toxicity via cysteine oxidation in vivo.
- High MICAL1 expression correlates with cancer progression and immune infiltration in renal clear cell carcinoma.
Yang, BMC cancer 2022 - GeneRIF: High MICAL1 expression correlates with cancer progression and immune infiltration in renal clear cell carcinoma.
- MICAL1 regulates actin cytoskeleton organization, directional cell migration and the growth of human breast cancer cells as orthotopic xenograft tumours.
McGarry, Cancer letters 2021 (PubMed)- GeneRIF: MICAL1 regulates actin cytoskeleton organization, directional cell migration and the growth of human breast cancer cells as orthotopic xenograft tumours.
- GRAF2, WDR44, and MICAL1 mediate Rab8/10/11-dependent export of E-cadherin, MMP14, and CFTR ΔF508.
Lucken-Ardjomande, The Journal of cell biology 2020 - GeneRIF: GRAF2, WDR44, and MICAL1 mediate Rab8/10/11-dependent export of E-cadherin, MMP14, and CFTR DeltaF508.
- MICAL1 constrains cardiac stress responses and protects against disease by oxidizing CaMKII.
Konstantinidis, The Journal of clinical investigation 2020 - GeneRIF: MICAL1 constrains cardiac stress responses and protects against disease by oxidizing CaMKII.
- Human MICAL1: Activation by the small GTPase Rab8 and small-angle X-ray scattering studies on the oligomerization state of MICAL1 and its complex with Rab8.
Esposito, Protein science : a publication of the Protein Society 2019 - GeneRIF: Human MICAL1: Activation by the small GTPase Rab8 and small-angle X-ray scattering studies on the oligomerization state of MICAL1 and its complex with Rab8.
- Mutations in MICAL-1cause autosomal-dominant lateral temporal epilepsy.
Dazzo, Annals of neurology 2018 (PubMed)- GeneRIF: Two autosomal-dominant lateral temporal epilepsy-causing variants were identified in the MICAL1 gene.
- More
MICA1_MOUSE / Q8VDP3 [F-actin]-monooxygenase MICAL1; Molecule interacting with CasL protein 1; MICAL-1; mMical1; NEDD9-interacting protein with calponin homology and LIM domains; EC 1.14.13.225; EC 1.6.3.1 from Mus musculus (Mouse) (see 6 papers)
Q8VDP3 F-actin monooxygenase (EC 1.14.13.225) from Mus musculus (see paper)
Aligns to 918:1047 / 1048 (12.4%), covers 95.5% of PF12130, 112.4 bits
- function: Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin to form methionine-sulfoxide, resulting in actin filament disassembly and preventing repolymerization. In the absence of actin, it also functions as a NADPH oxidase producing H(2)O(2) (By similarity). Acts as a cytoskeletal regulator that connects NEDD9 to intermediate filaments. Also acts as a negative regulator of apoptosis via its interaction with STK38 and STK38L; acts by antagonizing STK38 and STK38L activation by MST1/STK4. Involved in regulation of lamina-specific connectivity in the nervous system such as the development of lamina-restricted hippocampal connections. Through redox regulation of the actin cytoskeleton controls the intracellular distribution of secretory vesicles containing L1/neurofascin/NgCAM family proteins in neurons, thereby regulating their cell surface levels. May act as Rab effector protein and play a role in vesicle trafficking. Promotes endosomal tubule extension by associating with RAB8 (RAB8A or RAB8B), RAB10 and GRAF (GRAF1/ARHGAP26 or GRAF2/ARHGAP10) on the endosomal membrane which may connect GRAFs to Rabs, thereby participating in neosynthesized Rab8-Rab10-Rab11-dependent protein export (By similarity).
catalytic activity: H(+) + L-methionyl-[F-actin] + NADPH + O2 = H2O + L-methionyl- (R)-S-oxide-[F-actin] + NADP(+) (RHEA:51308)
catalytic activity: H(+) + NADPH + O2 = H2O2 + NADP(+) (RHEA:11260)
cofactor: FAD
subunit: Associates with the SH3 domain of NEDD9. Interacts with VIM and PLXNA3. Interacts with RAB1B, RAB8A, RAB10, RAB13 and RAB15 (in their GTP-bound forms); binding to RAB1B is of low affinity compared to other Rab proteins; at least in case of RAB8A and RAB10 can bind 2 molecules of the Rab proteins simultaneously (By similarity). Interacts with STK38 and STK38L. Interacts with GRAF1/ARHGAP26, GRAF2/ARHGAP10, RAB8A, RAB8B and RAB10; may bind simultaneously to GRAFs and Rabs and connects GRAFs to Rabs (By similarity). Does not interact with RAB1 and RAB11A (By similarity). - Diversification of Ubiquinone Biosynthesis via Gene Duplications, Transfers, Losses, and Parallel Evolution
Kazemzadeh, Molecular biology and evolution 2023 - “...as outgroup in rooted UQ-FMO phylogenies, except for that of Mus musculus (Uniprot sequence ID Q8VDP3, [F-actin]-monooxygenase MICAL1) that presented a much longer sequence than the other FMOs. The list of the sequence identifiers of the included FMO sequences is the following: P00438, P20586, Q93NG3, A6T923,...”
- Myocardial Injury Caused by Chronic Alcohol Exposure-A Pilot Study Based on Proteomics.
Ma, Molecules (Basel, Switzerland) 2022 - “...dehydrogenase Phgdh 0.816 0.027 down O35604 NPC intracellular cholesterol transporter 1 Npc1 0.824 0.029 down Q8VDP3 [F-actin]-monooxygenase MICAL1 Mical1 0.832 0.032 down Q3TX70 t-SNARE coiled-coil homology domain-containing protein Stx6 0.764 0.032 down A0A2R8VHC2 GTP-binding protein 1 (Fragment) Gtpbp1 0.796 0.032 down H3BK03 Serum paraoxonase/arylesterase 1 (Fragment)...”
- MICAL, the flavoenzyme participating in cytoskeleton dynamics.
Vanoni, International journal of molecular sciences 2013 - “...NM_015241 NP_056056 2002 57553 Q7RTP6 Figure 4 MICAL1 mouse 10 B1-B2 NM_138315 NP_612188 1048 171580 Q8VDP3 Figure 4 MICAL2 mouse 7E3 NM_001193305 NP_001180234 1102 320878 8QBML1 isoform A; Figure 4 MICAL3 mouse 6F1 NM_001270475 NP_001257404 1993 194401 Q8CJ19 isoform 1; Figure 4 MICAL1 rat 20q12 NM_001106397...”
XP_006512633 F-actin-monooxygenase MICAL1 isoform X1 from Mus musculus
Aligns to 1077:1206 / 1207 (10.8%), covers 95.5% of PF12130, 112.1 bits
L8Y7J9 MICAL-like protein 2 from Tupaia chinensis
Aligns to 607:695 / 761 (11.7%), covers 64.9% of PF12130, 104.9 bits
NP_001099867 [F-actin]-monooxygenase MICAL1 from Rattus norvegicus
D3ZBP4 [F-actin]-monooxygenase MICAL1 from Rattus norvegicus
Aligns to 918:1046 / 1047 (12.3%), covers 95.5% of PF12130, 101.1 bits
- Expression pattern of Mical-1 in the temporal neocortex of patients with intractable temporal epilepsy and pilocarpine-induced rat model.
Luo, Synapse (New York, N.Y.) 2011 (PubMed)- GeneRIF: In an epilepsy model, optical density values of MICAL-1 expression decreases at all time points after kindling, compared to the normal group.
- MICAL flavoprotein monooxygenases: expression during neural development and following spinal cord injuries in the rat.
Pasterkamp, Molecular and cellular neurosciences 2006 (PubMed)- GeneRIF: Tesults implicate MICALs in neuronal regeneration and support the possibility to attenuate axon repulsion in the injured spinal cord.
- The MICAL proteins and rab1: a possible link to the cytoskeleton?
Fischer, Biochemical and biophysical research communications 2005 (PubMed)- GeneRIF: Using the microtubule depolymerizing drug nocodazole we detected a link between MICAL-1 and -3, and the microtubule cytoskeleton.
- iTRAQ-based proteomics analysis on insomnia rats treated with Mongolian medical warm acupuncture
Xu, Bioscience reports 2020 - “...globin 1.533583884 0.040836379 D4A4T6 Protein Rint1 1.307495336 0.042824768 P17209 Myosin light chain 4 1.254133152 0.048826237 D3ZBP4 Protein-methionine sulfoxide oxidase MICAL1 1.220699776 0.049482287 O55145 Fractalkine 0.821730332 0.002073597 D3ZC82 Protein Nufip2 0.780885927 0.003504731 D3ZIC4 Protein phosphatase 1 regulatory subunit 0.797201943 0.006803938 Q3KR51 HMP19 protein, isoform CRA_a 0.813904866 0.009560059...”
- Analysis of the Effect of Intestinal Ischemia and Reperfusion on the Rat Neutrophils Proteome
Tahir, Frontiers in molecular biosciences 2018 - “...1 EC 1.11.1.9 P04041 Gpx1 3 0.131894129 0.236200267 0.104306138 Protein-methionine sulfoxide oxidase MICAL1 EC 1.14.13.- D3ZBP4 Mical1 3 0.132806847 0.172661531 0.039854685 Leukotriene-B(4) omega-hydroxylase 2 EC 1.14.13.30 Q3MID2 Cyp4f18 3 0.314624374 0.54501604 0.230391666 Metalloreductase STEAP4 EC 1.16.1.- Q4V8K1 Steap4 3 0.634298418 0.633934112 0.000364306 Peroxisomal acyl-coenzyme A oxidase...”
- Mechanisms of Mas1 Receptor-Mediated Signaling in the Vascular Endothelium.
Hoffmann, Arteriosclerosis, thrombosis, and vascular biology 2017 - “...Q60682 Killer cell lectin-like receptor 8 6 / 64 0.83 (0.010) Class I MHC Signaling D3ZBP4 Protein-methionine sulfoxide oxidase MICAL1 7 / 67 1.08 (0.0011) Apoptosis Signal Regulation () P12526 Proto-oncogene Mas (MAS1) 4 / 13 Unique (1.67E-4) G-protein and Renin-Angiotensin System Signaling P42346 Mammalian target...”
- MICAL, the flavoenzyme participating in cytoskeleton dynamics.
Vanoni, International journal of molecular sciences 2013 - “...NP_001257404 1993 194401 Q8CJ19 isoform 1; Figure 4 MICAL1 rat 20q12 NM_001106397 NP_001099867 1047 294520 D3ZBP4 Figure 4 MICAL2 rat 1q33 EDM_17817 1103 365352 D4A1F2-2 Figure 4 MICAL3 rat 4q42 NM_001191085 NP_001178014 1997 362427 - Figure 4 MICAL1 guinea pig - XM_003466042 XP_003466090 1058 100715118 H0V032...”
A0A0B4K703 F-actin monooxygenase from Drosophila melanogaster
Aligns to 4572:4706 / 4732 (2.9%), covers 88.8% of PF12130, 88.7 bits
- The Roles of the LIM Domain Proteins in Drosophila Cardiac and Hematopoietic Morphogenesis
She, Frontiers in cardiovascular medicine 2021 - “...Visceral mesoderm, Segmented pattern Dorsal apodeme, Dorsal epidermis, Hindgut LIM protein FBgn0053208 Mical Q86BA1 , A0A0B4K703 , A0A0B4K6D5 , A0A0B4K6N6 , A0A126GUS6 , A0A126GUS4 Blastoderm nuclei, Yolk nuclei, Zygotic Midgut, Muscle system, Morsal prothoracic, Pharyngeal muscle LIM protein FBgn0036333 Mical-like Q9VU34 API Malpighiantubule, Midgut, Trunk mesoderm...”
NP_001247015 molecule interacting with CasL, isoform L from Drosophila melanogaster
Aligns to 4583:4717 / 4743 (2.8%), covers 88.8% of PF12130, 88.7 bits
- Mical modulates Tau toxicity via cysteine oxidation in vivo.
Prifti, Acta neuropathologica communications 2022 - GeneRIF: Mical modulates Tau toxicity via cysteine oxidation in vivo.
- Profilin and Mical combine to impair F-actin assembly and promote disassembly and remodeling.
Grintsevich, Nature communications 2021 - GeneRIF: Profilin and Mical combine to impair F-actin assembly and promote disassembly and remodeling.
- F-actin dismantling through a redox-driven synergy between Mical and cofilin.
Grintsevich, Nature cell biology 2016 - GeneRIF: Mical and cofilin, therefore, form a redox-dependent synergistic pair that promotes F-actin instability by rapidly dismantling F-actin and generating post-translationally modified actin that has altered assembly properties
- MICAL-like Regulates Fasciclin II Membrane Cycling and Synaptic Development.
Nahm, Molecules and cells 2016 - GeneRIF: Results identify Mical-like as a novel regulator of synaptic growth and FasII endocytic recycling.
- SelR reverses Mical-mediated oxidation of actin to regulate F-actin dynamics.
Hung, Nature cell biology 2013 - GeneRIF: Mical oxidizes actin stereospecifically to generate actin Met-44-R-sulfoxide.
- Direct redox regulation of F-actin assembly and disassembly by Mical.
Hung, Science (New York, N.Y.) 2011 - GeneRIF: actin filament subunits were directly modified by Mical on their conserved pointed-end, critical for filament assembly; Mical posttranslationally oxidized the methionine 44 residue within D-loop of actin, severing filaments and decreasing polymerization
- Mical links semaphorins to F-actin disassembly.
Hung, Nature 2010 - GeneRIF: Mical is both necessary and sufficient for semaphorin-plexin-mediated F-actin reorganization in vivo
- A genetic pathway composed of Sox14 and Mical governs severing of dendrites during pruning.
Kirilly, Nature neuroscience 2009 - GeneRIF: a previously unknown pathway composed of Sox14 and its cytoskeletal target Mical governs dendrite severing during development
- More
MICAL_DROME / Q86BA1 [F-actin]-monooxygenase Mical; Molecule interacting with CasL protein homolog; EC 1.14.13.225 from Drosophila melanogaster (Fruit fly) (see 5 papers)
Q86BA1 F-actin monooxygenase (EC 1.14.13.225) from Drosophila melanogaster (see 4 papers)
Aligns to 4563:4697 / 4723 (2.9%), covers 88.8% of PF12130, 88.7 bits
- function: Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin. Acts by modifying actin subunits at 'Met-44' and 'Met-47' through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament disassembly and prevent repolymerization. Plays a key role in semaphorin-plexin repulsive axon guidance and cell morphological changes, probably via its ability to modify and regulate actin.
catalytic activity: H(+) + L-methionyl-[F-actin] + NADPH + O2 = H2O + L-methionyl- (R)-S-oxide-[F-actin] + NADP(+) (RHEA:51308)
cofactor: FAD
subunit: Interacts with plexA.
disruption phenotype: Defects in motor neuron guidance, myofilament organization and bristle formation. Surviving adult flies show abnormally shaped bristle cell processes that are variously straight, thick, bent, twisted and/or had abnormal 'club-like' or blunt tips. - A genetic screen to uncover molecular mechanisms underlying lipid transfer protein function at membrane contact sites and neurodegeneration
Mishra, 2023 - The Roles of the LIM Domain Proteins in Drosophila Cardiac and Hematopoietic Morphogenesis
She, Frontiers in cardiovascular medicine 2021 - “...Hindgut, muscle, Visceral mesoderm, Segmented pattern Dorsal apodeme, Dorsal epidermis, Hindgut LIM protein FBgn0053208 Mical Q86BA1 , A0A0B4K703 , A0A0B4K6D5 , A0A0B4K6N6 , A0A126GUS6 , A0A126GUS4 Blastoderm nuclei, Yolk nuclei, Zygotic Midgut, Muscle system, Morsal prothoracic, Pharyngeal muscle LIM protein FBgn0036333 Mical-like Q9VU34 API Malpighiantubule, Midgut,...”
- Apocrine secretion in Drosophila salivary glands: subcellular origin, dynamics, and identification of secretory proteins
Farkaš, PloS one 2014 - “...4 O61444 47.5 signaling cytoplasmic Minibrain P49657 65.9 protein modification nuclear Molecule interacting with CasL Q86BA1 525.0 cytoskeleton enzyme cytoplasmic Myosin II Q99323 227.0 cytoskeletal cytoplasmic, cortical NADH:ubiquinone reductase 23kD subunit precursor Q9VF27 24.6 metabolism membrane NAT1 Q0E996 104.5 DNA/RNA binding nuclear, cytoplasmic NTF2-related export protein...”
- MICAL, the flavoenzyme participating in cytoskeleton dynamics
Vanoni, International journal of molecular sciences 2013 - “...567456 F1QH17.2 Authentic according to UniPro; Figure 4 MICAL drosophila 3R AF520715 AAM55244 4723 41225 Q86BA1 long isoform differing from others for interdomain regions; Figure 4 Table 2 Summary of the kinetic properties of the NADPH oxidase reaction of human MICAL-MO. Assays were carried out at...”
NP_653101 bMERB domain-containing protein 1 from Mus musculus
Aligns to 10:147 / 203 (68.0%), covers 77.6% of PF12130, 76.7 bits
NP_505468 EH domain-binding protein 1 from Caenorhabditis elegans
Aligns to 739:869 / 901 (14.5%), covers 98.5% of PF12130, 73.7 bits
Or search for genetic data about PF12130 in the Fitness Browser
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory