PaperBLAST

PaperBLAST Hits for sp|Q9I553|SYA_PSEAE Alanine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=alaS PE=3 SV=1 (874 a.a., MKSAEIREAF...)

Show query sequence

>sp|Q9I553|SYA_PSEAE Alanine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=alaS PE=3 SV=1
MKSAEIREAFLRFFEEKGHTRVASSSLIPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA
TTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWEFLTGEKWLN
LPKEKLWVTVYATDDEAYDIWTKEVGVPAERMVRIGDNKGAPYASDNFWAMGDTGPCGPC
TEIFFDHGPEIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVMHPLPAPSVDTGMGLE
RVSAVLQHVHSNYEIDLFQNLLKASAEAIGCANDDAPSLKVVADHIRSCSFLIADGVLPS
NEGRGYVLRRIIRRACRHGNKLGARGTFFHKIVAALVAEMGDAFPELKQQQAHIERVLKT
EEEQFAKTLEQGLKILEQDLAELQGSVIPGNVVFKLYDTYGFPVDLTNDIARERELTIDE
DGFEREMEAQRERARASSAFGMDYNSLVKVDGETRFLGYQGVSGAGQIVALFRDGQAVER
LEEGEEGVVVLDQTPFYAESGGQVGDSGYLEAAGVRFDVRDTTKAGGAHLHHGVVARGNL
SVGGAVKAEVDASVRQATALNHSATHLLHAALRQVLGDHVQQKGSLVDSQRLRFDFSHFE
AIKAEQLKALEDIVNAEIRRNTEVETEETDIDTAKAKGAMALFGEKYGDQVRVLSMGGDF
SVELCGGTHVSRTGDIGLFKITSEGGVAAGVRRIEAVTGAAALAYLNGAEEQLKEAASLV
KGSRDNLLDKLGALLERNRSLEKELEQLKAKAASAAGDDLSAAAVEIKGAKVLAARLDGL
DGKALLALVDQLKNKLGRAVILLGGELDGKVVLVAGVTQDLTGQLKAGELMKQAAAAVGG
KGGGRPDMAQGGGTDAAKLDEALALAQRFVEQGL

Running BLASTp...

Found 190 similar proteins in the literature:

PA0903 alanyl-tRNA synthetase from Pseudomonas aeruginosa PAO1
100% identity, 100% coverage

• Uncovering the GacS-mediated role in evolutionary progression through trajectory reconstruction in Pseudomonas aeruginosa
  Jiang, Nucleic acids research 2024
  • “...in P. aeruginosa ( 61 ). Our examination revealed that only one differentially expressed gene, PA0903 (annotated as Alanyl-tRNA synthetase) in the ribosome biogenesis pathway, was directly bound by GacA. Therefore, it is probable that this regulation is an indirect consequence of GacS/GacA in regulating ribosome...”
• Comparative genomics of clinical strains of Pseudomonas aeruginosa strains isolated from different geographic sites
  Subedi, Scientific reports 2018
  • “...1 3 1 3 4 43 PA0004 gyrB Antibiotic target alternation 1 3 1 5 PA0903 alaS 1 1 1 1 1 1 1 1 1 1 1 2 13 PA1972 pmrC 3 3 3 3 3 3 1 1 1 4 1 1 2 3...”
• Identification and characterization of a periplasmic aminoacyl-phosphatidylglycerol hydrolase responsible for Pseudomonas aeruginosa lipid homeostasis
  Arendt, The Journal of biological chemistry 2013
  • “...coli carrying the gene encoding alanyl-tRNA-synthetase (orf PA0903) cloned into NdeI/BamHI sites, T7promoter, sequence for an N-terminal His6-tag, Kanr...”
• Global regulation of gene expression by OxyR in an important human opportunistic pathogen
  Wei, Nucleic acids research 2012
  • “...PA0195 pntAA 1.17 289 1 ATTAAAAACATTAAT 354 6.81 Putative NAD(P) transhydrogenase. subunit alpha part 1 PA0903 alaS 1.42 106 1 ATAGTTATTGCCTAT 92 7.77 Alanyl-tRNA synthetase PA0963 aspS 1.02 304 2 ATAGGGAGAATCTAT 319 7.66 Aspartyl-tRNA synthetase PA1054 1.48 271 6 ATAGATTGCGATAAT 138 7.45 Probable NADH dehydrogenase PA1541...”
  • “...efflux protein) and PA5291 (cholinebetaine transporter)], protein synthesis [PA0584 ( cca , tRNA nucleotidyl transferase), PA0903 ( alsS , alanyl-tRNA synthetase), PA0963 ( aspS , aspartyl-tRNA synthetase) and PA4268 ( rpsL , ribosomal protein S12)], aerobic/anaerobic respiration PA1317 ( cyoA , cytochrome o ubiquinol oxidase) and...”
• Analysis of Pseudomonas aeruginosa cell envelope proteome by capture of surface-exposed proteins on activated magnetic nanoparticles
  Vecchietti, PloS one 2012
  • “...4 U,3 PA4842 Putative uncharacterized protein 4 U,3 PA0126 Putative uncharacterized protein 4 U,3 alaS PA0903 Alanyl-tRNA synthetase AlaS 2 C,1 - P,1 rpsA PA3162 30S rP S1 2 C,1 - P,1 rpsE PA4246 30S rP S5 2 C,1 aspS PA0963 Aspartyl-tRNA synthetase AspS 2 C,2...”
• Alanyl-phosphatidylglycerol synthase: mechanism of substrate recognition during tRNA-dependent lipid modification in Pseudomonas aeruginosa
  Hebecker, Molecular microbiology 2011
  • “...yield pGEX-6P-1/PA0920aa1-542 (strains and plasmids are given in supplemental Table S4 ). Open reading frame PA0903 encoding the AlaRS from P. aeruginosa was amplified from genomic DNA with primers 27alaSNdeIfw and 28alaSBclIrv. The PCR fragment was digested with Nde I and Bcl I and cloned into...”
• Toxicogenomic response of Pseudomonas aeruginosa to ortho-phenylphenol
  Nde, BMC genomics 2008
  • “...metabolism PA4439_trpS_at PA4439 2.002 0.0155 tryptophanyl-tRNA synthetase trp S Amino acid biosynthesis and metabolism PA0903_alaS_at PA0903 2.099 0.0102 alanyl-tRNA synthetase ala S Transcription, RNA processing and degradation PA4602_glyA3_at PA4602 3.347 2.83E-05 serine hydroxymethyltransferase gly A3 Amino acid biosynthesis and metabolism PA0971_tolA_at PA0971 2.249 0.000381 TolA protein...”
• Isolation and characterization of Pseudomonas aeruginosa R' plasmids constructed by interspecific mating
  Morgan, Journal of bacteriology 1982
  • “...pur-136 PA0897 leu-8 PA0898 ilv-202 str-l PAO900 ilv-208 PA0903 his-5707 PA0904 argF1O PA0905 leu-10 PA0907 pro-S4 PA0944 PA0949 PA02048 PA02577 GMA253 P....”
  • “...the flanking marker proB or hisI to PA0888 or PA0903, and PPN1050(pMO755) transferred neither pur-136 nor ser-2 to PA0896 or PAO2. Because trpF and argF are...”

WP_034012995 alanine--tRNA ligase from Pseudomonas aeruginosa
100% identity, 100% coverage

• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(WP_004155915); Vpar , Vibrio parahaemolyticus (WP_086591229); Abau , Acinetobacter baumannii (ACC56466); Paer , Pseudomonas aeruginosa (WP_034012995); Nmen , Neisseria meningitidis (WP_010980961); Rpal , Rhodopseudomonas palustris (WP_044410751); Hpyl , Helicobacter pylori (WP_000354743); Aaeo , Aquifex aeolicus (WP_010880825); Bsub , Bacillus subtilis (WP_086344136); Tthe , Thermus thermophilus (WP_011228945);...”

PP4474 alanyl-tRNA synthetase from Pseudomonas putida KT2440
86% identity, 100% coverage

• The CbrB Regulon: Promoter dissection reveals novel insights into the CbrAB expression network in Pseudomonas putida
  Barroso, PloS one 2018
  • “...5050611 5048284 5050511 48 PP4471 mgtE magnesium transporter 2,26 transport 5078705 5079252 5078804 5080022 49 PP4474 alaS alaninetRNA ligase 2,60 enzymatic 5084164 5084605 5084244 5084505 50 PP4486 argT lysine /arginine /ornithine ABC transporter substrate-binding protein 2,48 transport 5096664 5097230 5096657 5097130 51 PP4520 hypothetical protein 4,01...”

ECP_2657 alanyl-tRNA synthetase from Escherichia coli 536
67% identity, 97% coverage

• Comprehensive analysis of PNA-based antisense antibiotics targeting various essential genes in uropathogenic Escherichia coli
  Popella, Nucleic acids research 2022
  • “...10mer rplS PNA at 10M (Table 1 ) is due to the off-target depletion of ECP_2657 (Figure 8 ), which encodes the essential protein alanyl-tRNA synthetase. While this possibility remains to be experimentally tested, the complementarity of the rplS PNA to 9 nucleotides within the translation...”

AlaS / b2697 alanine—tRNA ligase/DNA-binding transcriptional repressor (EC 6.1.1.7) from Escherichia coli K-12 substr. MG1655 (see 73 papers)
AlaS / P00957 alanine—tRNA ligase/DNA-binding transcriptional repressor from Escherichia coli (strain K12) (see 73 papers)
SYA_ECOLI / P00957 Alanine--tRNA ligase; Alanyl-tRNA synthetase; AlaRS; Protein lactyltransferase; EC 6.1.1.7; EC 6.-.-.- from Escherichia coli (strain K12) (see 9 papers)
B1XCM5 Alanine--tRNA ligase from Escherichia coli (strain K12 / DH10B)
NP_417177 alanine--tRNA ligase/DNA-binding transcriptional repressor from Escherichia coli str. K-12 substr. MG1655
b2697 alanyl-tRNA synthetase from Escherichia coli str. K-12 substr. MG1655
66% identity, 97% coverage

• function: Catalyzes the attachment of L-alanine to tRNA(Ala) in a two- step reaction: L-alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala) (PubMed:28362257). AlaRS also incorrectly activates the sterically smaller amino acid glycine as well as the sterically larger amino acid L-serine; generates 2-fold more mischarged Gly than Ser (PubMed:28362257). These mischarged amino acids occur because the of inherent physicochemical limitations on discrimination between closely related amino acids (Ala, Gly and Ser) in the charging step (PubMed:28362257). In presence of high levels of lactate, also acts as a protein lactyltransferase that mediates lactylation of lysine residues in target proteins (PubMed:38653238, PubMed:39322678).
  function: Edits mischarged Ser-tRNA(Ala) and Gly-tRNA(Ala) but not incorrectly charged Ser-tRNA(Thr) (PubMed:12554667, PubMed:18723508). Dtd edits Gly-tRNA(Ala) 4-fold better than does AlaRS (PubMed:28362257).
  function: Attaches Ala to transfer-messenger RNA (tmRNA, also known as 10Sa RNA, the product of the ssrA gene). tmRNA plays a major role in rescue of stalled ribosomes via trans-translation.
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  catalytic activity: (S)-lactate + ATP + H(+) = (S)-lactoyl-AMP + diphosphate (RHEA:80271)
  catalytic activity: (S)-lactoyl-AMP + L-lysyl-[protein] = N(6)-[(S)-lactoyl]-L- lysyl-[protein] + AMP + 2 H(+) (RHEA:80275)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit; it is not clear where this binding occurs.)
  subunit: Homotetramer.
• The Thioredoxin Fold Protein (TFP2) from Extreme Acidophilic Leptospirillum sp. CF-1 Is a Chaperedoxin-like Protein That Prevents the Aggregation of Proteins under Oxidative Stress
  Muñoz-Villagrán, International journal of molecular sciences 2024
  • “...subunit stability factor der 2.50 0.027 P0A7K6 50S ribosomal subunit protein L19 rplS 4.46 0.049 P00957 alanine--tRNA ligase/DNA-binding transcriptional repressor alaS 3.31 0.031 P07012 peptide chain release factor RF2 prfB 7.24 0.005 P05055 polynucleotide phosphorylase pnp 2.95 0.036 P0A705 translation initiation factor IF-2beta infB 8.08 0.003...”
• RNA-dependent proteome solubility maintenance in <i>Escherichia coli</i> lysates analysed by quantitative mass spectrometry: Proteomic characterization in terms of isoelectric point, structural disorder, functional hub, and chaperone network
  Park, RNA biology 2024
  • “...13.24 12.18 0.036 * P0A8N5 LysRS, heat inducible 2 57.70 4.87 12.69 14.55 0.012 * P00957 AlaRS 2 95.90 5.58 12.25 11.49 0.017 * P21888 CysRS 1 52.20 5.25 12.01 11.50 0 *** P0AGJ9 TyrRS 1 47.40 5.55 10.47 10.14 0 *** P07813 LeuRS 1 97.23...”
• Biodistribution of ⁸⁹Zr-DFO-labeled avian pathogenic Escherichia coli outer membrane vesicles by PET imaging in chickens
  Li, Poultry science 2023
  • “...Carbohydrate transport and metabolism Cytoplasm 209 P04693 TYRB Amino acid transport and metabolism Cytoplasm 210 P00957 SYA Translation, ribosomal structure and biogenesis Cytoplasm 211 P0C093 SLMA Transcription Cytoplasm 212 P00963 ASNA Amino acid transport and metabolism Cytoplasm 213 P0A9N4 PFLA Posttranslational modification, protein turnover, chaperones Cytoplasm...”
• The G3-U70-independent tRNA recognition by human mitochondrial alanyl-tRNA synthetase
  Zeng, Nucleic acids research 2019
  • “...(calculated molecular mass of 107 kDa) and E. coli AlaRS ( Ec AlaRS, Uniprot No. P00957, calculated molecular mass of 96 kDa) were measured, and were 74 and 223 kDa, respectively (Figure 2A and B ). Obviously, mmtAlaRS should also be a monomer, while Ec AlaRS...”
• The Escherichia coli proteome: past, present, and future prospects
  Han, Microbiology and molecular biology reviews : MMBR 2006
  • “...5.44/53,485 (DIGE 4.5-6.5) 5.20/41,503 (5-6) AlaS P00957 5.53/96,032.40 5.50/96,123 AldA P25553 Alanyl-tRNA synthetase Aldehyde dehydrogenase A 5.07/52,141.60...”
• A dual-specificity aminoacyl-tRNA synthetase in the deep-rooted eukaryote Giardia lamblia
  Bunjun, Proceedings of the National Academy of Sciences of the United States of America 2000
  • “...melanogaster (gb AAF05593.1), Escherichia coli (sp P00957), Homo sapiens (sp P49588), Methanobacterium thermoautotrophicum (sp O27718), Methanococcus jannaschii...”
• The T4 phage DNA mimic protein Arn inhibits the DNA binding activity of the bacterial histone-like protein H-NS
  Ho, The Journal of biological chemistry 2014
  • “...translocase subunit SecA Aldehyde-alcohol dehydrogenase P25516 B1XCM5 P06612 P33602 C4ZRJ3 P0A9Q7 10,868/179 4,534/66 4,327/80 4,242/70 3,471/61 2,969/47 68...”
• Role of D-aminoacyl-tRNA deacylase beyond chiral proofreading as a cellular defense against glycine mischarging by AlaRS.
  Pawar, eLife 2017
  • GeneRIF: Here, the authors show that DTD's active site architecture can efficiently edit mischarged Gly-tRNA(Ala) species four orders of magnitude more efficiently than even AlaRS, the only ubiquitous cellular checkpoint known for clearing the error.
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...(NP_421332); D. melanogaster , Drosophila melanogaster (DmAlaRS1, NP_523511.2; DmAlaRS2, NP_523932.2); E. coli , Escherichia coli (NP_417177); G. lamblia , Giardia lamblia (XP_001704452); H. sapiens , Homo sapiens (HsAlaRS1, BAA06808; HsAlaRS2, NP_065796); M. jannaschii , Methanocaldococcus jannaschii (NP_247543); M. thermautotrophicus , Methanothermobacter thermautotrophicus (NP_276794); T. thermophilus ,...”
• Allosteric interaction of nucleotides and tRNA(ala) with E. coli alanyl-tRNA synthetase.
  Dignam, Biochemistry 2011 (PubMed)
  • GeneRIF: ATP binding to full length enzyme (ARS875) and to an N-terminal construct (ARS461) is endothermic (DeltaH = 3-4 kcal mol(-1)) with stoichiometries of 1:1 for ARS461 and 2:1 for full-length dimer.
• The C-Ala domain brings together editing and aminoacylation functions on one tRNA.
  Guo, Science (New York, N.Y.) 2009
  • GeneRIF: findings show that the C-Ala domain plays a key role in alanyl-tRNA synthetases (AlaRS) function; C-Ala forms an ancient single-stranded nucleic acid binding motif that promotes cooperative binding of both aminoacylation and editing domains to tRNA(Ala)
• Distinct domains of tRNA synthetase recognize the same base pair.
  Beebe, Nature 2008 (PubMed)
  • GeneRIF: the editing site of alanyl-tRNA synthetase targets mischarged tRNA(Ala) using a structural motif unrelated to that for aminoacylation, so that, remarkably, two motifs in the same enzyme independently provide determinants for tRNA(Ala) recognition
• Mass spectra of partial protein hydrolysates as a multiple phase check for long polypeptides deduced from DNA sequences: NH2-terminal segment of alanine tRNA synthetase.
  Herlihy, Proceedings of the National Academy of Sciences of the United States of America 1980
  • GeneRIF: N-terminus verified by Edman degradation on mature peptide
• Whole-genome sequencing analysis of two heat-evolved Escherichia coli strains
  McGuire, BMC genomics 2023
  • “...b2551 / b2552 serine hydroxymethyltransferase / nitric oxide dioxygenase A 7 >A 6 n/a alaS b2697 alanine-tRNA ligase/DNA-binding transcriptional repressor Silent codon 196 n/a cca b3056 fused tRNA nucleotidyltransferase/2',3'-cyclic phosphodiesterase/2' nucleotidase and phosphatase Silent codon 345 n/a < -rbfA- / < -infB- b3167 / b3168 30S...”
• Essentiality Assessment of Cysteinyl and Lysyl-tRNA Synthetases of Mycobacterium smegmatis
  Ravishankar, PloS one 2016
  • “.... coli H . influenzae S . aureus S . pneumoniae AlaRS MSMEG_3025 Rv2555c ML0512 b2697 HI0814 SA1446 SP1383 GlyRS MSMEG_4485 Rv2357c ML0826 b3559,b3560 HI0924,HI0927 SA1394 SP1474,SP1475 ValRS MSMEG_4630 Rv2448c ML1472 b4258 HI1391 SA1488 SP0568 LeuRS MSMEG_6917 Rv0041 ML0032 b0642 HI0921 SA1579 SP0254 IleRS MSMEG_3169 Rv1536...”
• A cell-free system toward deciphering the post-translational modification barcodes of Oct4 in different cellular contexts
  Dan, Biochemical and biophysical research communications 2015 (PubMed)
  • “...School of Medicine, Zhejiang University (Grant No. b2697 to Y.-J.W.). Appendix A Supplementary data Supplementary data associated with this article can...”
• Gap-filling analysis of the iJO1366 Escherichia coli metabolic network reconstruction for discovery of metabolic functions
  Orth, BMC systems biology 2012
  • “...(b1719) L-threonine aspS (b1866) L-aspartate argS (b1876) L-arginine metG (b2114) L-methionine hisS (b2514) L-histidine alaS (b2697) L-alanine fmt (b3288) N-formyl-L-methionine trpS (b3384) L-tryptophan glyS (b3559) glycine glyQ (b3560) glycine valS (b4258) L-valine False negative model predictions All genes with false negative predictions for at least one...”
• Comparative analysis of regulatory elements between Escherichia coli and Klebsiella pneumoniae by genome-wide transcription start site profiling
  Kim, PLoS genetics 2012
  • “...regulates ogt by binding the upstream region of ogt [77] ( Figure S6C ). AlaS (b2697) of E. coli auto-regulates transcription of alaS by binding to the region covering parts of promoter region and the 5 UTR [78] ( Figure S6D ). A high conservation level...”
• The association of DNA damage response and nucleotide level modulation with the antibacterial mechanism of the anti-folate drug trimethoprim
  Sangurdekar, BMC genomics 2011
  • “...unknown yfgE (hda) b2496 Required for regulatory inactivation of DnaA; multicopy suppressor of dnaN(ts) alaS b2697 Alanine--tRNA ligase A total of 13 mutants, based on their relatively low yields, were identified as sensitive candidates. Genes whose functions are related to DNA maintenance and nucleotide salvage pathway...”
• Update on the Keio collection of Escherichia coli single-gene deletion mutants
  Yamamoto, Molecular systems biology 2009
  • “...( Baba et al , 2006 ). (A) New essential gene candidates alaS ECK2692 JW2667 b2697 E 2/8 Alanyl-tRNA synthetase coaA ECK3966 JW3942 b3974 E 2/8 Pantothenate kinase coaE ECK0103 JW0100 b0103 E 2/8 Dephospho-CoA kinase dnaG ECK3056 JW3038 b3066 E 2/8 DNA primase glmM ECK3165...”
• Remaining flexible in old alliances: functional plasticity in constrained mutualisms
  Wernegreen, DNA and cell biology 2009
  • “...pisum Buchnera- Schizaphis graminum Buchnera- Baizongia pistaciae alaS b2697 Bpen174 Bfl168 WGLp234 BU403 BUsg390 Bbp364 birA b3973 Bpen190 Bfl184 WGLp513 - - -...”

STM2827 alanyl-tRNA synthetase from Salmonella typhimurium LT2
67% identity, 97% coverage

• Subtyping of Salmonella enterica Subspecies I Using Single-Nucleotide Polymorphisms in Adenylate Cyclase
  Guard, Foodborne pathogens and disease 2016
  • “...Phenylalanine (beta subunit) 17 leuS STM0648 2582 400 49 25 0.510 17-Aug Leucine 18 alaS STM2827 2631 390 37 25 0.676 31-Aug Alanine 19 ileS STM0046 2835 382 40 19 0.475 17-Aug Isoleucine 20 valS STM4475 2855 393 48 43 0.896 31-Aug Valine Figure 1B :...”

ECs3554 alanyl-tRNA synthetase from Escherichia coli O157:H7 str. Sakai
66% identity, 97% coverage

• Global transcriptional response of Escherichia coli O157:H7 to growth transitions in glucose minimal medium
  Bergholz, BMC microbiology 2007
  • “...gabT 3.14 2 ECs2920 metG -2.59 1 ECs3533 ygaM 3.32 2 ECs3022 yohC 6.12 2 ECs3554 alaS -2.20 1 ECs3029 O157 4.04 2 ECs3605 cysN -3.19 1 ECs3030 O157 3.38 2 ECs3617 cysH -2.76 1 ECs3053 yeiJ -2.67 1 ECs3619 cysJ -4.11 1 ECs3055 yeiL 2.38...”

Z3999 alanyl-tRNA synthetase from Escherichia coli O157:H7 EDL933
65% identity, 99% coverage

• Use of in vivo-induced antigen technology for identification of Escherichia coli O157:H7 proteins expressed during human infection
  John, Infection and immunity 2005
  • “...ivi protein Z4279 Z5747 Z4263 Z4540 Z4616 Z4228 Z0176 Z3999 Z2789 Z3827 Z5977 Z3777 Z5955 Z3491 Z4043 Z4478 Z0998 Z5392 transketolase 1 isozyme (tktA) GroES,...”

S2911 alanyl-tRNA synthetase from Shigella flexneri 2a str. 2457T
66% identity, 97% coverage

• Dynamic proteome changes of Shigella flexneri 2a during transition from exponential growth to stationary phase
  Zhu, Genomics, proteomics & bioinformatics 2007
  • “...2-phosphodiesterase G17 AspS 193 gi|30063276 S1942 44% 24 aspartate tRNA synthetase G18 AlaS 59 gi|30064057 S2911 22% 12 alanyl-tRNA synthetase G19 SodA 94 gi|30064799 S3763 58% 10 superoxide dismutase, manganese G20 AsnS 201 gi|30062465 S0991 38% 18 asparagine tRNA synthetase G21 GuaA 208 gi|30063899 S2725 40%...”

WP_065680553 alanine--tRNA ligase from Salmonella enterica
67% identity, 97% coverage

• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...in AlaRS. Parentheses indicate accession number. Ecol , Escherichia coli (ACB03816); Sent , Salmonella enterica (WP_065680553); Eamy , Erwinia amylovora (WP_004155915); Vpar , Vibrio parahaemolyticus (WP_086591229); Abau , Acinetobacter baumannii (ACC56466); Paer , Pseudomonas aeruginosa (WP_034012995); Nmen , Neisseria meningitidis (WP_010980961); Rpal , Rhodopseudomonas palustris (WP_044410751);...”

C4X49_06310 alanine--tRNA ligase from Acinetobacter baumannii
66% identity, 99% coverage

• Acinetobacter baumannii NCIMB8209: a Rare Environmental Strain Displaying Extensive Insertion Sequence-Mediated Genome Remodeling Resulting in the Loss of Exposed Cell Structures and Defensive Mechanisms
  Repizo, mSphere 2020
  • “...(tmRNA; C4X49_04705)/DUF927 domain- containing protein (C4X49_04925) Ph3-N 25.2 29 12402671265538 41.5 Aspartate kinase (C4X49_06155)/alanine-tRNA ligase (C4X49_06310) Ph4-N 39.1 32 21401992179329 40.5 MFS transporter (C4X49_10600)/hypothetical protein (C4X49_10635) Ph5-N 13.9 11 24149642428883 37.7 gspL (C4X49_11920)/phosphohistidine phosphatase SixA (C4X49_12010) a According to PHASTER predictions. tmRNA, transfer-messenger RNA. (ii) IS...”

BHE81_13165 alanine--tRNA ligase from Klebsiella sp. AqSCr
68% identity, 97% coverage

• Transcriptome Analysis Reveals Cr(VI) Adaptation Mechanisms in Klebsiella sp. Strain AqSCr
  Lara, Frontiers in microbiology 2021
  • “...Supplementary Table 3 , and their specificity was confirmed by melting curve analysis. The alaRS (BHE81_13165) gene (coding the Alanyl-tRNA synthetase) was used as the internal reference. For cDNA synthesis, 1 g of RNA was reverse transcribed using the RevertAid H Minus Reverse Transcriptase (ThermoFisher Scientific...”
  • “...5.21 0.03 cydB (BHE81_19515) 2.62 0.19 gltA1 (BHE81_03385) 4.35 0.03 rpoB (BHE81_23755) 0.012 1.21 alaRS (BHE81_13165) 0.04 1.00 sdaAB (BHE81_09265) 0.04 1.17 Cr(VI) promotes significant changes in the global gene transcription of Klebsiella sp. strain AqSCr ( Figures 5 , 6 ). The Cr(VI)-adapted state of...”

HI0814 alanyl-tRNA synthetase (alaS) from Haemophilus influenzae Rd KW20
63% identity, 100% coverage

• Essentiality Assessment of Cysteinyl and Lysyl-tRNA Synthetases of Mycobacterium smegmatis
  Ravishankar, PloS one 2016
  • “...coli H . influenzae S . aureus S . pneumoniae AlaRS MSMEG_3025 Rv2555c ML0512 b2697 HI0814 SA1446 SP1383 GlyRS MSMEG_4485 Rv2357c ML0826 b3559,b3560 HI0924,HI0927 SA1394 SP1474,SP1475 ValRS MSMEG_4630 Rv2448c ML1472 b4258 HI1391 SA1488 SP0568 LeuRS MSMEG_6917 Rv0041 ML0032 b0642 HI0921 SA1579 SP0254 IleRS MSMEG_3169 Rv1536 ML1195...”
• Genome-scale approaches to identify genes essential for Haemophilus influenzae pathogenesis
  Wong, Frontiers in cellular and infection microbiology 2012
  • “...HI0527 fdx-2 Ferredoxin d HI0936 Cytochrome C-type biogenesis d TRANSCRIPTION/DNA PROCESSING HI0700 Hypothetical protein d HI0814 alaS Alanyl-tRNA synthetase d HI1056 Type III restriction-modification system methyltransferase-like protein d HI1459 RNA polymerase sigma-70 factor d HI1528 parE DNA topoisomerase IV subunit B d PROTEIN MODIFICATION HI0428 dsbB...”

WP_004155915 alanine--tRNA ligase from Erwinia amylovora ACW56400
65% identity, 99% coverage

• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...number. Ecol , Escherichia coli (ACB03816); Sent , Salmonella enterica (WP_065680553); Eamy , Erwinia amylovora (WP_004155915); Vpar , Vibrio parahaemolyticus (WP_086591229); Abau , Acinetobacter baumannii (ACC56466); Paer , Pseudomonas aeruginosa (WP_034012995); Nmen , Neisseria meningitidis (WP_010980961); Rpal , Rhodopseudomonas palustris (WP_044410751); Hpyl , Helicobacter pylori (WP_000354743);...”

YP_0381 alanyl-tRNA synthetase from Yersinia pestis biovar Medievalis str. 91001
66% identity, 99% coverage

• Comparative Lysine Acetylome Analysis of Y. pestis YfiQ/CobB Mutants Reveals that Acetylation of SlyA Lys73 Significantly Promotes Biofilm Formation of Y. pestis
  Tan, Microbiology spectrum 2023
  • “...Probable endonuclease 4 YP_1901 ruvB Holliday junction ATP-dependent DNA helicase RuvB Amino acid binding (GO:0016597) YP_0381 alaS Alanine-tRNA ligase YP_0638 argI Ornithine carbamoyl transferase YP_3602 gcvP Glycine dehydrogenase (decarboxylating) YP_2548 glyA Serine hydroxymethyltransferase YP_3124 argB Acetylglutamate kinase YP_0566 argR Arginine repressor YP_3842 pyrB Aspartate carbamoyl transferase...”

WP_086591229 alanine--tRNA ligase from Vibrio parahaemolyticus
64% identity, 100% coverage

• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(ACB03816); Sent , Salmonella enterica (WP_065680553); Eamy , Erwinia amylovora (WP_004155915); Vpar , Vibrio parahaemolyticus (WP_086591229); Abau , Acinetobacter baumannii (ACC56466); Paer , Pseudomonas aeruginosa (WP_034012995); Nmen , Neisseria meningitidis (WP_010980961); Rpal , Rhodopseudomonas palustris (WP_044410751); Hpyl , Helicobacter pylori (WP_000354743); Aaeo , Aquifex aeolicus (WP_010880825);...”

VP2548 alanyl-tRNA synthetase from Vibrio parahaemolyticus RIMD 2210633
64% identity, 100% coverage

• Insights into Vibrio parahaemolyticus CHN25 response to artificial gastric fluid stress by transcriptomic analysis
  Sun, International journal of molecular sciences 2014
  • “...4.6439 Glyceraldehyde-3-phosphate dehydrogenase Aminoacyl-tRNA biosynthesis VP2470 Chn25_2407 2.0793 Tyrosyl-tRNA synthetase VP1280 Chn25_1286 0.4891 Threonyl-tRNA synthetase VP2548 ( alaS ) Chn25_2482 2.6177 Alanyl-tRNA synthetase VP0861 ( argS ) Chn25_0854 2.7778 Arginyl-tRNA synthetase VP1150 ( cysS ) Chn25_1159 2.0297 Cysteinyl-tRNA synthetase VP0021 ( glyS ) Chn25_0010 3.0031 Glycyl-tRNA...”

APJL_0644 alanyl-tRNA synthetase from Actinobacillus pleuropneumoniae serovar 3 str. JL03
62% identity, 100% coverage

• A Transcriptome Map of Actinobacillus pleuropneumoniae at Single-Nucleotide Resolution Using Deep RNA-Seq
  Su, PloS one 2016
  • “...598881 599063 182 - Y APJL_0553(+) APJL_0559(+) t44 B APP-S18 703124 703153 30 Y Y APJL_0644(-) APJL_0645(-) - C APP-S19 753851 754045 195 - Y APJL_0686(-) APJL_0687(-) MOCO_RNA_motif B APP-S20 755351 755515 164 - Y APJL_0687(-) APJL_0688(+) MOCO_RNA_motif B APP-S21 765539 765588 50 Y Y APJL_0696(-)...”

VC0545 alanyl-tRNA synthetase from Vibrio cholerae O1 biovar eltor str. N16961
64% identity, 99% coverage

• A systems biology approach to modeling vibrio cholerae gene expression under virulence-inducing conditions
  Kanjilal, Journal of bacteriology 2010
  • “...VC2149 VC2216 VC2306 VC2351 VC2523 VCA0835 VC0006 VC0369 VC0545 VC2184 VC2259 VCA0291 VC0460 VC0468 VC0585 VC0745 VC1231 VC1483 VC1827 VC1995 VC2021 VC2484...”

A1S_1176 alanyl-tRNA synthetase from Acinetobacter baumannii ATCC 17978
65% identity, 95% coverage

• DNA damage response coregulator <i>ddrR</i> affects many cellular pathways and processes in <i>Acinetobacter baumannii</i> 17978
  Cook, Frontiers in cellular and infection microbiology 2023
  • “...upreg NSD rpsC A1S_3075 NSD NSD KZA74_07320 A1S_2061 upreg NSD frr A1S_1974 upreg downreg alaS A1S_1176 upreg NSD KZA74_12925 A1S_1142 upreg NSD KZA74_16540 A1S_0378 NSD NSD KZA74_17025 A1S_0279 upreg NSD gpmI A1S_0230 upreg NSD lldP A1S_0067 NSD NSD KZA74_18085 A1S_0066 NSD NSD wbpD A1S_0054 NSD NSD...”

BCAL1416 alanyl-tRNA synthetase from Burkholderia cenocepacia J2315
61% identity, 100% coverage

• Characterization of the Burkholderia cenocepacia J2315 Surface-Exposed Immunoproteome
  Sousa, Vaccines 2020
  • “...Peptides Identified (PSMs) 2 Subcellular Localization 3 Domains 4 B-Cell Epitope Average (Predicted Peptides) 5 BCAL1416 (AlaS) Alanyl-tRNA synthetase 23 (28) U (Class 3) tRNA synthetases class II (A) (PF01411) Threonyl and Alanyl tRNA synthetase second additional domain (PF07973) DHHA1 domain (PF02272) 0.464 (23) BCAM0965 (mdh)...”
• Proteomic profiling of Burkholderia cenocepacia clonal isolates with different virulence potential retrieved from a cystic fibrosis patient during chronic lung infection
  Madeira, PloS one 2013
  • “...1.1 0.032 22 Q123F6 BCAL0232 tuf Elongation factor Tu 2.9 1.8 0.6 <0.001 178 Q1BX19 BCAL1416 alaS Alanine-tRNA ligase 2.9 2.0 0.7 <0.001 181 A2VV06 BCAL0679 argS Arginine-tRNA ligase 2.9 1.7 0.6 <0.001 183 Q1BSL2 BCAL0484 gatA Glutamyl-tRNA (Gln) amidotransferase subunit A 4.1 2.2 0.5 <0.001...”

BP1836 alanyl-tRNA synthetase from Bordetella pertussis Tohama I
63% identity, 100% coverage

• A gel-free proteomic-based method for the characterization of Bordetella pertussis clinical isolates
  Williamson, Journal of microbiological methods 2012
  • “...purB 50 C 7 (3) 5 (2) 9 (3) 9 (3) Metabolism Alanyl-tRNA synthetase NP_880538 BP1836 alaS 96 C 15 (10) 9 (6) 8 (6) 8 (5) Translation ATP-dependent protease La NP_880488 BP1777 Ion 90 C 5 (4) 5 (3) 6 (4) 5 (3) Metabolism Autotransporter...”
• Bordetella pertussis autotransporter Vag8 binds human C1 esterase inhibitor and confers serum resistance
  Marr, PloS one 2011
  • “...BP0869 pepN aminopeptidase N 240 621 BP0993 aceE pyruvate dehydrogenase E1 component 234 not detected BP1836 alaS , lovB alanyl-tRNA synthetase 219 662 BP0489 gyrB DNA gyrase subunit B 116 not detected BP2573 pheT phenylalanyl-tRNA synthetase beta chain PheT 76 527 BP0944 gyrA DNA gyrase subunit...”

Q1BX19 Alanine--tRNA ligase from Burkholderia orbicola (strain AU 1054)
61% identity, 100% coverage

• Proteomic profiling of Burkholderia cenocepacia clonal isolates with different virulence potential retrieved from a cystic fibrosis patient during chronic lung infection
  Madeira, PloS one 2013
  • “...2.5 1.1 0.032 22 Q123F6 BCAL0232 tuf Elongation factor Tu 2.9 1.8 0.6 <0.001 178 Q1BX19 BCAL1416 alaS Alanine-tRNA ligase 2.9 2.0 0.7 <0.001 181 A2VV06 BCAL0679 argS Arginine-tRNA ligase 2.9 1.7 0.6 <0.001 183 Q1BSL2 BCAL0484 gatA Glutamyl-tRNA (Gln) amidotransferase subunit A 4.1 2.2 0.5...”

EIKCOROL_00085 alanine--tRNA ligase from Eikenella corrodens ATCC 23834
62% identity, 100% coverage

• Proteomic study of plaque fluid in high caries and caries free children
  Chen, Technology and health care : official journal of the European Society for Engineering and Medicine 2022
  • “...1.57 gi | 213962204 hypothetical protein CAPSP0001_1551 146 1874.39 1.57 gi | 225023233 hypothetical protein EIKCOROL_00085 147 1494.21 1.57 gi | 229210434 UDP-N-acetylmuramyl tripeptide synthase 148 1673.82 1.56 gi | 19705272 4-amino-4-deoxychorismate lyase 149 1951.21 1.56 gi | 42525731 TPR domain-containing protein 150 2204.99 1.56 gi...”

NMB1595 alanyl-tRNA synthetase from Neisseria meningitidis MC58
WP_010980961 alanine--tRNA ligase from Neisseria meningitidis MC58
62% identity, 100% coverage

• Phasome analysis of pathogenic and commensal Neisseria species expands the known repertoire of phase variable genes, and highlights common adaptive strategies
  Wanford, PloS one 2018
  • “...CGGTTG (3) Genic NMB1352 ++ + + YSIRK family signal peptide None AAGAA (3) Genic NMB1595 ++ ++ ++ Alanyl-tRNA synthetase None CGCGCC (3) Genic macB (NGO1439) + ++ + Macrolide efflux Alignment CAGGG (34) Intergenic NMB1605 + ++ ++ Topoisomerase IV subunit A None GGCGC...”
• An in vitro strategy for the selective isolation of anomalous DNA from prokaryotic genomes
  van, Nucleic acids research 2004
  • “...sequence and association with a transfer RNA (tRNA) gene (NMB1595) and an insertion sequence IS1106 (ORF NMB1601) at its boundaries. As the functions of these...”
• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(WP_086591229); Abau , Acinetobacter baumannii (ACC56466); Paer , Pseudomonas aeruginosa (WP_034012995); Nmen , Neisseria meningitidis (WP_010980961); Rpal , Rhodopseudomonas palustris (WP_044410751); Hpyl , Helicobacter pylori (WP_000354743); Aaeo , Aquifex aeolicus (WP_010880825); Bsub , Bacillus subtilis (WP_086344136); Tthe , Thermus thermophilus (WP_011228945); Mtub , Mycobacterium tuberculosis (WP_055366958);...”

Smlt1743 putative alanyl-tRNA synthetase from Stenotrophomonas maltophilia K279a
62% identity, 97% coverage

• A polysaccharide lyase from Stenotrophomonas maltophilia with a unique, pH-regulated substrate specificity
  MacDonald, The Journal of biological chemistry 2014
  • “...Substrate Specificity TABLE 3 Effect of various chemicals on Smlt1743 lyase activity Enzyme was incubated in 30 mM buffer containing NaCl, CaCl2, or Vcpal at...”

PD0094 alanyl-tRNA synthetase from Xylella fastidiosa Temecula1
57% identity, 99% coverage

• The Exometabolome of Xylella fastidiosa in Contact with Paraburkholderia phytofirmans Supernatant Reveals Changes in Nicotinamide, Amino Acids, Biotin, and Plant Hormones
  Feitosa-Junior, Metabolites 2024
  • “...Score e-Score Reaction-to-Gene Database ID Reaction-to-Gene e-Score Gene-to-Reaction Database ID Gene-to-Reaction MAGI Score 2-Aminoisobutyric acid PD0094 2.00 200.00 ALANINE--TRNA-LIGASE-RXN 200.00 ALANINE--TRNA-LIGASE-RXN 1.58 PD1696 2.00 200.00 RXN-16659 200.00 RXN-16659 1.58 2.00 200.00 RXN-16649 200.00 RXN-16649 1.58 PD1823 2.00 200.00 RHEA:20249 200.00 RHEA:20249 1.58 PD1864 2.00 200.00 RHEA:11224...”
  • “...Alanine PD1864 2.00 200.00 RHEA:11224 200.00 RHEA:11224 6.33 PD1823 2.00 200.00 RHEA:20249 200.00 RHEA:20249 6.33 PD0094 2.00 200.00 ALANINE--TRNA-LIGASE-RXN 200.00 ALANINE--TRNA-LIGASE-RXN 6.33 Arginine PD0116 2.00 34.19 ARGININE--TRNA-LIGASE-RXN 32.31 ARGININE--TRNA-LIGASE-RXN 4.01 Asparagine PD1947 2.00 200.00 ASPARAGINE--TRNA-LIGASE-RXN 200.00 ASPARAGINE--TRNA-LIGASE-RXN 6.33 Aspartate PD0089 2.00 200.00 RHEA:12228 200.00 RHEA:12228 6.33...”

BAB1_1223 Alanyl-tRNA synthetase, class IIc:Phosphoesterase, DHHA1:Alanyl-transfer RNA synthetase from Brucella melitensis biovar Abortus 2308
54% identity, 96% coverage

• Iron-dependent reconfiguration of the proteome underlies the intracellular lifestyle of Brucella abortus
  Roset, Scientific reports 2017
  • “...C NO 1.36 0.11 GI:82699998 BAB1_1181 frr ribosome recycling factor C NO 0.79 0.04 GI:82700035 BAB1_1223 alaS alanyl-tRNA synthetase C NO 1.33 0.04 GI:82700083 BAB1_1271 ef_Tu elongation factor Tu U NO 1.45 0.04 GI:82616743 BAB1_1872 prfA peptide chain release factor 1 C NO 1.43 0.16 GI:82939410...”
• Proteomics-based confirmation of protein expression and correction of annotation errors in the Brucella abortus genome
  Lamontagne, BMC genomics 2010
  • “...LpdA-2 BAB2_0566 AldA BAB1_0588 ATP/GTP-binding BAB1_1213 Unknown; conserved BAB1_1926 SucC BAB2_0568 Unknown BAB1_0641 Alanine aminopep- BAB1_1223 AlaS BAB1_1936 GloB BAB2_0572 IlvE tidase: Neutral zinc BAB1_1224 RecA BAB1_1946 SecA BAB2_0620 Unknown metallopeptidase, BAB1_1233 RpsM; S13 BAB1_1970 FadB BAB2_0642 Acyl-CoA zinc-binding region BAB1_1234 Adk BAB1_1971 EtfA dehydrogenase BAB1_0666...”

CC2529, NP_421332 alanyl-tRNA synthetase from Caulobacter crescentus CB15
52% identity, 98% coverage

• Bacterial cell cycle control by citrate synthase independent of enzymatic activity
  Bergé, eLife 2020
  • “...immunoprecipitation coupled to deep-sequencing)performed with antibodies recognizing the RNAP on chromatin from WT (MB1), citA (CC2529) and a strain expressing relA-FLAG from the xylX promoter (MB3282). Direct targets of CtrA, classified into two classesG 1 and Sarerepresented. The color key indicates the degree towhich the occupancy...”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “..., Arabidopsis thaliana (CAA80380); B. subtilis , Bacillus subtilis (NP_390618); C. crescentus , Caulobacter crescentus (NP_421332); D. melanogaster , Drosophila melanogaster (DmAlaRS1, NP_523511.2; DmAlaRS2, NP_523932.2); E. coli , Escherichia coli (NP_417177); G. lamblia , Giardia lamblia (XP_001704452); H. sapiens , Homo sapiens (HsAlaRS1, BAA06808; HsAlaRS2, NP_065796);...”

bll5750 alanyl-tRNA synthetase from Bradyrhizobium japonicum USDA 110
52% identity, 97% coverage

• Identification of the Important Genes of Bradyrhizobium diazoefficiens 113-2 Involved in Soybean Nodule Development and Senescence
  Yuan, Frontiers in microbiology 2021
  • “...2018 113-2GL007693 blr1971 Pessi et al., 2007 Glyma.01G118900 blr1971 113-2GL007693 Delmotte et al., 2010 Glyma.02G155300 bll5750 113-2GL003467 uklina et al., 2016 Glyma.02G208700 Zhang et al., 2018 Glyma.03G004900 Glyma.03G195400 Glyma.04G007400 Glyma.04G081100 Glyma.05G204000 Glyma.07G079700 Glyma.07G173100 Glyma.08G067400 Glyma.09G278600 Glyma.10G280000 Glyma.11G102100 Glyma.11G237400 Glyma.14G176900 Glyma.14G206300 Glyma.15G058400 Glyma.16G117600 Glyma.18G056100 Glyma.18G060600 Glyma.18G210100 Glyma.19G173400...”

B0UGC4 Alanine--tRNA ligase from Methylobacterium sp. (strain 4-46)
52% identity, 96% coverage

• Contact Effect of a Methylobacterium sp. Extract on Biofilm of a Mycobacterium chimaera Strain Isolated from a 3T Heater-Cooler System
  Pradal, Antibiotics (Basel, Switzerland) 2020
  • “...kinase Methylobacterium aquaticum 38 B0ULW9 R.LLIDVK.E Glycosyl transferase group 1 Methylobacterium sp. (strain 4-46) 37 B0UGC4 R.LERELSEARR.K Alanine--tRNA ligase Methylobacterium sp. (strain 4-46) 37 3 A0A389MRA9 K.IVADNNLK.L K.AMGGDLEAQSR.R R.SVMADVLQNAVNEANQK.I Trigger factor Methylobacterium sp. 135 A0A0X1SM13 R.GSRATVSLPR.A Glutamine amidotransferase Methylobacterium sp . AMS5 54 A0A0Q4WX57 R.VLSELGTR.A Chaperone...”

WP_044410751 alanine--tRNA ligase from Rhodopseudomonas sp. BAL398
53% identity, 96% coverage

• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(ACC56466); Paer , Pseudomonas aeruginosa (WP_034012995); Nmen , Neisseria meningitidis (WP_010980961); Rpal , Rhodopseudomonas palustris (WP_044410751); Hpyl , Helicobacter pylori (WP_000354743); Aaeo , Aquifex aeolicus (WP_010880825); Bsub , Bacillus subtilis (WP_086344136); Tthe , Thermus thermophilus (WP_011228945); Mtub , Mycobacterium tuberculosis (WP_055366958); Sfil , Streptomyces filamentosus (WP_006123197);...”

DVU1089 alanyl-tRNA synthetase from Desulfovibrio vulgaris Hildenborough
49% identity, 98% coverage

• Antimicrobial Effects of Free Nitrous Acid on Desulfovibrio vulgaris: Implications for Sulfide-Induced Corrosion of Concrete
  Gao, Applied and environmental microbiology 2016
  • “...DVU1308 DVU1574 DVU0928 DVU1303 DVU1315 DVU1318 DVU2927 DVU1089 DVU3166 DVU1248 DVU3367 DVU0808 DVU1885 DVU0001 DVU2252 DVU0004 DVU0003 DVU0483 DVU0002 DVU1193...”

A9HL73 Alanine--tRNA ligase from Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
52% identity, 97% coverage

• Arabidopsis thaliana exudates induce growth and proteomic changes in Gluconacetobacter diazotrophicus
  Dos, PeerJ 2020
  • “...0.59 A9HEI5 Uncharacterized protein GDI1295 3.00 3,273.24 0.63 A9H9C0 Inosine-guanosine kinase GDI0702 4.00 1,497.69 0.63 A9HL73 Alanine--tRNA ligase alaS 13.00 1,109.99 0.64 A9HPE1 Extracellular solute-binding protein family 1 GDI2634 13.00 9,768.71 0.66 10.7717/peerj.9600/fig-3 Figure 3 Analyses of identified proteins of G. diazotrophicus co-cultivated with A. thaliana...”

BU403 alanyl-tRNA synthetase from Buchnera aphidicola str. APS (Acyrthosiphon pisum)
47% identity, 99% coverage

• Remaining flexible in old alliances: functional plasticity in constrained mutualisms
  Wernegreen, DNA and cell biology 2009
  • “...graminum Buchnera- Baizongia pistaciae alaS b2697 Bpen174 Bfl168 WGLp234 BU403 BUsg390 Bbp364 birA b3973 Bpen190 Bfl184 WGLp513 - - - bolA b0435 - - - BU473...”

BQ07940 Alanyl-tRNA synthetase from Bartonella quintana str. Toulouse
Q6FZF1 Alanine--tRNA ligase from Bartonella quintana (strain Toulouse)
49% identity, 98% coverage

• Proteomic and immunoblot analyses of Bartonella quintana total membrane proteins identify antigens recognized by sera from infected patients
  Boonjakuakul, Infection and immunity 2007
  • “...2552 INFECT. IMMUN. BQ03760 BQ03760 BQ11170 BQ11170 BQ01090 BQ07940 BQ01090 BQ13580 BQ04770 BQ09000 BQ12230 BQ01690 BQ10750 ppdK ppdK clpB clpB acnA alaS acnA...”
• Proteomic and immunoblot analyses of Bartonella quintana total membrane proteins identify antigens recognized by sera from infected patients
  Boonjakuakul, Infection and immunity 2007
  • “...Q6G181 Q6G036 Q6G1K4 Q6G0B6 Q6G0B6 Q6G134 Q6G134 Q6G0V8 Q6FZF1 Q6G0V8 Q6FYB7 Q6G0P7 Q6G0P7 BQ08250 BQ08780 BQ08430 BQ11790 hbpE NA Q8KP11 Q6FYQ2 Q6FZC0 Q6FZ79...”

MXAN_5802 alanyl-tRNA synthetase from Myxococcus xanthus DK 1622
49% identity, 96% coverage

• Transcription factor MrpC binds to promoter regions of hundreds of developmentally-regulated genes in Myxococcus xanthus
  Robinson, BMC genomics 2014
  • “...on the DNA fragment. A DNA fragment encompassing a putative MrpC binding site upstream of MXAN_5802 produced 3 shifted complexes (Figure 4 , lane 6), suggesting the presence of multiple binding sites, which may account for the high rank of this site on the list of...”
  • “...-MrpC2 (+) (1M, except lane 4 in which 0.5M was added) were subjected to EMSAs. MXAN_5802 and 0524 were analyzed on the same gel, with intervening lanes removed, as indicated by narrower separation between panels. Filled and open arrowheads indicate complexes inferred to have one or...”

Bfl168 alanyl-tRNA synthetase from Candidatus Blochmannia floridanus
45% identity, 97% coverage

• Remaining flexible in old alliances: functional plasticity in constrained mutualisms
  Wernegreen, DNA and cell biology 2009
  • “...Schizaphis graminum Buchnera- Baizongia pistaciae alaS b2697 Bpen174 Bfl168 WGLp234 BU403 BUsg390 Bbp364 birA b3973 Bpen190 Bfl184 WGLp513 - - - bolA b0435 -...”

SAR11_0643 alanine-tRNA ligase from Candidatus Pelagibacter ubique HTCC1062
46% identity, 97% coverage

• Identification of candidate structured RNAs in the marine organism 'Candidatus Pelagibacter ubique'
  Meyer, BMC genomics 2009
  • “...motif (+) SAR11_0906 dnaE (+) SAR11_0907 rpsB (+) 628285628539 255 30.2 571 SAR11_0642 protease (-) SAR11_0643 alaS (+) 10056791005890 212 30.19 483 SAM-V (+) SAR11_1029 rplM (-) SAR11_1030 metY (+) 361353361571 219 30.14 76 SAR11_0369 grpE (-) SAR11_0370 HAM1-like prot. (+) 11254901125606 117 29.91 11 SAR11_1171...”

CD1282 alanyl-tRNA synthetase from Clostridium difficile 630
46% identity, 99% coverage

• The current riboswitch landscape in <i>Clostridioides difficile</i>
  Badilla, Microbiology (Reading, England) 2024
  • “...synthetase CD0014 Serine-tRNA ligase CD0049 Proline-tRNA ligase CD0574 Threonine-tRNA ligase CD0699 Phenylalanyl-tRNA synthetase alpha chain CD1282 Alanine-tRNA synthetase CD1521 Tyrosine-tRNA ligase CD2245 Asparagine-tRNA ligase CD2521 Leucine-tRNA ligase CD2618 Isoleucine-tRNA ligase CD3256 Valine-tRNA ligase CD3540 Methionine-tRNA ligase Amino acid metabolism CD0989 2-Isopropylmalate synthase CD1580 Homoserine dehydrogenase CD1580*...”

H375_6610 alanine--tRNA ligase from Rickettsia prowazekii str. Breinl
Q9ZCA4 Alanine--tRNA ligase from Rickettsia prowazekii (strain Madrid E)
46% identity, 98% coverage

• Identification and Characterization of Novel Small RNAs in Rickettsia prowazekii
  Schroeder, Frontiers in microbiology 2016
  • “...CcmF H375_8880 LSU ribosomal protein L6p (L9e) Rp_ sR67 30 37 7 H375_8490 MethioninetRNA ligase H375_6610 AlaninetRNA ligase H375_4810 Hypothetical protein H375 H375_2550 Reductase H375_1110 tRNA pseudouridine synthase B H375 H375_3730 Uncharacterized protein RP244 of Rickettsia H375_6090 ATP synthase subunit c H375 Listed are the common...”
• A dual-specificity aminoacyl-tRNA synthetase in the deep-rooted eukaryote Giardia lamblia
  Bunjun, Proceedings of the National Academy of Sciences of the United States of America 2000
  • “...horikoshii OT3 (sp O58035), Rickettsia prowazekii (sp Q9ZCA4), Saccharomyces cerevisiae (sp P40825), Sulfolobus solfataricus (sp P96041), Synechocystis sp. (sp...”

SYA_AQUAE / O67323 Alanine--tRNA ligase; Alanyl-tRNA synthetase; AlaRS; EC 6.1.1.7 from Aquifex aeolicus (strain VF5) (see paper)
WP_010880825 alanine--tRNA ligase from Aquifex aeolicus VF5
47% identity, 100% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged Ser-tRNA(Ala) and Gly-tRNA(Ala) via its editing domain.
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(WP_010980961); Rpal , Rhodopseudomonas palustris (WP_044410751); Hpyl , Helicobacter pylori (WP_000354743); Aaeo , Aquifex aeolicus (WP_010880825); Bsub , Bacillus subtilis (WP_086344136); Tthe , Thermus thermophilus (WP_011228945); Mtub , Mycobacterium tuberculosis (WP_055366958); Sfil , Streptomyces filamentosus (WP_006123197); Mpne , Mycoplasma pneumoniae (WP_014574975); Hsap , Homo sapiens (NP_001596);...”
• A dual-specificity aminoacyl-tRNA synthetase in the deep-rooted eukaryote Giardia lamblia
  Bunjun, Proceedings of the National Academy of Sciences of the United States of America 2000
  • “...pernix (sp Q9Y9 3), Aquifex aeolicus (sp O67323), Arabidopsis thaliana (sp P36428), Archaeoglobus fulgidus (sp O28029), Bacillus subtilis (sp O34526), Borrelia...”

BMMGA3_12250 alanine--tRNA ligase from Bacillus methanolicus MGA3
47% identity, 99% coverage

• Transcriptome analysis of thermophilic methylotrophic Bacillus methanolicus MGA3 using RNA-sequencing provides detailed insights into its previously uncharted transcriptional landscape
  Irla, BMC genomics 2015
  • “...its transcriptional organization Affected amino acid biosynthesis Related function Locus tag(s) (T-box)*- alaS Alanine aaRS BMMGA3_12250 gltX -(T-box)- cysE - cysS - mrnC - yacO - yacP Cysteine Amino acid biosynthesis, aaRS, maturation of 23S rRNA BMMGA3_00580-BMMGA3_00605 (T-box)- glyQS Glycine aaRS BMMGA3_11920 (T-box)- hisS - aspS...”

Ddes_0290 alanyl-tRNA synthetase from Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
49% identity, 98% coverage

• Coordinated response of the Desulfovibrio desulfuricans 27774 transcriptome to nitrate, nitrite and nitric oxide
  Cadby, Scientific reports 2017
  • “...1.63 0.019 O Ddes_0288 Porphobilinogen synthase 1.63 0.00303 H Ddes_0289 SAM-binding methylase 2.41 1.59E-06 R Ddes_0290 alaS Alanyl-tRNA synthetase 1.49 0.0132 J Ddes_0334 Prephenate dehydrogenase 1.52 0.0206 E Ddes_0335 3-phosphoshikimate 1-carboxyvinyltransferase 1.35 0.0377 E Ddes_0336 Chorismate mutase 1.56 0.00875 E Ddes_0337 3-dehydroquinate synthase 1.45 0.0119 E...”

WP_086344136 alanine--tRNA ligase from Bacillus subtilis
47% identity, 100% coverage

• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(WP_044410751); Hpyl , Helicobacter pylori (WP_000354743); Aaeo , Aquifex aeolicus (WP_010880825); Bsub , Bacillus subtilis (WP_086344136); Tthe , Thermus thermophilus (WP_011228945); Mtub , Mycobacterium tuberculosis (WP_055366958); Sfil , Streptomyces filamentosus (WP_006123197); Mpne , Mycoplasma pneumoniae (WP_014574975); Hsap , Homo sapiens (NP_001596); Dmel , Drosophila melanogaster (NP_523511);...”

BSU27410, NP_390618 alanyl-tRNA synthetase from Bacillus subtilis subsp. subtilis str. 168
O34526 Alanine--tRNA ligase from Bacillus subtilis (strain 168)
47% identity, 100% coverage

• The Blueprint of a Minimal Cell: MiniBacillus
  Reuß, Microbiology and molecular biology reviews : MMBR 2016
  • “...3CDI 3DEV B. subtilis E. coli Staphylococcus haemolyticus BSU27410 BSU37330 Yes Yes Yes Yes 6.1.1.7 6.1.1.19 3HTZ 3FNR E. coli Campylobacter jejuni asnS aspS...”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “..., Archaeoglobus fulgidus (NP_071080); A. thaliana , Arabidopsis thaliana (CAA80380); B. subtilis , Bacillus subtilis (NP_390618); C. crescentus , Caulobacter crescentus (NP_421332); D. melanogaster , Drosophila melanogaster (DmAlaRS1, NP_523511.2; DmAlaRS2, NP_523932.2); E. coli , Escherichia coli (NP_417177); G. lamblia , Giardia lamblia (XP_001704452); H. sapiens ,...”
• Gene discovery within the planctomycete division of the domain Bacteria using sequence tags from genomic DNA libraries
  Jenkins, Genome biology 2002
  • “...tRNA ligase) 1.00E-25 Thermotoga maritima (Q9WY15) B pl2-A10 BH001161 Alanyl tRNA synthetase 6.00E-14 Bacillus subtilis (O34526) B Miscellaneous F3 BH001162 Ribonuclease E (RNase E) 1.00E-38 Haemophilus influenzae (P44443) B H6 BH001163 Inter-alpha-trypsin inhibitor heavy chain H2 precursor 2.00E-06 Mus musculus (Q61703) E pl2-D4 BH001164 Putative methionine...”
• A dual-specificity aminoacyl-tRNA synthetase in the deep-rooted eukaryote Giardia lamblia
  Bunjun, Proceedings of the National Academy of Sciences of the United States of America 2000
  • “...fulgidus (sp O28029), Bacillus subtilis (sp O34526), Borrelia burgdorferi (sp O51238), Caenorhabditis elegans (gb AAB52339.1), Chlamydia trachomatis (sp...”

SACOL1673 alanyl-tRNA synthetase from Staphylococcus aureus subsp. aureus COL
45% identity, 99% coverage

• Global analysis of the Staphylococcus aureus response to mupirocin
  Reiss, Antimicrobial agents and chemotherapy 2012
  • “...10 min 30 min 60 min c2 SACOL1385 SACOL1673 SACOL1984 SACOL2097 AcnA AlaS AldA2 AtpA Aconitate hydratase Alanyl-tRNA synthetase Aldehyde dehydrogenase ATP...”

SAOV_1616 alanine--tRNA ligase from Staphylococcus aureus subsp. aureus ED133
45% identity, 99% coverage

• Staphylococcus aureus seroproteomes discriminate ruminant isolates causing mild or severe mastitis
  Le, Veterinary research 2011
  • “...SAOV_1627 4,99 66584 233,90 7,65 4 0,21 S C alaS alanyl-tRNA synthetase 82 011_2466 046_2291 SAOV_1616 5,00 98604 442,31 11,74 8 0,30 O C [ 97 ] Transcription nusA transcription elongation factor NusA 62 011_0919 046_0765 SAOV_1268 4,60 43701 247,74 11,00 4 0,34 S C DNA...”

SAV1618 alanine--tRNA ligase from Staphylococcus aureus subsp. aureus Mu50
SA1446 alanyl-tRNA synthetase from Staphylococcus aureus subsp. aureus N315
NP_372142 alanyl-tRNA synthetase from Staphylococcus aureus subsp. aureus Mu50
45% identity, 99% coverage

• Inhibition of Staphylococcus aureus biofilm formation by gurmarin, a plant-derived cyclic peptide
  Chang, Frontiers in cellular and infection microbiology 2022
  • “...(guaA) glutamine hydrolyzing guaA 0.02 SAV0432 -10.24 Probable restriction modification system specificity subunit hsdS 0.01 SAV1618 -9.99 Alanyl-tRNA synthetase alaS 0.01 SAV0195 -8.85 Probable type I restriction enzyme restriction chain hsdR 0.02 SACOL0712 -8.35 Lipase-esterase 0.02 SACOL0852 -7.72 Hypothetical protein 0.02 SAV2169 -7.62 Probable multidrug transporter...”
• Essentiality Assessment of Cysteinyl and Lysyl-tRNA Synthetases of Mycobacterium smegmatis
  Ravishankar, PloS one 2016
  • “...H . influenzae S . aureus S . pneumoniae AlaRS MSMEG_3025 Rv2555c ML0512 b2697 HI0814 SA1446 SP1383 GlyRS MSMEG_4485 Rv2357c ML0826 b3559,b3560 HI0924,HI0927 SA1394 SP1474,SP1475 ValRS MSMEG_4630 Rv2448c ML1472 b4258 HI1391 SA1488 SP0568 LeuRS MSMEG_6917 Rv0041 ML0032 b0642 HI0921 SA1579 SP0254 IleRS MSMEG_3169 Rv1536 ML1195 b0026...”
• Levels of alpha-toxin correlate with distinct phenotypic response profiles of blood mononuclear cells and with agr background of community-associated Staphylococcus aureus isolates
  Mairpady, PloS one 2014
  • “...II t345 ST772/CC1 + ND se -A, C, L/ tsst -1/+ P (23.7) -toxin + Sa1446 MRSA-V II t657 ST772/CC1 + ND se - A, E//+ P (25.4) -toxin + Sa233 MRSA-V II t657 ST772/CC1 + ND se -A, C, E, L//+ P (30.0) -toxin ++...”
• walK and clpP mutations confer reduced vancomycin susceptibility in Staphylococcus aureus
  Shoji, Antimicrobial agents and chemotherapy 2011
  • “...SA0488 SA0564 SA0855 SA0985 SA0986 SA1036 SA1106 SA1287 SA1446 SA1456 SA1457 SA1488 SA1506 SA1550 SA1563 SA1579 SA1715 SA1716 SA1717 serS metS lysS gltX cysS...”
• Blood Serum Affects Polysaccharide Production and Surface Protein Expression in S. Aureus
  Islam, Advances in biotechnology & microbiology (Newbury, Calif.) 2017
  • “...3.1soleucyl-tRNA synthetase (ileS) Aminio Acid biosynthesis 5.2/104 NP_371717 b6 1. Alanyl-tRNA synthetase RNA synthesis 4.9/93 NP_372142 2. Hypothetical protein (SAV0219) Not known 4.6/37 NP_370743 3.Collagen adhesin precursor (MW2612) Surface Adhesin 5.81132 NP_647429 b7 1 Alpha-keto acid dehydrogenase (pdhc) Carbohydrate metabolism 4.8/46 NP_371619 2. Preprotein translocase (secA)...”

W8YHI6 Alanine--tRNA ligase from Bacillus thuringiensis DB27
47% identity, 99% coverage

• Role of hsp20 in the Production of Spores and Insecticidal Crystal Proteins in Bacillus thuringiensis
  Xie, Frontiers in microbiology 2019
  • “...Enolase W8Y537 0.49 rplA 50S ribosomal protein L1 W8YSF0 0.42 rplE 50S ribosomal protein L5 W8YHI6 0.39 alaS Alanine tRNA ligase W8Y9C4 0.57 asnS Asparagine tRNA ligase W8YJP5 0.51 glyA Serine hydroxymethyltransferase W8YIL1 0.40 pepA cytosol aminopeptidase W8Y592 0.44 ctpA Carboxy-terminal processing protease These genes selected...”

FN0697 Alanyl-tRNA synthetase from Fusobacterium nucleatum subsp. nucleatum ATCC 25586
46% identity, 100% coverage

• Proteomics of Fusobacterium nucleatum within a model developing oral microbial community
  Hendrickson, MicrobiologyOpen 2014
  • “...FN2040. 3 Covers FN0040, FN0054, FN0067, FN0069, FN0070, FN0110, FN0298, FN0299, FN0405, FN0466, FN0506, FN0611, FN0697, FN0753, FN0754, FN0755, FN1268, FN1340, FN1489, FN1517, FN1579, FN1597, FN1658, FN1977, FN2011, FN2122, FN2123. Ribosomal proteins are noted to correlate with growth rates (Nomura etal. 1984 ). However, the cells...”

UH47_04780 alanine--tRNA ligase from Staphylococcus pseudintermedius
45% identity, 99% coverage

• Carprofen-induced depletion of proton motive force reverses TetK-mediated doxycycline resistance in methicillin-resistant Staphylococcus pseudintermedius
  Magnowska, Scientific reports 2019
  • “...translation UH47_03525 seryl-tRNA synthetase 0.7 translation UH47_05175 30S ribosomal protein S2 rpsB 0.6 0.7 translation UH47_04780 alaninetRNA ligase alaS 1.1 translation UH47_04960 valinetRNA ligase valS 1 translation UH47_11775 methioninetRNA ligase 0.6 0.9 translation Other proteins UH47_09860 phosphoribosylformylglycinamidine synthase 1 purine metabolism UH47_13130 tetracycline resistance protein tetK...”

EF1379 alanyl-tRNA synthetase from Enterococcus faecalis V583
46% identity, 99% coverage

• Integrating highly quantitative proteomics and genome-scale metabolic modeling to study pH adaptation in the human pathogen Enterococcus faecalis
  Großeholz, NPJ systems biology and applications 2016
  • “...The latter include enzymes required for biosynthesis of particular tRNA molecules, including those for L-alanine (EF1379), glycine (EF2406), L -isoleucine (EF1003) and L -valine (EF2931) and were upregulated ( Figure 4d ). These amino acids are found predominantly in transmembrane segments of membrane proteins. 35 Altogether,...”
• Identification of surface proteins in Enterococcus faecalis V583
  Bøhle, BMC genomics 2011
  • “...protein Cytoplasmic (1) 2 3 23.7 EF1319 - Hypothetical protein N-terminal anchor (1) 3 23.3 EF1379 Alanyl-tRNA synthetase Cytoplasmic 2 3.3 EF1420 - Hypothetical protein Lipid anchor SP-II, MTA-CS 2 (1) 15.6 EF1523 e - Hypothetical protein Cytoplasmic (1) 3 6.4 EF1613 fg Formate acetyltransferase Cytoplasmic...”
• Transcriptional response of Enterococcus faecalis V583 to erythromycin
  Aakra, Antimicrobial agents and chemotherapy 2005
  • “...Purine/pyrimidine/nucleoside/nucleotide Purine/pyrimidine/nucleoside/nucleotide EF0820 EF1379 EF1764 EF1970 EF2228 EF2856 EF2858 EF2931...”

Q97IG3 Alanine--tRNA ligase from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
43% identity, 99% coverage

• Trans-editing of mischarged tRNAs
  Ahel, Proceedings of the National Academy of Sciences of the United States of America 2003
  • “...D. radiodurans AlaRS (Q9RS27), C. acetobutylicum AlaRS (Q97IG3), Giardia lamblia AlaRS (AAG23137), M. barkeri AlaRS (ZP00077929), M. jannaschii AlaRS (Q57984),...”

3hxuA / P00957 Crystal structure of catalytic fragment of e. Coli alars in complex with alasa (see paper)
74% identity, 50% coverage

• Ligand: '5'-o-(n-(l-alanyl)-sulfamoyl)adenosine (3hxuA)

LMOf2365_1523 alanyl-tRNA synthetase from Listeria monocytogenes str. 4b F2365
45% identity, 99% coverage

• Transcriptomic Analysis of Listeria monocytogenes in Response to Bile Under Aerobic and Anaerobic Conditions
  Chakravarty, Frontiers in microbiology 2021
  • “...diphosphatase 4.1 LMOf2365_2133 Pyridoxal 5-phosphate synthase pdxS subunit 3.9 pyk LMOf2365_1592 Pyruvate kinase 3.9 alaS LMOf2365_1523 Alanyl-tRNA synthetase 3.9 fhs LMOf2365_1906 Formatetetrahydrofolate ligase 3.9 LMOf2365_1033 N-acetyldiaminopimelate deacetylase 3.8 LMOf2365_0872 D-alanine-D-alanine ligase 3.8 LMOf2365_0987 Putative GTP pyrophosphokinase 3.8 LMOf2365_1299 Acyl-CoA thioester hydrolase 3.8 LMOf2365_1512 Peptidase, M3 family...”

CJJ81176_0534 alanyl-tRNA synthetase from Campylobacter jejuni subsp. jejuni 81-176
46% identity, 100% coverage

• High-throughput sequencing of Campylobacter jejuni insertion mutant libraries reveals mapA as a fitness factor for chicken colonization
  Johnson, Journal of bacteriology 2014
  • “...CJJ81176_0076 CJJ81176_0107 CJJ81176_1421 CJJ81176_1336 CJJ81176_0534 CJJ81176_1519 CJJ81176_0856 CJJ81176_0802 CJJ81176_0661 CJJ81176_1431 CJJ81176_0202...”

lmo1504 alanyl-tRNA synthetase from Listeria monocytogenes EGD-e
44% identity, 99% coverage

• Genomic characteristics of listeria that caused invasive listeriosis during the COVID-19 pandemic
  Voronina, 2022
• SecA2 Associates with Translating Ribosomes and Contributes to the Secretion of Potent IFN-β Inducing RNAs
  Teubner, International journal of molecular sciences 2022
  • “...and conversion 0.05 0.06 lmo0259 * rpoC DNA-directed RNA polymerase subunit beta Transcription 0.05 0.05 lmo1504 alaS AlaninetRNA ligase Translation 0.04 0.05 lmo2019 ileS IsoleucinetRNA ligase Translation 0.03 0.04 lmo0007 gyrA DNA gyrase subunit A Replication. recombination and repair 0.03 0.03 * COGs = (Clusters of...”
• Mutant and Recombinant Phages Selected from In Vitro Coevolution Conditions Overcome Phage-Resistant Listeria monocytogenes
  Peters, Applied and environmental microbiology 2020 (secret)
• Comparison of Surface Proteomes of Adherence Variants of Listeria Monocytogenes Using LC-MS/MS for Identification of Potential Surface Adhesins
  Tiong, Pathogens (Basel, Switzerland) 2016
  • “...CY CY 0.03 (E,C) CY No No 0 No No <1.8 0.45 3 15 1 lmo1504 * (3.7.2) Alanyl-tRNA synthetase (98) S CY 0 CY No No 0 No No <1.8 0.37 7 24 4 lmo1519* (3.7.2) Aspartyl-tRNA synthetase (66) M CY 0 CY No No...”
• Intracellular gene expression profile of Listeria monocytogenes
  Chatterjee, Infection and immunity 2006
  • “...of genes encoding tRNA synthetases, i.e., alaS (lmo1504), hisS (lmo1520), ileS (lmo2019), glyS (lmo1458), serS (lmo2747), cysS (lmo0239), valS (lmo1552), thrS...”

LMRG_01466 alanyl-tRNA synthetase from Listeria monocytogenes 10403S
44% identity, 99% coverage

• Mutant and Recombinant Phages Selected from In Vitro Coevolution Conditions Overcome Phage-Resistant Listeria monocytogenes
  Peters, Applied and environmental microbiology 2020 (secret)

sll0362 alanyl-tRNA synthetase from Synechocystis sp. PCC 6803
45% identity, 99% coverage

• Ethylene causes transcriptomic changes in Synechocystis during phototaxis
  Lacey, Plant direct 2018
  • “...operons. The exceptions were several pairs of genes ( sll1392 and sll1393 ; sll0361 and sll0362 ; sll1063 and sll1064 ) and sll5041 through sll5046 . The group of 13 genes from slr1065 to slr1078 is predicted to be in three operons. Table 3 Selected clusters...”
• Recombination and gene conversion in a 170-kb genomic region of Arabidopsis thaliana
  Haubold, Genetics 2002
  • “...338-451 Annotation s.t. Synechocystis sp. PCC6803 sll0362 (alanyl-tRNA synthetase; alaS) s.t. lysosomal pro-x carboxypeptidase precursor (EC 3.4.16.2) s.t....”

SCO1501 alanyl-tRNA synthetase from Streptomyces coelicolor A3(2)
43% identity, 98% coverage

• The WblC/WhiB7 Transcription Factor Controls Intrinsic Resistance to Translation-Targeting Antibiotics by Altering Ribosome Composition
  Lee, mBio 2020
  • “...requirements of those genes may differ during antibiotic stress. For instance, alaS2 (SCO7600) and alaS (SCO1501) are paralogous genes encoding Ala-tRNA synthetases, and expression of the former is dependent on WblC and tetracycline but expression of the latter is not ( Fig.S5 and TableS2 ). Similar...”
  • “...text. Locus tags of each gene are shown in parentheses as follows: alaS2 (SCO7600), alaS (SCO1501), trpS (SCO3334), trpS2 (SCO4839), thrS2 (SCO3778), thrS (SCO1531), lrm (SCO6089), ksgA (SCO3149), arfB (SCO4278), prfB (SCO2972), tuf3 (SCO1321), tuf1 (SCO4662), fusB (SCO6589), tetM (SCO0783), and fusA (SCO4661). Download FIGS5, PDF...”
• Rapid functional screening of Streptomyces coelicolor regulators by use of a pH indicator and application to the MarR-like regulator AbsC
  Yang, Applied and environmental microbiology 2010
  • “...synthase 320 O 2 Amino acid metabolism SCO1501 SCO1595 SCO2198 SCO2210 SCO2241 SCO5699 Alanine tRNA synthetase, AlaS Phenylalanyl-tRNA synthetase alpha subunit,...”

SP_1383 alanyl-tRNA synthetase from Streptococcus pneumoniae TIGR4
44% identity, 99% coverage

• Streptococcus pneumoniae TIGR4 Phase-Locked Opacity Variants Differ in Virulence Phenotypes
  Oliver, mSphere 2017
  • “...S.pneumoniae TIGR4 virulence ( 33 ). Strain C had increased expression of three genes ( SP_1383 , SP_2175 , and SP_2176 ) known to be involved in d -alanylation of cell wall teichoic acids. Finally, strain D had reduced expression of six genes ( SP_0957 ,...”
  • “...B SP_2237 comC2 0.2 1.4 0.25 0.9 0.8 0.5 0.3 Competence-stimulating peptide type 2 C SP_1383 alaS 0.3 0.2 1.00 0.7 0.2 0.0 0.1 Alanine-tRNA ligase SP_2175 dltB 0.9 0.6 1.16 0.4 0.1 0.1 1.0 d -Alanyl-lipoteichoic acid biosynthesis protein DltB SP_2176 dltA 0.9 1.0 1.24...”
• Biofilm and planktonic pneumococci demonstrate disparate immunoreactivity to human convalescent sera
  Sanchez, BMC microbiology 2011
  • “...Elongation factor Tu (SP_0681) 29 59 Arginyl-tRNA synthetase argS (SP_2078) 11 14 Alanyl-tRNA synthetase alaS (SP_1383) 4 8 Glutamyl-tRNA(Gln) amidotransferase subunit A gatA (SP_0437) 0 4 Glycyl-tRNA synthetase alpha subunit glyQ (SP_1475) 0 4 Methionyl-tRNA formyltransferase fmt (SP_1735) 0 2 Methionyl-tRNA synthetase metG (SP_0788) 0 2...”

SMU_650, SMU_RS03080 alanine--tRNA ligase from Streptococcus mutans UA159
43% identity, 99% coverage

• Mass spectrometry and split luciferase complementation assays reveal the MecA protein interactome of Streptococcus mutans
  Qin, Microbiology spectrum 2024
  • “...SMU_RS08345 10 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit, GatA SMU_RS09775 3.2 7 Yes tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme, MnmG SMU_RS03080 2.3 6 Yes Alanine-tRNA ligase, AlaS SMU_RS06850 5 6 Yes Phenylalanine-tRNA ligase subunit beta, PheT SMU_RS03595 5 Lysine-tRNA ligase, LysS SMU_RS08265 4.7 Ribosome biogenesis GTPase, YqeH SMU_RS00770 4.5 30S ribosomal...”
• Protein Interactomes of Streptococcus mutans YidC1 and YidC2 Membrane Protein Insertases Suggest SRP Pathway-Independent- and -Dependent Functions, Respectively
  Lara, mSphere 2021
  • “...initiation factor 2 (SMU_421) Putative translation initiation factor IF3 (SMU_697) Putative alanyl-tRNA synthetase (alanine-tRNA ligase) (SMU_650) Translocation Preprotein translocase subunit SecA (SMU_1838) Putative preprotein translocase SecY protein (SMU_2006) Putative secreted protein, preprotein translocase subunit YajC (SMU_1787c) Putative signal peptidase II (SMU_1661c) Chaperones/proteases Peptidyl-prolyl isomerase RopA (trigger...”

spr1240 Alanyl-tRNA synthetase from Streptococcus pneumoniae R6
SPD_1216 alanyl-tRNA synthetase from Streptococcus pneumoniae D39
SPV_1216 alanine--tRNA ligase from Streptococcus pneumoniae
44% identity, 99% coverage

• Whole genome sequencing of penicillin-resistant Streptococcus pneumoniae reveals mutations in penicillin-binding proteins and in a putative iron permease
  Fani, Genome biology 2011
  • “...SYN G620A G207D GAC660AAT T221I AA689CG E230A T696A SYN spr1224 Conserved hypothetical protein T564C SYN spr1240 Alanyl-tRNA synthetase A139G T47A spr1254 ABC transporter ATP-binding protein-phosphate transport (PstB) G499A G167S C614T T205I spr1260 Conserved hypothetical protein T597C SYN spr1272 N-Acetylglucosamine-6-phosphate isomerase G385A G129R spr1384 UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysine ligase G996A...”
• Phenotypic characterization of Streptococcus pneumoniae biofilm development
  Allegrucci, Journal of bacteriology 2006
  • “...nrdE (spr1065) Day 3 81.86 5.3 9/9 alaS (spr1240) pnp (spr0734) hisS (spr1931) gauA (spr1300) lysS (spr0626) glyS (spr1328) accC (spr0385) gpdA (spr1902) rpsA...”
• Pivotal Roles for Ribonucleases in Streptococcus pneumoniae Pathogenesis
  Sinha, mBio 2021
  • “...2.19 6.74E03 SPD_1707 Hypothetical protein 2.25 2.79E04 SPD_1792 Hypothetical protein 2.16 2.13E04 Decreased relative expression SPD_1216 c alaS Alanyl-tRNA synthetase 0.52 2.13E04 SPD_1596 b , d trpA Tryptophan synthase alpha chain 0.49 2.13E04 SPD_1597 d trpB Tryptophan synthase beta chain 0.42 1.03E07 SPD_1598 d trpF Phosphoribosylanthranilate...”
  • “...1.54E07 SPD_SR57 spd_0988 , spd_0987 1.83 2.62E05 SPD_SR54 spd_1190 , rplJ 1.95 7.51E07 SPD_SR70 b spd_1216 , spd_1217 2.00 0.00011 SPD_SR73 spd_1289 , spd_1288 2.39 4.19E10 SPD_SR74 b spd_1308 , spd_1307 1.94 7.70E06 SPD_SR77 asnS , rpsF 2.00 0.00019 SPD_SR80 b spd_1441 , spd_1442 6.45 1.74E24...”
• Redefining the Small Regulatory RNA Transcriptome in Streptococcus pneumoniae Serotype 2 Strain D39
  Sinha, Journal of bacteriology 2019
  • “...spd_1180, spd_1179 spd_1190, rplJ spd_1191, spd_1190 spd_1216, spd_1217 spd_1233, spd_1232 guaA, spd_1273 spd_1289, spd_1288 Spd_sr74b 1326066-1326252 ()...”
  • “...pheS (gene encoding phenylalanine-tRNA synthetase), and spd_1216 (gene encoding alanyl-tRNA synthetase), respectively, in D39. Interestingly, 35% of the...”
• Point mutations in functionally diverse genes are associated with increased natural DNA transformation in multidrug resistant Streptococcus pneumoniae
  Peillard-Fiorente, Nucleic acids research 2025
  • “...R9H T129M 59/3 (**/ns) 54/0 (**/ns) SPV_1002 PulA W191* E723D L714F 59/0 (**/ns) 59/0 (**/ns) SPV_1216 AlaS E154K A490T I241T S498P 69/6 (**/ns) 59/0 (**/ns) 70/10 (**/ns) SPV_1429 D73Y G88H 45/6 (*/**) SPV_1437 PlsC D242N R108C 43/5 (*/**) SPV_1487 NanR L245S I9V T205S I112V T214A I127V...”

T285_RS02260 alanine--tRNA ligase from Lactobacillus johnsonii N6.2
43% identity, 99% coverage

• Identification of Biomarkers for Systemic Distribution of Nanovesicles From Lactobacillus johnsonii N6.2
  Harrison, Frontiers in immunology 2021
  • “...Dipeptidase 33.34 12.02 4.08 4.32 0.020 T285_RS01720 2,3-bisphosphate-dependent phosphoglycerate mutase 28.50 6.44 1.70 1.19 0.008 T285_RS02260 AlaninetRNA ligase 25.33 11.08 3.37 2.26 0.035 T285_RS02345 Membrane protein/penicillin-binding protein 86.55 14.30 19.40 8.81 0.002 T285_RS02490 ArgininetRNA ligase 15.62 4.95 2.61 1.58 0.017 T285_RS03880 Enolase 3 355.64 40.61 45.98...”

SSA_0756 Alanyl-tRNA synthetase, putative from Streptococcus sanguinis SK36
44% identity, 99% coverage

• Analysis of essential gene dynamics under antibiotic stress in Streptococcus sanguinis
  El-Rami, Microbiology (Reading, England) 2018
  • “...clues about the biased transcriptomic up-regulation of genes encoding specific amino acid-tRNA synthetases: alanine-tRNA synthetase (SSA_0756), glycine-tRNA synthetase (SSA_1879), methionine-tRNA synthetase (SSA_1848), prolyl-tRNA synthetase (SSA_2069), isoleucyl-tRNA synthetase (SSA_0661), threonyl-tRNA synthetase (SSA_1571) and valine-tRNA synthetase (SSA_1819). Given the fact that alanine, glycine, methionine and valine have higher...”

Q9RS27 Alanine--tRNA ligase from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
DR2300 alanyl-tRNA synthetase from Deinococcus radiodurans R1
46% identity, 96% coverage

• Trans-editing of mischarged tRNAs
  Ahel, Proceedings of the National Academy of Sciences of the United States of America 2003
  • “...Mesorhizobium loti AlaX (NP102167), D. radiodurans AlaRS (Q9RS27), C. acetobutylicum AlaRS (Q97IG3), Giardia lamblia AlaRS (AAG23137), M. barkeri AlaRS...”
• Identification of new genes contributing to the extreme radioresistance of Deinococcus radiodurans using a Tn5-based transposon mutant library
  Dulermo, PloS one 2015
  • “...Ribonuclease P protein component (RnpA) DR2151 45.4 0.3 R R R Alanyl tRNA synthetase, AlaS DR2300 23.2 2.7 s s s heterogenote Metabolic pathways Energy production and conversion Rieske like Fe-S protein (COG0723) DR0342 51.2 4.6 s s R Cytochrome C-Type biogenesis protein CycJ ( u...”
  • “...disturbed in another class of IR sensitive mutants such as DR0315 , DR2151 , and DR2300 affected in translation activity. Given the -radiation-induced production of intracellular ROS, we assessed whether the observed radiosensitive phenotype was primarily due to ROS sensitivity or not, by testing 158 mutants...”

CTLon_0118 alanyl-tRNA synthetase from Chlamydia trachomatis L2b/UCH-1/proctitis
42% identity, 98% coverage

• Horizontal transfer of tetracycline resistance among Chlamydia spp. in vitro
  Suchland, Antimicrobial agents and chemotherapy 2009
  • “...10 neighboring C. suis genes (homologs of CTLon_0109 to CTLon_0118), flanked by the two rrn operons. The upstream (L2 parental) rrn operon was not involved in...”
  • “...the 16S rRNA gene sequence in the intergenic region between CTLon_0118 and the 16S rRNA. This is followed by two more transitions in the 16S rRNA gene, a single...”

SPy1389 putative alanyl-tRNA synthetase from Streptococcus pyogenes M1 GAS
43% identity, 100% coverage

• Genome-wide identification of genes required for fitness of group A Streptococcus in human blood
  Le, Infection and immunity 2013
  • “...Spy1240 Spy1257 Spy1269 Spy1304 Spy1306 Spy1337 Spy1351 Spy1364 Spy1389 Spy1391 Spy1423 Spy1426 b Le Breton et al. TABLE 2 (Continued) Signal ratio for blood...”
• Novel conserved group A streptococcal proteins identified by the antigenome technology as vaccine candidates for a non-M protein-based vaccine
  Fritzer, Infection and immunity 2010
  • “...Spy1228 Spy1245 Spy1315 Spy1357 Spy1361 Spy1371 Spy1375 Spy1389 Spy1390 Spy1422 Spy1436 Spy1494 Spy1523 Spy1536 Spy1564 Spy1604 Putative ABC transporter...”

CT749 Alanyl tRNA Synthetase from Chlamydia trachomatis D/UW-3/CX
O84754 Alanine--tRNA ligase from Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
42% identity, 98% coverage

• Genomic and phenotypic characterization of in vitro-generated Chlamydia trachomatis recombinants
  Jeffrey, BMC microbiology 2013
  • “...resulting in a progeny strain that contains only the C. suis homologs of CT740 through CT749. The results demonstrate that these C. suis sequences can complement any required function of the deleted C. trachomatis genes for growth in vitro. Figure 4 Schematic diagram of the CT740...”
  • “...are shown in black. The deletion of the C. trachomatis homologous region of CT740 to CT749 in the RC-J(s)/122 sequence is indicated by the delta symbol. Nucleotide sequence analysis of the recombinant genomes showed that some of these isolates lacked the chlamydial plasmid (Table 1 ,...”
• In vivo and in vitro studies of Chlamydia trachomatis TrpR:DNA interactions
  Carlson, Molecular microbiology 2006
  • “...operator sequence while the other was found in the CT749 (alaS) ORF. Neither of the other possible TrpR binding sites identified was found upstream of an ORF...”
• A dual-specificity aminoacyl-tRNA synthetase in the deep-rooted eukaryote Giardia lamblia
  Bunjun, Proceedings of the National Academy of Sciences of the United States of America 2000
  • “...elegans (gb AAB52339.1), Chlamydia trachomatis (sp O84754), Dictyostelium discoideum (gb AAF05592.1), Drosophila melanogaster (gb AAF05593.1), Escherichia coli...”

CAB842 alanine--tRNA ligase from Chlamydia abortus S26/3
CAB842 putative alanyl-tRNA synthetase from Chlamydophila abortus S26/3
42% identity, 98% coverage

• Genomic analysis of an attenuated Chlamydia abortus live vaccine strain reveals defects in central metabolism and surface proteins
  Burall, Infection and immunity 2009
  • “...CAB283 NA CAB308 CAB373 CAB394 CAB469 CAB622 CAB636 NA CAB648 CAB772 CAB842 CAB887 NAh NA NA NA CAB185/CAB186 NA NA NA NA NA CAB287/CAB288 NA NA NA NA NA NA...”

PGN_1381 alanyl-tRNA synthetase from Porphyromonas gingivalis ATCC 33277
43% identity, 99% coverage

• Porphyromonas gingivalis Tyrosine Kinase Is a Fitness Determinant in Polymicrobial Infections
  Perpich, Infection and immunity 2022 (secret)
• Pathway analysis for intracellular Porphyromonas gingivalis using a strain ATCC 33277 specific database
  Hendrickson, BMC microbiology 2009
  • “...PGN_0517 PGN_0281 PGN_0366 PGN_1157 PGN_0543 PGN_0570 PGN_0569 PGN_0981 PGN_0819 PGN_0962 PGN_1711 PGN_1883 PGN_0987 PGN_1218 PGN_1229 PGN_1381 PGN_1805 PGN_1969 PGN_2045 PGN_2060 Proteins are listed by ORF number in the same manner as in Table 3. Transcription machinery Most of the proteins responsible for transcription also showed increased...”

WP_006123197 alanine--tRNA ligase from Streptomyces filamentosus NRRL 15998
44% identity, 98% coverage

• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(WP_086344136); Tthe , Thermus thermophilus (WP_011228945); Mtub , Mycobacterium tuberculosis (WP_055366958); Sfil , Streptomyces filamentosus (WP_006123197); Mpne , Mycoplasma pneumoniae (WP_014574975); Hsap , Homo sapiens (NP_001596); Dmel , Drosophila melanogaster (NP_523511); Scer , Saccharomyces cerevisiae (EDV10897); Aful , Archaeoglobus fulgidus (WP_010879744); Phor , Pyrococcus horikoshii (WP_010884393);...”

PG1246 alanyl-tRNA synthetase from Porphyromonas gingivalis W83
42% identity, 99% coverage

• VimA-dependent modulation of acetyl coenzyme A levels and lipid A biosynthesis can alter virulence in Porphyromonas gingivalis
  Aruni, Infection and immunity 2012
  • “...SppA (PG0639) Conserved hypothetical protein, PG1347 Alanyl-tRNA synthetase, PG1246 Isoleucyl-tRNA synthetase, PG1596 2 21 20 19 18 17 16 15 14 13 11 12...”
  • “...conserved hypothetical protein (PG0410), and alanyl-tRNA synthetase (PG1246) showed this characteristic sorting motif (Table 3). These proteins were also found...”

WP_011228945 alanine--tRNA ligase from Thermus thermophilus
P74941 Alanine--tRNA ligase from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
YP_145097 alanyl-tRNA synthetase from Thermus thermophilus HB8
46% identity, 98% coverage

• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(WP_000354743); Aaeo , Aquifex aeolicus (WP_010880825); Bsub , Bacillus subtilis (WP_086344136); Tthe , Thermus thermophilus (WP_011228945); Mtub , Mycobacterium tuberculosis (WP_055366958); Sfil , Streptomyces filamentosus (WP_006123197); Mpne , Mycoplasma pneumoniae (WP_014574975); Hsap , Homo sapiens (NP_001596); Dmel , Drosophila melanogaster (NP_523511); Scer , Saccharomyces cerevisiae (EDV10897);...”
• The G3-U70-independent tRNA recognition by human mitochondrial alanyl-tRNA synthetase
  Zeng, Nucleic acids research 2019
  • “...AlaRS, S. cerevisiae cytoplasmic AlaRS (Uniprot No. P40825); Tt AlaRS, Thermus thermophilus AlaRS (Uniprot No. P74941) and Ph AlaRS, Pyrococcus horikoshii AlaRS (Uniprot No. O58035). ( B ) Location and orientation of Arg 631 (Arg 663 inhmtAlaRS)in the structure of the Af AlaRS/tRNA Ala complex (PDB...”
• A dual-specificity aminoacyl-tRNA synthetase in the deep-rooted eukaryote Giardia lamblia
  Bunjun, Proceedings of the National Academy of Sciences of the United States of America 2000
  • “...Thermotoga maritima (sp Q9 1B6), Thermus aquaticus (sp P74941), and Treponema pallidum (sp O83980). The following amino acid sequences for previously described...”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “..., Methanocaldococcus jannaschii (NP_247543); M. thermautotrophicus , Methanothermobacter thermautotrophicus (NP_276794); T. thermophilus , Thermus thermophilus (YP_145097); T. vaginalis , Trichomonas vaginalis (AAT95880.1). DISCUSSION As aaRSs are likely to be one of the most ancient families of proteins, they are often targets of choice for phylogenetic analyses....”

P61707 Alanine--tRNA ligase from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
46% identity, 98% coverage

• Stereospecificity control in aminoacyl-tRNA-synthetases: new evidence of d-amino acids activation and editing
  Rybak, Nucleic acids research 2019
  • “...ID: 3HTZ, 3WQZ) with a different degree of similarity (3258%) to the target protein (UniProt: P61707). Next, the two derived models were combined after a structural alignment and mutual replacements of the low-quality fragments (missed or disordered regions, generated due to the low-level similarity threshold). This...”

SYAP_ARATH / Q9FFC7 Alanine--tRNA ligase, chloroplastic/mitochondrial; Alanyl-tRNA synthetase; AlaRS; Protein EMBRYO DEFECTIVE 1030; Protein EMBRYO DEFECTIVE 263; Protein EMBRYO DEFECTIVE 86; EC 6.1.1.7 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT5G22800 EMB1030 (EMBRYO DEFECTIVE 1030); ATP binding / alanine-tRNA ligase/ ligase, forming aminoacyl-tRNA and related compounds / nucleic acid binding / nucleotide binding from Arabidopsis thaliana
42% identity, 88% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Monomer.
  disruption phenotype: Embryo defective. Developmental arrest of the embryo at early cotyledon stage.
• Plant-Specific Domains and Fragmented Sequences Imply Non-Canonical Functions in Plant Aminoacyl-tRNA Synthetases
  Saga, Genes 2020
  • “...Localization Prediction Primary Structure ArgRS At4g26300 cytosol, cp AlaRS At1g50200 cytosol, mt At1g66530 cytosol, mt At5g22800 mt, cp CysRS At5g38830 cytosol At1g49930 N truncated At3g56300 cytosol AsnRS At5g56680 cytosol At2g31170 mt, cp At4g17300 mt, cp GlnRS At1g25350 cytosol At1g70980 cytosol At5g19720 N truncated At3g07420 cytosol GluRS...”
• A Label-free Mass Spectrometry Method to Predict Endogenous Protein Complex Composition
  McBride, Molecular & cellular proteomics : MCP 2019
  • “...only in the aimp1 profile experiment: Glutamyl-tRNA synthetase (GluRS, AT5G26710). And Alanine tRNA synthetase (AlaRS, AT5G22800). D , The remaining tRNA synthetases that were detected in the aimp1l profiling experiment but did not have an altered elution profile in the mutant: Leucine tRNA synthetase (LeuRS, AT1G09620),...”
• Time-resolved interaction proteomics of the GIGANTEA protein under diurnal cycles in Arabidopsis
  Krahmer, FEBS letters 2019
  • “...FKF1 9 1.3E05 3.8E04 12 Y 15/0 AT5G54770 THI1 2 0.00051 0.0044 11 n n.d. AT5G22800 EMB86 3 6.33E05 0.0011 11 n n.d. AT1G74730 DUF1118 2 0.00031 0.0030 7.6 n n.d. AT3G11910 UBP13 7 2.76E04 0.0028 6.9 Y n.d. AT5G38660 APE1 3 5.27E04 0.0044 6.5 n...”
• Widespread dual targeting of proteins in land plants: when, where, how and why
  Carrie, Plant signaling & behavior 2013
  • “...thaliana Arabidopsis thaliana Arabidopsis thaliana At5g22800 Arabidopsis thaliana Arabidopsis thaliana At5g16715 At5g17660 Arabidopsis thaliana At5g15700...”
• Indispensable Roles of Plastids in Arabidopsis thaliana Embryogenesis
  Hsu, Current genomics 2010
  • “...# (PGME) S T At1g75350 NC ribosomal protein L31 family protein # (PGME) S P At5g22800 C2 aminoacyl-tRNA synthetase # (PGME) [ 56 ] [ 57 ] At1g23400 C2 chloroplast intron splicing factor (PGME) [ 78 ] [ 78 ] P At2g04030 + C heat shock...”
  • “...Ambiguous on the Arabidopsis whole Genome ATH1 GeneChip Not covered in the Chip At2g04842 At3g06430 At5g22800 At5g26742 A probe is available but shared with another gene At2g31530 At3g55610 a At4g23430 At5g10330 Two probes are available and results are not consistent At5g63420 Defined as distinct genes by...”
• Integrating the genetic and physical maps of Arabidopsis thaliana: identification of mapped alleles of cloned essential (EMB) genes
  Meinke, PloS one 2009
  • “...binding protein At5g19620 Cross EMB213 T-DNA 1 [5] OEP80 2 [31] Yes Chloroplast envelope protein At5g22800 Cross; PCR EMB86* EMB263 T-DNA 2 [4] , [5] , [9] , [19] , [20] EMB1030 2 [32] Yes Alanyl tRNA synthetase At5g27740 Cross; PCR EMB161* EMB251* T-DNA 2 [5]...”
  • “...because two different TAIL products were confirmed from chromosome 5. One identified the EMB1030 locus (At5g22800) responsible for the mutant phenotype; the other revealed a linked locus (At5g20935) at the expected distance inferred from genetic analysis [19] . We demonstrated through reverse genetics that knockouts of...”
• Comparative mapping of Brassica juncea and Arabidopsis thaliana using Intron Polymorphism (IP) markers: homoeologous relationships, diversification and evolution of the A, B and C Brassica genomes
  Panjabi, BMC genomics 2008
  • “...3 O At4g00030 At4g04955 2.5 3 1 P At4g12070 At4g08690 1.6 2 1 Q At5g28897 At5g22800 3.3 3 2 R At5g22030 At5g01240 7.1 3 3 S At5g41900 At5g32621 4.4 1 0 T At4g12750 At4g16143 1.6 4 1 U At4g16250 At4g38770 8.9 3 3 V At5g48520 At5g42970...”
• Dual targeting is the rule for organellar aminoacyl-tRNA synthetases in Arabidopsis thaliana
  Duchêne, Proceedings of the National Academy of Sciences of the United States of America 2005
  • “...Thr Val Trp Tyr AGI no. At1g50200 At5g22800 At5g38830 At3g56300 At2g31170 At4g33760 At4g31180 At4g26870 At5g26710 At5g64050 At4g39280 At1g72550 At3g58140...”
  • “...At5g52520 At3g02660 At1g11870 At4g33760 At1g50200 At5g22800 At3g58140 At4g04350 At4g26300 At5g26830 At2g04842 At1g14610 At5g16715 At2g25840 At1g29880 At3g48110...”

IVR12_01878 alanine--tRNA ligase from Limosilactobacillus reuteri
42% identity, 99% coverage

• Recombinant Limosilactobacillus (Lactobacillus) delivering nanobodies against Clostridium perfringens NetB and alpha toxin confers potential protection from necrotic enteritis
  Gangaiah, MicrobiologyOpen 2022
  • “...protein S8 IVR12_00764 15 79 DNAdirected RNA polymerase subunit beta' LREU3632_00816 82 77 AlaninetRNA ligase IVR12_01878 99 77 30S ribosomal protein S9 IVR12_00745 14 74 50S ribosomal protein L11 IVR12_01623 15 72 30S ribosomal protein S19 IVR12_00774 10 71 50S ribosomal protein L5 IVR12_00766 20 70...”
  • “...247 30S ribosomal protein S8 IVR12_00764 15 246 1,3propanediol dehydrogenase IVR12_01279 42 244 AlaninetRNA ligase IVR12_01878 99 242 30S ribosomal protein S13 IVR12_00754 14 241 50S ribosomal protein L14 IVR12_00768 13 240 50S ribosomal protein L15 IVR12_00759 15 237 Putative ATPdependent Clp protease ATPbinding subunit IVR12_01298...”

WP_000354743 alanine--tRNA ligase from Helicobacter pylori SouthAfrica7
43% identity, 99% coverage

• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(WP_034012995); Nmen , Neisseria meningitidis (WP_010980961); Rpal , Rhodopseudomonas palustris (WP_044410751); Hpyl , Helicobacter pylori (WP_000354743); Aaeo , Aquifex aeolicus (WP_010880825); Bsub , Bacillus subtilis (WP_086344136); Tthe , Thermus thermophilus (WP_011228945); Mtub , Mycobacterium tuberculosis (WP_055366958); Sfil , Streptomyces filamentosus (WP_006123197); Mpne , Mycoplasma pneumoniae (WP_014574975);...”

LBA0417 ala-tRNA synthetase from Lactobacillus acidophilus NCFM
42% identity, 98% coverage

• Investigating the Effect of Growth Phase on the Surface-Layer Associated Proteome of Lactobacillus acidophilus Using Quantitative Proteomics
  Klotz, Frontiers in microbiology 2017
  • “...PhoUPhosphate-specific transport system accessory protein 2.29 9.21E-05 Cytoplasm LBA0831 BipAGTP-binding protein-BipA-EF-TU family 2.3 5.14E-06 Other LBA0417 AlaSAlaninetRNA ligase 2.32 7.95E-06 Cytoplasm LBA1162 AsparaginetRNA ligase 2.33 2.76E-06 Cytoplasm * LBA0285 RpoCDNA-directed RNA polymerase subunit beta' 2.48 2.76E-06 Other LBA0657 Putative tRNA (cytidine(34)-2-O)-methyltransferase 2.48 2.53E-06 Cytoplasm * LBA0284...”

LIC10763 alanyl-tRNA synthetase from Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
P61703 Alanine--tRNA ligase from Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
40% identity, 88% coverage

• Pathogenic Leptospira interrogans exoproteins are primarily involved in heterotrophic processes
  Eshghi, Infection and immunity 2015
  • “...LIC13393 LIC10913 LIC11698 LIC12422 LIC10852 LIC10763 LIC10750 LIC13328 LIC10065 Fumarate hydratase (aspartate ammonia-lyase) Sulfate adenylyltransferase...”
• Inferring pathogen-host interactions between Leptospira interrogans and Homo sapiens using network theory
  Kumar, Scientific reports 2019
  • “...UppP (P62465), and three outer membrane proteins viz . XseA (Q72RZ7), Pgi (Q72MT7) and AlaS (P61703) were present in only pathogenic but absent in both intermediate and saprophytic. Moreover, out of 4 periplasmic proteins, only Flab (Q72R59) and GlyA (Q72PY2) were present in all pathogenic, intermediate...”

A2RME6 Alanine--tRNA ligase from Lactococcus lactis subsp. cremoris (strain MG1363)
42% identity, 99% coverage

• Investigating Lactococcus lactis MG1363 Response to Phage p2 Infection at the Proteome Level
  Lemay, Molecular & cellular proteomics : MCP 2019
  • “...protein L29 (rpmC, A2RNP7), the alanine-tRNA ligase (alaS, A2RME6), the elongation factor Tu (tuf, A2RMT1), and the thioredoxin H-type (trxH, A2RIB5). We also...”

jhp1162 ALANYL-TRNA SYNTHETASE from Helicobacter pylori J99
42% identity, 99% coverage

• Expression of the BabA adhesin during experimental infection with Helicobacter pylori
  Styer, Infection and immunity 2010
  • “...JHP0833 JHP0833 JHP0833 JHP0833 JHP0833 JHP0835 JHP0835 NAd JHP1162 JHP1164 JHP1165 JHP1164 NA NA NA NA babA babA babA babA babA babA Intergenic Intergenic...”

WP_075269877 alanine--tRNA ligase from Weissella jogaejeotgali
42% identity, 99% coverage

• Phylogenomic and comparative genomic analyses of Leuconostocaceae species: identification of molecular signatures specific for the genera Leuconostoc, Fructobacillus and Oenococcus and proposal for a novel genus Periweissella gen. nov
  Bello, International journal of systematic and evolutionary microbiology 2022
  • “...main clade APC family permease WP_070229375 1 aa Del 579609 Fig. S38 Alanine tRNA ligase* WP_075269877 1 aa Del 368401 Fig. S39 Cytochrome d ubiquinol oxidase subunit II WP_070230395 1 aa Ins 165205 Fig. S40 Response regulator transcription factor WP_070230808 1 aa Ins 178211 Fig. S41...”

DIP1350 alanyl-tRNA synthetase from Corynebacterium diphtheriae NCTC 13129
41% identity, 97% coverage

• Corynebacterium diphtheriae Proteome Adaptation to Cell Culture Medium and Serum
  Möller, Proteomes 2021
  • “...five. This cluster includes 15 proteins (DIP1636, DIP1902, DIP1987, DIP1322, DIP1786, DIP0938, DIP2115, DIP2294, DIP2331, DIP1350, DIP0740, DIP2189, DIP1888, DIP2190, and DIP0446), three proteins (DIP0740, DIP2189, and DIP2190) are thought to be involved in mycolic acid synthesis [ 43 ] and a homologue of DIP1350 is...”

A8YTJ0 Alanine--tRNA ligase from Lactobacillus helveticus (strain DPC 4571)
42% identity, 98% coverage

• Microbial diversity and metaproteomic analysis of activated sludge responses to naphthalene and anthracene exposure.
  Li, RSC advances 2019
  • “...1.59 1.81 ATP-dependent zinc metalloprotease (FtsH) C5CES8 Asterales 1.06 1.53 1.34 1.34 Alanyl-tRNA synthetase (AlaRS) A8YTJ0 Actinomycetales 1.24 50S ribosomal protein P0A5W1 Actinomycetales 1.56 1.68 1.20 1.70 3.29 1.43 DNA replication Chromosomal replication initiator protein (DnaA) A6W3V4 Actinomycetales 1.84 2.03 Energy metabolism ATP synthase subunit beta...”

B8B4H5 Alanine--tRNA ligase, chloroplastic/mitochondrial from Oryza sativa subsp. indica
42% identity, 87% coverage

• Microbe-Responsive Proteomes During Plant-Microbe Interactions Between Rice Genotypes and the Multifunctional Methylobacterium oryzae CBMB20
  Walitang, Rice (New York, N.Y.) 2023
  • “...Specific proteins such as peptidyl-prolyl cistrans isomerase (A2WJU9), thiamine thiazole synthase (A2YM28), and alaninetRNA ligase (B8B4H5) upregulated in IR29 and FL478 indicate key mechanisms of M. oryzae CBMB20 mediated plant growth promotion in rice. Conclusions Interaction of Methylobacterium oryzae CBMB20 to rice results in a dynamic,...”
  • “...upon CBMB20 inoculation. Enzymes peptidyl-prolyl cistrans isomerase (A2WJU9), thiamine thiazole synthase (A2YM28), and alaninetRNA ligase (B8B4H5) were all upregulated in CBMB20-inoculated IR29 and FL478 (Table 1 ; Additional file 1 : Fig. S1). There are also proteins and enzymes with similar functional categories downregulated due to...”

G2EA49 alanine-tRNA ligase (EC 6.1.1.7) from Bizionia argentinensis (see paper)
43% identity, 99% coverage

HP1241 alanyl-tRNA synthetase (alaS) from Helicobacter pylori 26695
P56452 Alanine--tRNA ligase from Helicobacter pylori (strain ATCC 700392 / 26695)
43% identity, 99% coverage

• Methylation Motifs in Promoter Sequences May Contribute to the Maintenance of a Conserved ^m5C Methyltransferase in Helicobacter pylori
  Meng, Microorganisms 2021
  • “...encodes lipid A acyl transferase; [ 47 ]), valS (HP1153, encodes valyl-tRNA synthetase), and alaS (HP1241, encodes alanyl-tRNA synthetase). The TSS data for H. pylori 26695 [ 31 ] confirmed the sequences in lpxL , valS, and alaS as functional antisense promoters, although the promoter in...”
• Outer Membrane Vesicles Secreted by Helicobacter pylori Transmitting Gastric Pathogenic Virulence Factors
  Wei, ACS omega 2022
  • “...O25293 ychF 372 O25595 alr 373 P56737 trpD 374 O26103 pdxA 375 P56137 purA 376 P56452 alaS 377 P94842 ybgC 378 O24885 gmd 379 O24864 CheV 380 P56184 prs 381 O25475 secA 382 O25477 HP_0788 383 O24973 OmpR 384 O26096 metN 385 P56157 dnaE 386 O24890...”

lp_2277 alanine--tRNA ligase from Lactobacillus plantarum WCFS1
41% identity, 99% coverage

• Transcriptomic Evidence of Molecular Mechanisms Underlying the Response of Lactobacillus Plantarum WCFS1 to Hydroxytyrosol
  Reverón, Antioxidants (Basel, Switzerland) 2020
  • “...factor), lp_0963 or rluE (ribosomal large subunit pseudouridine syntethase), lp_2039 or rbfA (ribosome binding factor), lp_2277 or alaRS (alanyl-tRNA syntethase and lp_1027 or fusA2 (elongation factor), were downregulated ( Supplementary Table S2 ). Also, other genes related to cell proliferation that code for factors playing roles...”

LGG_00767 alanine--tRNA ligase from Lacticaseibacillus rhamnosus GG
LGG_00767 alanyl-tRNA synthetase (Alanine-tRNA ligase) (AlaRS) from Lactobacillus rhamnosus GG
41% identity, 99% coverage

• Growth phase-associated changes in the proteome and transcriptome of Lactobacillus rhamnosus GG in industrial-type whey medium
  Laakso, Microbial biotechnology 2011
  • “...family 168 2.3 2.413 LGG_02499 clpC ATPdependent Clp protease ATPbinding subunit 169 1.9 0.399 Translation LGG_00767 alaS AlanyltRNA synthetase 170 1.5 0.758 LGG_01019 gatA Aspartyl/glutamyltRNA(Asn/Gln) amidotransferase subunit A 171 1.7 0.603 Miscellaneous LGG_00226 Pyridoxine 5phosphate oxidase Vrelated favinnucleotidebinding protein 172 2.1 1.605 LGG_00491 NADH peroxidase 173...”

XP_001731546 uncharacterized protein from Malassezia globosa CBS 7966
40% identity, 91% coverage

• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...Cn, Cryptococcus neoformans (XP_774788); Dh, Debaryomyces hansenii (XP_456501); Kl, Kluyveromyces lactis (XP_455190); Mg, Malassezia globosa (XP_001731546); Pg, Pichia guilliermondii (XP_001486846); Ps, Pichia stipitis (XP_001383420); and Vp, Vanderwaltozyma polyspora (VpAlaRS1, XP_001643652; VpAlaRS2, XP_001642960). ( B ) 5-End sequences of VpALA1 and VpALA2 . The sequence extends from...”

M901_2280 alanine--tRNA ligase from Bacteriovorax sp. DB6_IX
39% identity, 100% coverage

• Characterization of biosynthetic genes of ascamycin/dealanylascamycin featuring a 5'-O-sulfonamide moiety in Streptomyces sp. JCM9888
  Zhao, PloS one 2014
  • “...acmC 414 major facilitator superfamily protein Micromonospora sp. CNB394, WP_018786560 29 acmD 871 alanyl-tRNA synthetase M901_2280, Bacteriovorax sp. DB6_IX, EQC50866 44 acmE 455 esterase Xanthomonas campestris , BAA11623 20 acmF 370 alanyl-tRNA synthetase CGL2_10933004, Leptospirillum sp. Group II '5-way CG', EDZ38785 27 acmG 480 Sulfatase Francci3_1756,...”

XP_003571715 alanine--tRNA ligase from Brachypodium distachyon
40% identity, 88% coverage

• PK-profiling method for identifying the expression of resistance-associated genes in partially resistant oats to crown rust
  Loarce, BMC plant biology 2018
  • “...protein Xa21 (XP_010236334) PK4R1b22 (JZ978725) 400 LRR Mixed kinase SERK (XP_003577373) PK4R1b32 (JZ978726) 196 Alanyl-tRNA-synthetase (XP_003571715) No redundant clones obtained with each PK primer, GenBank accession numbers, sizes of the cloned fragments and expected functions for the most similar protein sequences of Brachypodium distachyon accessions searched...”

C3B54_111113 alanine--tRNA ligase from Pontimonas salivibrio
41% identity, 97% coverage

• Complete genome of streamlined marine actinobacterium Pontimonas salivibrio strain CL-TW6^T adapted to coastal planktonic lifestyle
  Cho, BMC genomics 2018
  • “...closer common ancestor with Yonghaparkia . Genes used were C3B54_11793, C3B54_11942, C3B54_11990, C3B54_111069, C3B54_111092, C3B54_111098, C3B54_111113, C3B54_111132, C3B54_111675. Time scale was determined as described in Fig. 2 . (DOC 78 kb) Additional file 8: Table S5. Raw vertical index numbers for all P. salivibrio genes. (XLS...”

P36428 Alanine--tRNA ligase from Arabidopsis thaliana
AT1G50200 ALATS (ALANYL-TRNA SYNTHETASE); ATP binding / alanine-tRNA ligase/ ligase, forming aminoacyl-tRNA and related compounds / nucleic acid binding / nucleotide binding from Arabidopsis thaliana
39% identity, 87% coverage

• A dual-specificity aminoacyl-tRNA synthetase in the deep-rooted eukaryote Giardia lamblia
  Bunjun, Proceedings of the National Academy of Sciences of the United States of America 2000
  • “...Aquifex aeolicus (sp O67323), Arabidopsis thaliana (sp P36428), Archaeoglobus fulgidus (sp O28029), Bacillus subtilis (sp O34526), Borrelia burgdorferi (sp...”
• Endoplasmic reticulum membrane receptors of the GET pathway are conserved throughout eukaryotes
  Asseck, Proceedings of the National Academy of Sciences of the United States of America 2021
  • “...3 5 or 4 Yes AT5G13430 Ubiquinol-cytochrome C reductase FeS subunit Mito 0 2 Yes AT1G50200 ALATS Alanyl-tRNA synthetase Mito 0 1 Yes AT4G01100 ADNT1 Adenine nucleotide transporter 1 Mito 0 4 Yes AT5G41670 6-phosphogluconate dehydrogenase family protein Mito/Chp 0 2 Yes AT2G38040 CAC3 Carboxyltransferase alpha...”
• Plant-Specific Domains and Fragmented Sequences Imply Non-Canonical Functions in Plant Aminoacyl-tRNA Synthetases
  Saga, Genes 2020
  • “...Primary Structure Class II AGI No. Localization Prediction Primary Structure ArgRS At4g26300 cytosol, cp AlaRS At1g50200 cytosol, mt At1g66530 cytosol, mt At5g22800 mt, cp CysRS At5g38830 cytosol At1g49930 N truncated At3g56300 cytosol AsnRS At5g56680 cytosol At2g31170 mt, cp At4g17300 mt, cp GlnRS At1g25350 cytosol At1g70980 cytosol...”
• A Genetic Screen for Mutations Affecting Cell Division in the Arabidopsis thaliana Embryo Identifies Seven Loci Required for Cytokinesis
  Gillmor, PloS one 2016
  • “...Ler: ~290+220+30bp H013 At1g50150 ccctttcctatggacaatgtg Length polymorphism (AT-repeat) aaatggcatgcattgtgaatcc Col: ~160bp; L er <Col H375 At1g50200 tagatgcagcaattatccccgc Length polymorphism (S375) gttccgctattttcttctgagc Col: ~210bp, L er : ~190bp H567 At1g50230 catctgaggcaatgtgattgg Polymorphic EcoRI site (C425567) ggttgtctctggattcacagc Col: ~330+120bp; L er : ~450bp H560 At1g50300 agatggtgactggatgtgcc Polymorphic Bsh1236I...”
• Proteomic analysis of endoplasmic reticulum stress responses in rice seeds
  Qian, Scientific reports 2015
  • “...LOC_Os06g43760 gi|222630224 3.842 AT3G02760 tRNA synthetase class II core domain containing protein LOC_Os05g05840 gi|218184221 2.516 AT1G50200 alanyl-tRNA synthetase LOC_Os10g10244 gi|109940177 2.058 AT4G13780 methionyl-tRNA synthetase LOC_Os06g31210 gi|115462445 2.088 AT1G25350 glutaminyl-tRNA synthetase LOC_Os05g08990 gi|218197256 2.454 AT1G72550 phenylalanyl-tRNA synthetase beta chain LOC_Os05g48510 gi|222637260 2.004 AT3G60240 eukaryotic translation initiation factor...”
• The Proteomic Response of Arabidopsis thaliana to Cadmium Sulfide Quantum Dots, and Its Correlation with the Transcriptomic Response
  Marmiroli, Frontiers in plant science 2015
  • “...ACT2 At3g18780 257749_AT 42,078 5.37 62 0.008 11 37 29 34.09 AlaninetRNA ligase SYA_ARATH ALATS At1g50200 262468_AT 111,275 6.05 45 0.38 13 21 13 20.43 Arogenate dehydratase/prephenate dehydratase 6 AROD6_ARATH ADT6 At1g08250 261758_AT 45,059 6.11 41 0.96 5 28 8 24.56 ATP synthase subunit beta, chloroplastic...”
• Fluorescent protein tagging as a tool to define the subcellular distribution of proteins in plants
  Tanz, Frontiers in plant science 2013
  • “...appear to disagree but when in fact they actually complement each other is alanyl-tRNA synthetase (At1g50200). FP tagging studies found this protein to be targeted to plastids and mitochondria, whereas proteomics studies found it in the cytosol (Supplementary Table 1). Analysis of the transcription of the...”
  • “...study (Ito et al., 2011 ) showed that all the cytosolic peptides significantly matching to At1g50200 (see Ito et al., 2011 ; Supplementary Table 1, protein hit number 68) are downstream of the second start methionine. Thus, alanyl-tRNA synthetase is only expressed at low levels in...”
• Widespread dual targeting of proteins in land plants: when, where, how and why
  Carrie, Plant signaling & behavior 2013
  • “...Arabidopsis thaliana Arabidopsis thaliana At1g65630 At1g50200 Arabidopsis thaliana At1g49630 Arabidopsis thaliana Arabidopsis thaliana Arabidopsis thaliana...”
• Proteomic divergence in Arabidopsis autopolyploids and allopolyploids and their progenitors
  Ng, Heredity 2012
  • “...1 (At1g52410), mitochondrial alanyl-tRNA synthetase (At1g50200) and ribosomerecycling factor (At3g63190). The transcriptomic and proteomic comparison between...”
• More

Sb08g008230 No description from Sorghum bicolor
39% identity, 86% coverage

• Identification of novel drought-responsive microRNAs and trans-acting siRNAs from Sorghum bicolor (L.) Moench by high-throughput sequencing analysis
  Katiyar, Frontiers in plant science 2015
  • “...protein kinase family protein (Sb04g008470); Tetratricopeptide repeat (TPR)-like superfamily protein (Sb01g037150) 5 novel-sbi-miR-64 Alanyl-tRNA synthetase (Sb08g008230); basic leucine-zipper 44 (Sb02g020760); Protein kinase family protein (Sb09g006270) 6 novel-sbi-miR-120a-b Enolase 1(Sb02g023480); S15/NS1, RNA-binding protein(Sb04g036260); ubiquitin-specific protease 12 (Sb05g022390); uridine-ribohydrolase 2 (Sb03g009290); Walls Are Thin 1 (Sb10g002840) 7 novel-sbi-miR-200...”

WP_055366958 alanine--tRNA ligase from Mycobacterium tuberculosis
40% identity, 95% coverage

• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(WP_010880825); Bsub , Bacillus subtilis (WP_086344136); Tthe , Thermus thermophilus (WP_011228945); Mtub , Mycobacterium tuberculosis (WP_055366958); Sfil , Streptomyces filamentosus (WP_006123197); Mpne , Mycoplasma pneumoniae (WP_014574975); Hsap , Homo sapiens (NP_001596); Dmel , Drosophila melanogaster (NP_523511); Scer , Saccharomyces cerevisiae (EDV10897); Aful , Archaeoglobus fulgidus (WP_010879744);...”

P9WFW7 Alanine--tRNA ligase from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Rv2555c alanyl-tRNA synthetase from Mycobacterium tuberculosis H37Rv
40% identity, 95% coverage

• The unfoldase ClpC1 of Mycobacterium tuberculosis regulates the expression of a distinct subset of proteins having intrinsically disordered termini
  Lunge, The Journal of biological chemistry 2020 (secret)
• Large-scale Pan Genomic Analysis of <i>Mycobacterium tuberculosis</i> Reveals Key Insights Into Molecular Evolutionary Rate of Specific Processes and Functions
  Bundhoo, Evolutionary bioinformatics online 2024
  • “...protein S4 Rv3458c 50S ribosomal protein L22 Rv0706 50S ribosomal protein L23 Rv0703 AlaninetRNA ligase Rv2555c GlycinetRNA ligase Rv2357c Metabolism and respiration Cytochrome c oxidase subunit 3 Rv2193 Comas et al 29 Electron transfer flavoprotein subunit beta Rv3029c Prokaryotic ubiquitin-like protein Pup Rv2111c Dihydroorotase Rv1381 Cell...”
• Implementation of homology based and non-homology based computational methods for the identification and annotation of orphan enzymes: using Mycobacterium tuberculosis H37Rv as a case study
  Sinha, BMC bioinformatics 2020
  • “...C (11)-methyltransferase) Rv2071c 2.3.2.10 (UDP-N-acetylmuramoylpentapeptide-lysine N(6)-alanyltransferase/ Peptidoglycan biosynthesis) 6.1.1.14 (GlycinetRNA ligase) Rv0041 6.1.1.7 AlaninetRNA ligase Rv2555c 6.3.2.10 (MurF synthetase) Rv2157c 6.3.1.2 (Glutamine synthetase) Rv2222c 1.14.13.83 (Precorrin-3B synthase/porphyrin and chlorophyll metabolism) 2.1.1.131 (Precorrin-3B C(17)-methyltransferase) Rv2066 2.1.1.130 (Precorrin-2C (20)-methyltransferase) Rv2066 1.3.3.3 (Coprogen oxidase/porphyrin and chlorophyll metabolism) 1.3.3.4 (Protoporphyrinogen...”
• Hypoxia Is Not a Main Stress When Mycobacterium tuberculosis Is in a Dormancy-Like Long-Chain Fatty Acid Environment
  Del, Frontiers in cellular and infection microbiology 2018
  • “...1.43E-03 Transmembrane protein Rv2516c 4.00E-20 1.90E-02 Hypothetical protein Rv2554c 2.14E-78 1.58E-09 Holliday junction resolvase-like protein Rv2555c alaS 7.94E-04 2.53E-253 Alanyl-tRNA synthetase Rv2623 Tb31.7 7.38E-158 6.77E-67 Hypothetical protein Rv2694c 7.50E-88 9.61E-06 Hypothetical protein Rv2699c 1.20E-146 2.58E-05 Hypothetical protein Rv2710 sigB 1.67E-69 1.47E-03 RNA polymerase sigma factor SigB...”
• Essentiality Assessment of Cysteinyl and Lysyl-tRNA Synthetases of Mycobacterium smegmatis
  Ravishankar, PloS one 2016
  • “...leprae E . coli H . influenzae S . aureus S . pneumoniae AlaRS MSMEG_3025 Rv2555c ML0512 b2697 HI0814 SA1446 SP1383 GlyRS MSMEG_4485 Rv2357c ML0826 b3559,b3560 HI0924,HI0927 SA1394 SP1474,SP1475 ValRS MSMEG_4630 Rv2448c ML1472 b4258 HI1391 SA1488 SP0568 LeuRS MSMEG_6917 Rv0041 ML0032 b0642 HI0921 SA1579 SP0254 IleRS...”
• Adenylating enzymes in Mycobacterium tuberculosis as drug targets
  Duckworth, Current topics in medicinal chemistry 2012
  • “...glyS, hisS, ileS, leuS, lysS, lysX, metS, pheS, pheT, proS, serS, thrS, trpS, tyrS, valS Rv2555c, Rv1658, Rv1292, Rv2572c, Rv3580c, Rv2992, Rv2357c, Rv2580c, Rv1536, Rv0041, Rv3598c, Rv1640c, Rv1007c, Rv1649, Rv1650, Rv2845c, Rv3834c, Rv2614c, Rv3336c, Rv1689, Rv2448c Aminoacyl tRNA synthetase (Protein biosynthesis) yes (E) 2 acs Rv3667...”
• Phylogenetic detection of horizontal gene transfer during the step-wise genesis of Mycobacterium tuberculosis
  Veyrier, BMC evolutionary biology 2009
  • “...Rv1310- atpD , Rv1437- pgk , Rv1650- pheT , Rv1832- gcvB , Rv2220- glnA1 , Rv2555c- alaS , Rv-2748c- ftsK , Rv2839c- infB , Rv2916c- ffh , Rv3240- secA1 , Rv3459c- rpsK , and Rv3646- topA . For an out-group, we used orthologues of these genes...”

NP_523511 Alanyl-tRNA synthetase, isoform A from Drosophila melanogaster
38% identity, 90% coverage

• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(WP_006123197); Mpne , Mycoplasma pneumoniae (WP_014574975); Hsap , Homo sapiens (NP_001596); Dmel , Drosophila melanogaster (NP_523511); Scer , Saccharomyces cerevisiae (EDV10897); Aful , Archaeoglobus fulgidus (WP_010879744); Phor , Pyrococcus horikoshii (WP_010884393); whole sequences were aligned by ClustalW [ 32 ] and ESPript 3 [ 33 ]....”
• Positional recognition of a tRNA determinant dependent on a peptide insertion.
  Lovato, Molecular cell 2004 (PubMed)
  • GeneRIF: Drosophila melanogaster mitochondrial tRNA (Ala) contains a G:U base pair that has been translocated to the adjacent 2:71 position.This G2:U71 is the major determinant for identity of Dm mt tRNA(Ala).

SYA_CANAL / Q5A8K2 Alanine--tRNA ligase; Alanyl-tRNA synthetase; AlaRS; EC 6.1.1.7 from Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) (see paper)
ALA1 alanyl-tRNA synthetase from Candida albicans (see paper)
38% identity, 90% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Monomer.
• CharProtDB CGD description: Alanyl-tRNA synthetase; translational regulation generates cytoplasmic and mitochondrial forms; regulated by Gcn4p; repressed upon amino acid starvation (3-AT); translation-related genes downregulated upon phagocytosis by murine macrophage

MSMEG_3025 alanyl-tRNA synthetase from Mycobacterium smegmatis str. MC2 155
41% identity, 95% coverage

• Essentiality Assessment of Cysteinyl and Lysyl-tRNA Synthetases of Mycobacterium smegmatis
  Ravishankar, PloS one 2016
  • “.... leprae E . coli H . influenzae S . aureus S . pneumoniae AlaRS MSMEG_3025 Rv2555c ML0512 b2697 HI0814 SA1446 SP1383 GlyRS MSMEG_4485 Rv2357c ML0826 b3559,b3560 HI0924,HI0927 SA1394 SP1474,SP1475 ValRS MSMEG_4630 Rv2448c ML1472 b4258 HI1391 SA1488 SP0568 LeuRS MSMEG_6917 Rv0041 ML0032 b0642 HI0921 SA1579 SP0254...”

NP_984459 ADR363Cp from Ashbya gossypii ATCC 10895
40% identity, 90% coverage

• Divergent Alanyl-tRNA Synthetase Genes of Vanderwaltozyma polyspora Descended from a Common Ancestor through Whole-Genome Duplication Followed by Asymmetric Evolution
  Chang, Molecular and cellular biology 2015
  • “...XP_003688259); Lachancea thermotolerans, XP_002552804; Ashbya gossypii, NP_984459; and Kluyveromyces lactis, XP_455190. (B) Synteny of yeast AlaRS genes. X...”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...Ca, Candida albicans (XP_718016); Yl, Yarrowia lipolytica (XP_500483); Sp, S. pombe (NP_593640); Ag, Ashbya gossypii (NP_984459); Cg, Candida glabrata (XP_445923); Cn, Cryptococcus neoformans (XP_774788); Dh, Debaryomyces hansenii (XP_456501); Kl, Kluyveromyces lactis (XP_455190); Mg, Malassezia globosa (XP_001731546); Pg, Pichia guilliermondii (XP_001486846); Ps, Pichia stipitis (XP_001383420); and Vp,...”

ML0512 alanyl-tRNA synthetase from Mycobacterium leprae TN
40% identity, 95% coverage

• Essentiality Assessment of Cysteinyl and Lysyl-tRNA Synthetases of Mycobacterium smegmatis
  Ravishankar, PloS one 2016
  • “...E . coli H . influenzae S . aureus S . pneumoniae AlaRS MSMEG_3025 Rv2555c ML0512 b2697 HI0814 SA1446 SP1383 GlyRS MSMEG_4485 Rv2357c ML0826 b3559,b3560 HI0924,HI0927 SA1394 SP1474,SP1475 ValRS MSMEG_4630 Rv2448c ML1472 b4258 HI1391 SA1488 SP0568 LeuRS MSMEG_6917 Rv0041 ML0032 b0642 HI0921 SA1579 SP0254 IleRS MSMEG_3169...”

A7TPK2 alanine-tRNA ligase (EC 6.1.1.7) from Vanderwaltozyma polyspora (see paper)
XP_001643652 alanine--tRNA ligase from Vanderwaltozyma polyspora DSM 70294
38% identity, 89% coverage

• Divergent Alanyl-tRNA Synthetase Genes of Vanderwaltozyma polyspora Descended from a Common Ancestor through Whole-Genome Duplication Followed by Asymmetric Evolution
  Chang, Molecular and cellular biology 2015
  • “...XP_004177771; Vanderwaltozyma polyspora (VpAlaRS1, XP_001643652; VpAlaRS2, XP_001642960); Tetrapisispora phaffii (TpAlaRS1, XP_003686912; TpAlaRS2,...”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...globosa (XP_001731546); Pg, Pichia guilliermondii (XP_001486846); Ps, Pichia stipitis (XP_001383420); and Vp, Vanderwaltozyma polyspora (VpAlaRS1, XP_001643652; VpAlaRS2, XP_001642960). ( B ) 5-End sequences of VpALA1 and VpALA2 . The sequence extends from the nearest upstream stop codon to +60 nucleotide relative to ATG1. ATG and potential...”

XP_455190 hypothetical protein from Kluyveromyces lactis NRRL Y-1140
38% identity, 91% coverage

• Divergent Alanyl-tRNA Synthetase Genes of Vanderwaltozyma polyspora Descended from a Common Ancestor through Whole-Genome Duplication Followed by Asymmetric Evolution
  Chang, Molecular and cellular biology 2015
  • “...XP_002552804; Ashbya gossypii, NP_984459; and Kluyveromyces lactis, XP_455190. (B) Synteny of yeast AlaRS genes. X denotes loss of the homologue in...”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...Cg, Candida glabrata (XP_445923); Cn, Cryptococcus neoformans (XP_774788); Dh, Debaryomyces hansenii (XP_456501); Kl, Kluyveromyces lactis (XP_455190); Mg, Malassezia globosa (XP_001731546); Pg, Pichia guilliermondii (XP_001486846); Ps, Pichia stipitis (XP_001383420); and Vp, Vanderwaltozyma polyspora (VpAlaRS1, XP_001643652; VpAlaRS2, XP_001642960). ( B ) 5-End sequences of VpALA1 and VpALA2 ....”

PFREUD_11560 alanine--tRNA ligase from Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
40% identity, 96% coverage

• A temporal-omic study of Propionibacterium freudenreichii CIRM-BIA1 adaptation strategies in conditions mimicking cheese ripening in the cold
  Dalmasso, PloS one 2012
  • “...PFREUD_06960 Methionyl-tRNA synthetase P 0.1 1.4 1.2 1.2 0.011 0.9 0.3 0.9 0.034 20 alaS PFREUD_11560 Alanyl-tRNA synthetase P 0.6 1.3 1 1.1 0.013 0.4 0.4 0.9 0.035 10 a Spot number (see Table S4 and Fig. 2 ). Bold characters indicate genes that are differentially...”

W5P5H4 Alanine--tRNA ligase from Ovis aries
38% identity, 90% coverage

• Poor maternal diet during gestation alters offspring muscle proteome in sheep
  Reed, Journal of animal science 2022
  • “...W5PVX8 PPP3CA W5PFC9 LOC101117129 W5QIM2 COPS2 W5PF97 RPL5 W5P5H4 AARS W5PT14 IPO7 W5Q7C7 PSMA2 W5QHD8 PSMD2 W5P508 EIF3B W5P101 A1BG W5Q124 LOC101119509 W5QHM6...”

G8BWM7 alanine-tRNA ligase (EC 6.1.1.7) from Tetrapisispora phaffii (see paper)
37% identity, 90% coverage

P50475 Alanine--tRNA ligase, cytoplasmic from Rattus norvegicus
38% identity, 90% coverage

• Persistence of Coxsackievirus B4 in Pancreatic β Cells Disturbs Insulin Maturation, Pattern of Cellular Proteins, and DNA Methylation
  Nekoua, Microorganisms 2021
  • “...4.42 * O70593 Small glutamine-rich tetratricopeptide repeat-containing protein alpha 1.03 1.21 5.43 2.75 4.4 * P50475 Alanine--tRNA ligase, cytoplasmic 0.44 0.88 4.76 2.41 4.32 * P27008 Poly [ADP-ribose] polymerase 1 1.90 2.77 6.15 2.62 4.25 * B2RYI2 Signal recognition particle subunit SRP68 2.03 1.60 6.04 1.87...”
• Proteomic Analysis of Retinal Tissue in an S100B Autoimmune Glaucoma Model.
  Reinehr, Biology 2021
  • “...42% 19 Q68FX0 Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial 4.00 10 7 0.020 32% 20 P50475 Alanine--tRNA ligase, cytoplasmic 5.49 10 8 0.020 78%...”
• Proteomic analysis of cortical neuronal cultures treated with poly-arginine peptide-18 (R18) and exposed to glutamic acid excitotoxicity
  MacDougall, Molecular brain 2019
  • “...Got2 P00507 Aspartate aminotransferase, mitochondrial 1.923 1.213 2.109 b Ribosome components/RNA trafficking & processing Aars P50475 Alanine--tRNA ligase, cytoplasmic 1.556 5.495 4.699 C1qbp O35796 ASF/SF2-associated protein p32 1.213 1.600 b 1.888 Ddx1 Q641Y8 ATP-dependent RNA helicase DDX1 1.148 11.173 4.286 Eef1a1 P62630 Elongation factor 1-alpha 1...”
• Comparative Proteomic Analysis of Three Chinese Hamster Ovary (CHO) Host Cells.
  Xu, Biochemical engineering journal 2017
  • “...) 17.54.9 244.2 41.4 1 F1M9V7 Protein Npepps ( npepps ) 8.50.7 14.50.7 242.8 1 P50475 Alanine--tRNA ligase, cytoplasmic ( aars ) 28.56.3 15.50.7 32.517.6 0.99 P05197 Elongation factor 2 ( eef2 ) 1268.4 13014.1 1180 1 P10126 Elongation factor 1-alpha 1 ( eef1a1 ) 749.9...”
• Comparison of Integrated Responses to Nonlethal and Lethal Hypothermal Stress in Milkfish (Chanos chanos): A Proteomics Study
  Chang, PloS one 2016
  • “.... sapiens 1811 P0A6M8 Elongation factor G (EF-G) 77.39/5.25 77.58/5.24 25.5 E . coli 1812 P50475 Alanine-tRNA ligase, cytoplasmic (AlaRS) 94.86/5.32 106.79/5.41 29.0 R . norvegicus a . Spot No, spot number in 16, 18 and 28C 2-DE spot maps. b . Accession No, accession number...”
  • “.... sapiens 1811 P0A6M8 Elongation factor G (EF-G) 77.39/5.25 77.58/5.24 25.5 E . coli 1812 P50475 Alanine-tRNA ligase, cytoplasmic (AlaRS) 94.86/5.32 106.79/5.41 29.0 R . norvegicus Up-regulation 161 P62158 Calmodulin (CaM) 17.31/4.48 16.83/4.09 28.0 H . sapiens 163 P24534 Elongation factor 1-beta (EF1-beta) 25.58/5.30 24.76/4.50 36.1...”

CHLREDRAFT_38643 uncharacterized protein from Chlamydomonas reinhardtii
42% identity, 73% coverage

• Quantitative Proteomics of Chromochloris zofingiensis Reveals the Key Proteins Involved in Cell Growth and Bioactive Compound Biosynthesis
  Qiu, Plants (Basel, Switzerland) 2022
  • “...without glucose. Gene Name ID Annotation log2 (FC) for G+ vs. G Regulation p -Value CHLREDRAFT_38643 A8J0R6 Alanine-tRNA ligase (Fragment) 0.73 up 7.29 10 5 MNEG_4651 A0A0D2L8Z9 Alanyl-tRNA synthetase 0.64 up 3.26 10 5 CHLRE_06g279150v5 A8J1X8 Aspartyl-tRNA synthetase 0.62 up 3.96 10 5 ATF1 A8IZE7 Glutamine-fructose6-phosphate...”

SYAC_HUMAN / P49588 Alanine--tRNA ligase, cytoplasmic; Alanyl-tRNA synthetase; AlaRS; Protein lactyltransferase AARS1; Renal carcinoma antigen NY-REN-42; EC 6.1.1.7; EC 6.-.-.- from Homo sapiens (Human) (see 19 papers)
NP_001596 alanine--tRNA ligase, cytoplasmic from Homo sapiens
38% identity, 90% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala) (PubMed:27622773, PubMed:27911835, PubMed:28493438, PubMed:33909043). Also edits incorrectly charged tRNA(Ala) via its editing domain (PubMed:27622773, PubMed:27911835, PubMed:28493438, PubMed:29273753). In presence of high levels of lactate, also acts as a protein lactyltransferase that mediates lactylation of lysine residues in target proteins, such as TEAD1, TP53/p53 and YAP1 (PubMed:38512451, PubMed:38653238). Protein lactylation takes place in a two-step reaction: lactate is first activated by ATP to form lactate-AMP and then transferred to lysine residues of target proteins (PubMed:38512451, PubMed:38653238, PubMed:39322678). Acts as an inhibitor of TP53/p53 activity by catalyzing lactylation of TP53/p53 (PubMed:38653238). Acts as a positive regulator of the Hippo pathway by mediating lactylation of TEAD1 and YAP1 (PubMed:38512451).
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  catalytic activity: (S)-lactate + ATP + H(+) = (S)-lactoyl-AMP + diphosphate (RHEA:80271)
  catalytic activity: (S)-lactoyl-AMP + L-lysyl-[protein] = N(6)-[(S)-lactoyl]-L- lysyl-[protein] + AMP + 2 H(+) (RHEA:80275)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Monomer (PubMed:27911835). Interacts with ANKRD16; the interaction is direct (By similarity).
• Eukaryotic AlaX provides multiple checkpoints for quality and quantity of aminoacyl-tRNAs in translation.
  Li, Nucleic acids research 2024
  • “...Abmart (Shanghai, China). Plasmid construction The genes encoding hAlaX (UniProt No. Q9BTE6), hAlaRS (UniPort No. P49588), and hDTD1 (UniPort No. Q8TEA8) were amplified from cDNA obtained by reverse transcription of total RNA from human HEK293T cells. The genes encoding Sc AlaX (UniProt No. P53960) and Sc...”
• Meibomian Gland Dysfunction Is Associated with Low Levels of Immunoglobulin Chains and Cystatin-SN
  Muttuvelu, International journal of molecular sciences 2023
  • “...transfer protein beta isoform PITPNB 0.019 1.65 Q7Z6Z7-2 E3 ubiquitin-protein ligase HUWE1 HUWE1 0.005 1.65 P49588 Alanine--tRNA ligase, cytoplasmic AARS 0.022 1.63 Q15257-3 Serine/threonine-protein phosphatase 2A activator PPP2R4 0.040 1.59 O60784 Target of Myb protein 1 TOM1 0.045 1.59 O14908 PDZ domain-containing protein GIPC1 GIPC1 0.021...”
• Conditioned Medium of Human Pluripotent Stem Cell-Derived Neural Precursor Cells Exerts Neurorestorative Effects against Ischemic Stroke Model.
  Hur, International journal of molecular sciences 2022
  • “...P62081 RS7 40S ribosomal protein S7 40S RIBOSOMAL PROTEIN S7 (PTHR11278:SF5) HUMAN|HGNC = 20|UniProtKB = P49588 SYAC AlaninetRNA ligase, cytoplasmic ALANINE--TRNA LIGASE, CYTOPLASMIC (PTHR11777:SF34) HUMAN|HGNC = 7637|UniProtKB = P55209 NP1L1 Nucleosome assembly protein 1-like 1 NUCLEOSOME ASSEMBLY PROTEIN 1-LIKE 1 (PTHR11875:SF70) HUMAN|HGNC = 3014|UniProtKB = Q16555...”
• Secreted protein markers in oral squamous cell carcinoma (OSCC).
  Mumtaz, Clinical proteomics 2022
  • “...line secretomes average counts Frequency of detection in 03 saliva datasets SecretomeP prediction Subcellular localization P49588 AARS 29 AlaninetRNA ligase, cytoplasmic 0.001 2 78 3 NP Cytosol O15143 ARPC1B 18 Actin-related protein 2/3 complex subunit 1B 0.001 2 17 3 NP Cytoskeleton P27708 CAD 38 CAD...”
• Serum BRD2 autoantibody in hepatocellular carcinoma and its detection using mimotope peptide‑conjugated BSA.
  Heo, International journal of oncology 2022
  • “...(Da) pI % mol a /score b Band-1 Band-2 P13639 EEF2 96,246 6.41 0.9864/555 4.002/1645 P49588 AARS 107,484 5.34 0.9059/771 2.906/1883 A0A140T9E9 BRD2 88,664 9.13 - 2.7652/1357 Q14697-2 GANAB 109,825 5.82 - 1.6993/934 P53618 COPB1 108,214 5.72 0.9461/603 1.6692/779 K7EJE8 LONP1 93,637 6.08 - 1.6692/848 P22314...”
• CD9 inhibition reveals a functional connection of extracellular vesicle secretion with mitophagy in melanoma cells
  Suárez, Journal of extracellular vesicles 2021
  • “...SV=4 TUBB3 Q13509 31.77 0.65 Tubulin beta3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2 AARS1 P49588 20.48 0.65 AlaninetRNA ligase cytoplasmic OS=Homo sapiens OX=9606 GN=AARS PE=1 SV=2 KARS1 Q15046 20.39 0.65 LysinetRNA ligase OS=Homo sapiens OX=9606 GN=KARS PE=1 SV=3 CD63 P08962 11.11 1.49 CD63 antigen OS=Homo...”
• Major Determinants of Airway Epithelial Cell Sensitivity to S. aureus Alpha-Toxin: Disposal of Toxin Heptamers by Extracellular Vesicle Formation and Lysosomal Degradation.
  Möller, Toxins 2021
  • “...protein, KIF23 12 16 19 P06753 Tropomyosin alpha-3 chain, TPM3 6 5 6 Cytosolic enzymes P49588 Alanine-tRNA ligase, cytoplasmic, AARS 24 18 25 P31939 Bifunctional purine biosynthesis protein, ATIC 21 17 25 Enzyme, organizer of 3D structure of proteins Q96HE7 ERO1-like protein alpha, ERO1L 5 5...”
• Identification of Proteins Deregulated by Platinum-Based Chemotherapy as Novel Biomarkers and Therapeutic Targets in Non-Small Cell Lung Cancer.
  Ryan, Frontiers in oncology 2021
  • “...with 74 interactors HNRNPAB Q99729 N/A 0.999999747 N/A N/A 191 interactions with 144 interactors AARS P49588 4XEM 4XEO 5V59 5KNN 0.999999059 Thiazole derivatives (see Supplemental Table 3 ) N/A 332 interactions with 205 interactors UCHL5 Q9Y5K5 3RIS 4UEL 4UF5 4WLP 0.999999059 4-hydroxycyclohexanone scaffolds (see Supplemental Table...”
• More
• The alanyl-tRNA synthetase AARS1 moonlights as a lactyltransferase to promote YAP signaling in gastric cancer.
  Ju, The Journal of clinical investigation 2024
  • GeneRIF: The alanyl-tRNA synthetase AARS1 moonlights as a lactyltransferase to promote YAP signaling in gastric cancer.
• Alanyl-tRNA synthetase, AARS1, is a lactate sensor and lactyltransferase that lactylates p53 and contributes to tumorigenesis.
  Zong, Cell 2024 (PubMed)
  • GeneRIF: Alanyl-tRNA synthetase, AARS1, is a lactate sensor and lactyltransferase that lactylates p53 and contributes to tumorigenesis.
• A humanized yeast model reveals dominant-negative properties of neuropathy-associated alanyl-tRNA synthetase mutations.
  Meyer-Schuman, Human molecular genetics 2023
  • GeneRIF: A humanized yeast model reveals dominant-negative properties of neuropathy-associated alanyl-tRNA synthetase mutations.
• Clinical characteristics and proteome modifications in two Charcot-Marie-Tooth families with the AARS1 Arg326Trp mutation.
  Høyer, BMC neurology 2022
  • GeneRIF: Clinical characteristics and proteome modifications in two Charcot-Marie-Tooth families with the AARS1 Arg326Trp mutation.
• CMT2N-causing aminoacylation domain mutants enable Nrp1 interaction with AlaRS.
  Sun, Proceedings of the National Academy of Sciences of the United States of America 2021
  • GeneRIF: CMT2N-causing aminoacylation domain mutants enable Nrp1 interaction with AlaRS.
• Protein instability associated with AARS1 and MARS1 mutations causes trichothiodystrophy.
  Botta, Human molecular genetics 2021
  • GeneRIF: Protein instability associated with AARS1 and MARS1 mutations causes trichothiodystrophy.
• Alanyl-tRNA synthetase 1 (AARS1) gene mutation in a family with intermediate Charcot-Marie-Tooth neuropathy.
  Lee, Genes & genomics 2020 (PubMed)
  • GeneRIF: Alanyl-tRNA synthetase 1 (AARS1) gene mutation in a family with intermediate Charcot-Marie-Tooth neuropathy.
• The G3-U70-independent tRNA recognition by human mitochondrial alanyl-tRNA synthetase.
  Zeng, Nucleic acids research 2019
  • GeneRIF: we investigated the effects of the severe infantile-onset cardiomyopathy-associated R592W mutation of hmtAlaRS on the canonical enzymatic activities of hmtAlaRS. Overall, our results provide fundamental information about tRNA recognition and deepen our understanding of translational quality control mechanisms by hmtAlaRS.
• More

O01541 Alanine--tRNA ligase, cytoplasmic from Caenorhabditis elegans
38% identity, 90% coverage

• Altered proteostasis in aging and heat shock response in C. elegans revealed by analysis of the global and de novo synthesized proteome
  Liang, Cellular and molecular life sciences : CMLS 2014
  • “...homolog 7 1.7 1.3 Q18240 spr-2 Suppressor of presenilin-2 1 2.2 1.6 Other cellular components O01541 aars-2 Alanyl amino-acyl tRNA synthetase 1 1.7 1.2 Q18493 C36A4.4 Orthologous to human isoform AGX2 4 2.0 1.5 1 2.3 1.5 Q18688 daf-21 Abnormal dauer formation, heat shock protein 90...”

SYA_YEAST / P40825 Alanine--tRNA ligase, mitochondrial; Alanyl-tRNA synthetase; AlaRS; EC 6.1.1.7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
P40825 alanine-tRNA ligase (EC 6.1.1.7) from Saccharomyces cerevisiae (see paper)
43% identity, 71% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Monomer.
• Eukaryotic AlaX provides multiple checkpoints for quality and quantity of aminoacyl-tRNAs in translation
  Li, Nucleic acids research 2024
  • “...HEK293T cells. The genes encoding Sc AlaX (UniProt No. P53960) and Sc AlaRS (Uniport No. P40825) were amplified from the BY4741 genome. For gene expression analysis in HEK293T cells, hAlaX gene was inserted between the BamHI and XhoI sites of pCMV-3Tag-3A, pCMV-3Tag-4Aor pEGFP-N2. EGFP was amplified...”
• The G3-U70-independent tRNA recognition by human mitochondrial alanyl-tRNA synthetase
  Zeng, Nucleic acids research 2019
  • “...Arg 663 -containing peptides from various AlaRSs. Sc mtAlaRS, Saccharomyces cerevisiae mitochondrial AlaRS (Uniprot No. P40825); hAlaRS, human cytoplasmic AlaRS (Uniprot No. P49588); mAlaRS, mouse cytoplasmic AlaRS (Uniprot No. Q8BGQ7); Sc AlaRS, S. cerevisiae cytoplasmic AlaRS (Uniprot No. P40825); Tt AlaRS, Thermus thermophilus AlaRS (Uniprot No....”
• Plus ça change - evolutionary sequence divergence predicts protein subcellular localization signals
  Fukasawa, BMC genomics 2014
  • “...MTS and N-signal-free classes. The most highly affected protein is mitochondrial alanine tRNA ligase, ALA1 (P40825), which is predicted to have an MTS when sequence divergence features are used. Upon closer inspection we discovered that the sequence we used for this protein should in fact have...”
• A dual-specificity aminoacyl-tRNA synthetase in the deep-rooted eukaryote Giardia lamblia
  Bunjun, Proceedings of the National Academy of Sciences of the United States of America 2000
  • “...prowazekii (sp Q9ZCA4), Saccharomyces cerevisiae (sp P40825), Sulfolobus solfataricus (sp P96041), Synechocystis sp. (sp P74423), Thermotoga maritima (sp...”

SYAC_MOUSE / Q8BGQ7 Alanine--tRNA ligase, cytoplasmic; Alanyl-tRNA synthetase; AlaRS; Protein lactyltransferase AARS1; Protein sticky; Sti; EC 6.1.1.7; EC 6.-.-.- from Mus musculus (Mouse) (see 6 papers)
NP_666329 alanine--tRNA ligase, cytoplasmic from Mus musculus
38% identity, 90% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala) (PubMed:16906134, PubMed:20010690, PubMed:25422440, PubMed:27622773). Also edits incorrectly charged tRNA(Ala) via its editing domain (PubMed:16906134, PubMed:20010690, PubMed:25422440, PubMed:29769718). In presence of high levels of lactate, also acts as a protein lactyltransferase that mediates lactylation of lysine residues in target proteins, such as TEAD1, TP53/p53 and YAP1. Protein lactylation takes place in a two-step reaction: lactate is first activated by ATP to form lactate-AMP and then transferred to lysine residues of target proteins. Acts as an inhibitor of TP53/p53 activity by catalyzing lactylation of TP53/p53. Acts as a positive regulator of the Hippo pathway by mediating lactylation of TEAD1 and YAP1.
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  catalytic activity: (S)-lactate + ATP + H(+) = (S)-lactoyl-AMP + diphosphate (RHEA:80271)
  catalytic activity: (S)-lactoyl-AMP + L-lysyl-[protein] = N(6)-[(S)-lactoyl]-L- lysyl-[protein] + AMP + 2 H(+) (RHEA:80275)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Monomer (By similarity). Interacts with ANKRD16; the interaction is direct (PubMed:29769718).
• TBX1 is required for normal stria vascularis and semicircular canal development
  Tian, Developmental biology 2020
  • “...3 NP_081118 582 aa 114241 ATRN Good 2 NP_033860 1428 aa 256490 AARS Moderate 1 NP_666329 968 aa 754913 ABTB2 Moderate 1 NP_849221 1024 aa 256490 COMP Moderate 1 NP_057894 755 aa 5136 CREBZF Moderate 1 NP_660133 358 aa 182358 FBN1 Moderate 1 NP_032019 2873 aa...”
• Proteomic Analysis of Protective Effects of Dl-3-n-Butylphthalide against mpp + -Induced Toxicity via downregulating P53 pathway in N2A Cells
  Zhao, Proteome science 2023
  • “...cholesterol ester hydrolase 1 0.00098 Q8BHC1 Rab39b Ras-related protein Rab-39B 0.002247 Q8BGZ6 Gla Alpha-galactosidase 0.010911 Q8BGQ7 Aars \AlaninetRNA ligase, cytoplasmic \"" 8.69E-05 Q8BGB5 Limd2 LIM domain-containing protein 2 0.000117 Q8BG16 Slc6a15 Sodium-dependent neutral amino acid transporter B(0)AT2 0.001698 Q8BFW6 Entpd3 Ectonucleoside triphosphate diphosphohydrolase 3 0.0032 Q80ZM5...”
• The amyloid peptide β disrupts intercellular junctions and increases endothelial permeability in a NADPH oxidase 1-dependent manner.
  Tarafdar, Redox biology 2022
  • “...Q8BP47 Asparagine--tRNA ligase, cytoplasmic NARS1 0.0091134 Q8K0B2 Lysosomal cobalamin transport escort protein LMBD1 Lmbrd1 0.0095729 Q8BGQ7 Alanine--tRNA ligase, cytoplasmic Aars1 0.0102687 Q80X50 Ubiquitin-associated protein 2-like Ubap2l 0.0116174 Q8BJW6 Eukaryotic translation initiation factor 2A Eif2a 0.0116343 Q69ZR2 E3 ubiquitin-protein ligase HECTD1 Hectd1 0.0119589 Q9JK81 MYG1 exonuclease Myg1...”
• Proteomic profiling of the interface between the stomach wall and the pancreas in dystrophinopathy
  Dowling, European journal of translational myology 2021
  • “...Cpt2 6 0.013181 2.1 P63038 60 kDa heat shock protein, mitochondrial Hspd1 5 0.007267 2.1 Q8BGQ7 Alanine--tRNA ligase, cytoplasmic Aars 3 0.007629 2.1 P38647 Stress-70 protein, mitochondrial Hspa9 7 0.000879 2 P56480 ATP synthase subunit beta, mitochondrial Atp5f1b 3 0.02928 2 P02088 Hemoglobin subunit beta-1 Hbb-b1...”
• Proteomics of autism and Alzheimer's mouse models reveal common alterations in mTOR signaling pathway.
  Mencer, Translational psychiatry 2021
  • “...1 Q3V1U8 ELMO domain-containing protein 1 Q6PDI5 Proteasome-associated protein ECM29 homolog Q06335 Amyloid-like protein 2 Q8BGQ7 AlaninetRNA ligase, cytoplasmic Q8C779 Uncharacterized protein CXorf57 homolog Q9QZE7 Translin-associated protein X Q9QZQ1 Afadin Q91Y44 Bromodomain testis-specific protein Q8BUH8 Sentrin-specific protease 7 Q3UQ44 Ras GTPase-activating-like protein IQGAP2 Q8CHY6 Transcriptional repressor...”
• Protein Expression Analysis of an In Vitro Murine Model of Prostate Cancer Progression: Towards Identification of High-Potential Therapeutic Targets
  Bahmad, Journal of personalized medicine 2020
  • “...shock 70 kDa protein 1B Hspa1b 70,176 -1.3879 0.0209 O55131 Septin-7 Sept7 50,550 1.4336 0.0409 Q8BGQ7 AlaninetRNA ligase, cytoplasmic Aars 106,909 1.4824 0.0113 Q99K85 Phosphoserine aminotransferase Psat1 40,473 1.4994 0.0014 Q6IRU2 Tropomyosin alpha-4 chain Tpm4 28,468 1.5363 0.0019 P62814 V-type proton ATPase subunit B, brain isoform...”
• The G3-U70-independent tRNA recognition by human mitochondrial alanyl-tRNA synthetase.
  Zeng, Nucleic acids research 2019
  • “...No. P40825); hAlaRS, human cytoplasmic AlaRS (Uniprot No. P49588); mAlaRS, mouse cytoplasmic AlaRS (Uniprot No. Q8BGQ7); Sc AlaRS, S. cerevisiae cytoplasmic AlaRS (Uniprot No. P40825); Tt AlaRS, Thermus thermophilus AlaRS (Uniprot No. P74941) and Ph AlaRS, Pyrococcus horikoshii AlaRS (Uniprot No. O58035). ( B ) Location...”
• Proteomic Analysis of Secretomes of Oncolytic Herpes Simplex Virus-Infected Squamous Cell Carcinoma Cells.
  Tada, Cancers 2018
  • “...72 16 11.3 1.41 0.00015 * Q9D8N0 Elongation factor 1-gamma 50 16.7 10.3 1.61 0.18 Q8BGQ7 Alanine--tRNA ligase, cytoplasmic 107 15.7 10.3 1.51 0.21 Q61553 Fascin 55 15 10.3 1.45 0.049 * Q8CIE6 Coatomer subunit alpha 138 14.7 10 1.47 0.025 * P21550 Beta-enolase 47 38...”
• Proteomics Reveals Scope of Mycolactone-mediated Sec61 Blockade and Distinctive Stress Signature.
  Morel, Molecular & cellular proteomics : MCP 2018
• More

NP_014980 alanine--tRNA ligase from Saccharomyces cerevisiae S288C
NP_014980, YOR335C Ala1p from Saccharomyces cerevisiae
43% identity, 73% coverage

• Redundancy of non-AUG initiators. A clever mechanism to enhance the efficiency of translation in yeast.
  Chang, The Journal of biological chemistry 2006 (PubMed)
  • GeneRIF: ALA1 constructs with redundant ACG initiators exhibit stronger complementing activity and express a higher level of protein than do those with a single ACG initiator
• An unusual pattern of protein expression and localization of yeast alanyl-tRNA synthetase isoforms.
  Huang, Molecular microbiology 2006 (PubMed)
  • GeneRIF: The sequence upstream of the first in-frame AUG initiator not only carries an unusual initiation site, but also contributes to a novel pattern of protein expression and localization.
• A non-canonical Puf3p-binding sequence regulates CAT5/COQ7 mRNA under both fermentable and respiratory conditions in budding yeast
  Hayashi, PloS one 2023
  • “...- Polysome YGR094W VAS1 Mitochondrial and cytoplasmic valyl-tRNA synthetase Localized No independent of Puf3p Polysome YOR335C ALA1 Cytoplasmic and mitochondrial alanyl-tRNA synthetase undetermined Yes - Polysome YPL061W ALD6 Cytosolic aldehyde dehydrogenase undetermined No - Polysome YIL125W KGD1 Subunit of the mitochondrial alpha-ketoglutarate dehydrogenase complex Localized No...”
• Comprehensive characterization of mRNAs associated with yeast cytosolic aminoacyl-tRNA synthetases
  Garin, RNA biology 2021 (secret)
• Localization and RNA Binding of Mitochondrial Aminoacyl tRNA Synthetases
  Garin, Genes 2020
  • “...No No TyrRS YPL097W (MSY1) Yes (94.2) Yes Partial No No Mitochondria & Cytosol AlaRS YOR335C (ALA1) No No NR NR No CysRS YNL247W (CRS1) NA No NA NR NA GlyRS YBR121C (GRS1) Low (13.1) No No NR No HisRS YPR033C (HTS1) No No NR NR...”
• Divergent Alanyl-tRNA Synthetase Genes of Vanderwaltozyma polyspora Descended from a Common Ancestor through Whole-Genome Duplication Followed by Asymmetric Evolution
  Chang, Molecular and cellular biology 2015
  • “...africana, XP_003957527; Saccharomyces cerevisiae, NP_014980; Candida glabrata, XP_445923; Tetrapisispora blattae, XP_004177771; Vanderwaltozyma polyspora...”
• RSC Chromatin-Remodeling Complex Is Important for Mitochondrial Function in Saccharomyces cerevisiae
  Imamura, PloS one 2015
  • “...YOR048C RAT1 -1.205794524 Ribonucleic Acid Trafficking YOR188W MSB1 -1.4223978 Multicopy Suppressor of a Budding defect YOR335C ALA1 -1.034833773 ALAnyl-tRNA synthetase YPL005W AEP3 -1.086709933 ATPase ExPression YPL082C MOT1 -1.191021182 Modifier of Transcription Other YDL040C NAT1 -1.987231644 N-terminal AcetylTransferase YLR090W XDJ1 -1.238779632 Putative chaperone YOL109W ZEO1 -1.128791113 ZEOcin...”
• Translate to divide: сontrol of the cell cycle by protein synthesis
  Polymenis, Microbial cell (Graz, Austria) 2015
  • “...G2/M, other 52 tRNA synthetases YGR264C MES1 MetRS G1 51 YLL018C DPS1 AspRS G1 52 YOR335C ALA1/CDC64 AlaRS G1 50 YPL160W CDC60 LeuRS G1 50 tRNA tQ(CUG)M CDC65 tRNA-Gln G1 137 Ribosome biogenesis and assembly YBL004W UTP20 18S rRNA biogenesis other 52 YBR142W MAK5 60S ribosome...”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...in boldface. The letter m denotes putative initiation from a non-AUG codon. Sc, Saccharomyces cerevisiae (NP_014980); Ca, Candida albicans (XP_718016); Yl, Yarrowia lipolytica (XP_500483); Sp, S. pombe (NP_593640); Ag, Ashbya gossypii (NP_984459); Cg, Candida glabrata (XP_445923); Cn, Cryptococcus neoformans (XP_774788); Dh, Debaryomyces hansenii (XP_456501); Kl, Kluyveromyces...”
• Widespread reorganization of metabolic enzymes into reversible assemblies upon nutrient starvation
  Narayanaswamy, Proceedings of the National Academy of Sciences of the United States of America 2009
  • “...UGT51 URA2 VAS1 YNL220W YMR120C YGL234W YMR303C YOR335C YGL105W YAL038W YPL160W YLR216C YGR155W YPR035W YOR168W YMR186W YDR171W YPL240C YPR033C YBL076C YBR140C...”
• More

NP_593640 alanine-tRNA ligase (predicted) from Schizosaccharomyces pombe
38% identity, 91% coverage

• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...Sc, Saccharomyces cerevisiae (NP_014980); Ca, Candida albicans (XP_718016); Yl, Yarrowia lipolytica (XP_500483); Sp, S. pombe (NP_593640); Ag, Ashbya gossypii (NP_984459); Cg, Candida glabrata (XP_445923); Cn, Cryptococcus neoformans (XP_774788); Dh, Debaryomyces hansenii (XP_456501); Kl, Kluyveromyces lactis (XP_455190); Mg, Malassezia globosa (XP_001731546); Pg, Pichia guilliermondii (XP_001486846); Ps, Pichia...”

A7TRK4 alanine-tRNA ligase (EC 6.1.1.7) from Vanderwaltozyma polyspora (see paper)
XP_001642960 uncharacterized protein from Vanderwaltozyma polyspora DSM 70294
37% identity, 91% coverage

• Divergent Alanyl-tRNA Synthetase Genes of Vanderwaltozyma polyspora Descended from a Common Ancestor through Whole-Genome Duplication Followed by Asymmetric Evolution
  Chang, Molecular and cellular biology 2015
  • “...polyspora (VpAlaRS1, XP_001643652; VpAlaRS2, XP_001642960); Tetrapisispora phaffii (TpAlaRS1, XP_003686912; TpAlaRS2, XP_003688259); Lachancea thermotolerans,...”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...Pg, Pichia guilliermondii (XP_001486846); Ps, Pichia stipitis (XP_001383420); and Vp, Vanderwaltozyma polyspora (VpAlaRS1, XP_001643652; VpAlaRS2, XP_001642960). ( B ) 5-End sequences of VpALA1 and VpALA2 . The sequence extends from the nearest upstream stop codon to +60 nucleotide relative to ATG1. ATG and potential non-ATG initiator...”

Q5AQL1 Alanine--tRNA ligase from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
38% identity, 91% coverage

• iTRAQ-Based Quantitative Proteomic Analysis Reveals Proteomic Changes in Mycelium of Pleurotus ostreatus in Response to Heat Stress and Subsequent Recovery
  Zou, Frontiers in microbiology 2018
  • “...fumigata 1.72 1 1.348 1.505 Q4P5N0 Serine/threonine-protein kinase SMU1 Ustilago maydis 1.74 1 0.798 1.609 Q5AQL1 Alaninetrna ligase Emericella nidulans 3.64 2 0.901 0.630 O43011 Histidinetrna ligase, mitochondrial Schizosaccharomyces pombe 1.95 1 0.853 0.607 Q8SRH2 Probable threoninetrna ligase, cytoplasmic Encephalitozoon cuniculi 1.25 1 1.733 1.991 O75005...”

XP_456501 alanyl-tRNA synthetase from Debaryomyces hansenii CBS767
42% identity, 73% coverage

• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...Ag, Ashbya gossypii (NP_984459); Cg, Candida glabrata (XP_445923); Cn, Cryptococcus neoformans (XP_774788); Dh, Debaryomyces hansenii (XP_456501); Kl, Kluyveromyces lactis (XP_455190); Mg, Malassezia globosa (XP_001731546); Pg, Pichia guilliermondii (XP_001486846); Ps, Pichia stipitis (XP_001383420); and Vp, Vanderwaltozyma polyspora (VpAlaRS1, XP_001643652; VpAlaRS2, XP_001642960). ( B ) 5-End sequences of...”

XP_445923 hypothetical protein from Candida glabrata CBS 138
42% identity, 73% coverage

• Divergent Alanyl-tRNA Synthetase Genes of Vanderwaltozyma polyspora Descended from a Common Ancestor through Whole-Genome Duplication Followed by Asymmetric Evolution
  Chang, Molecular and cellular biology 2015
  • “...cerevisiae, NP_014980; Candida glabrata, XP_445923; Tetrapisispora blattae, XP_004177771; Vanderwaltozyma polyspora (VpAlaRS1, XP_001643652; VpAlaRS2,...”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...Yl, Yarrowia lipolytica (XP_500483); Sp, S. pombe (NP_593640); Ag, Ashbya gossypii (NP_984459); Cg, Candida glabrata (XP_445923); Cn, Cryptococcus neoformans (XP_774788); Dh, Debaryomyces hansenii (XP_456501); Kl, Kluyveromyces lactis (XP_455190); Mg, Malassezia globosa (XP_001731546); Pg, Pichia guilliermondii (XP_001486846); Ps, Pichia stipitis (XP_001383420); and Vp, Vanderwaltozyma polyspora (VpAlaRS1, XP_001643652;...”

XP_500483 YALI0B04180p from Yarrowia lipolytica CLIB122
38% identity, 91% coverage

• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...from a non-AUG codon. Sc, Saccharomyces cerevisiae (NP_014980); Ca, Candida albicans (XP_718016); Yl, Yarrowia lipolytica (XP_500483); Sp, S. pombe (NP_593640); Ag, Ashbya gossypii (NP_984459); Cg, Candida glabrata (XP_445923); Cn, Cryptococcus neoformans (XP_774788); Dh, Debaryomyces hansenii (XP_456501); Kl, Kluyveromyces lactis (XP_455190); Mg, Malassezia globosa (XP_001731546); Pg, Pichia...”

NCU02566 alanyl-tRNA synthetase from Neurospora crassa OR74A
39% identity, 79% coverage

• Flammulina filiformis Pkac Gene Complementing in Neurospora crassa Mutant Reveals Its Function in Mycelial Growth and Abiotic Stress Response
  Yang, Life (Basel, Switzerland) 2022
  • “...crassa : NCU04755 / F. filiformis : gene3092 ); alanyl-tRNA synthetase ( N. crassa : NCU02566 / F. filiformis : gene4152 ); phenylalanyl-tRNA synthetase subunit alpha ( N. crassa : NCU05095 / F. filiformis : gene3962 ); translation initiation factor eif-2b epsilon subunit ( N. crassa...”

H3BPK7 Alanine--tRNA ligase from Homo sapiens
41% identity, 75% coverage

• HMGB1 and Caveolin-1 related to RPE cell senescence in age-related macular degeneration.
  Sun, Aging 2019
  • “...MX1 50.71424385 0.000773586 P04179 SOD2 37.3876135 0.000328524 H9KVA0 TYMP 27.61593536 0.00153441 F5H090 UNC13C 26.74494289 0.00305275 H3BPK7 AARS 26.39582865 0.000375675 P51911 CNN1 26.24793326 0.0604881 Q8IYM0 FAM186B 25.5978875 0.373977 P21281 ATP6V1B2 23.45846962 0.0387506 Q562R1 ACTBL2 19.38697164 0.0155401 P42785 PRCP PCP 17.65006048 0.0672487 Q15349 RPS6KA2 17.34576845 0.000390284 H0Y9R5 SNX25...”

Q54Y20 alanine-tRNA ligase (EC 6.1.1.7) from Dictyostelium discoideum (see paper)
38% identity, 92% coverage

NP_001037775 alanine--tRNA ligase, cytoplasmic isoform 1 from Danio rerio
37% identity, 88% coverage

• Hypermorphic and hypomorphic AARS alleles in patients with CMT2N expand clinical and molecular heterogeneities.
  Weterman, Human molecular genetics 2018
  • GeneRIF: all three mutations caused a pathological phenotype of neural abnormalities when expressed in zebrafish, while expression of the human wild-type messenger RNA (mRNA) did not. Our data indicate that not only functional null or hypomorphic alleles, but also hypermorphic AARS alleles can cause dominantly inherited axonal Charcot-Marie-Tooth (CMT) disease .
• A major determinant for binding and aminoacylation of tRNA(Ala) in cytoplasmic Alanyl-tRNA synthetase is mutated in dominant axonal Charcot-Marie-Tooth disease
  Latour, American journal of human genetics 2010
  • “...(Rattus norvegicus ), NP_001005836 (Gallus gallus ), NP_001037775 (Danio rerio ), and AAF05593 (Drosophila melanogaster ). Fully conserved amino acids are...”

XP_001383420 Alanyl-tRNA synthetase, cytoplasmic (Alanine--tRNA ligase) (AlaRS) from Pichia stipitis CBS 6054
41% identity, 77% coverage

• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...Kl, Kluyveromyces lactis (XP_455190); Mg, Malassezia globosa (XP_001731546); Pg, Pichia guilliermondii (XP_001486846); Ps, Pichia stipitis (XP_001383420); and Vp, Vanderwaltozyma polyspora (VpAlaRS1, XP_001643652; VpAlaRS2, XP_001642960). ( B ) 5-End sequences of VpALA1 and VpALA2 . The sequence extends from the nearest upstream stop codon to +60 nucleotide...”

C0NKL8 Alanine--tRNA ligase from Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432)
HCBG_03698 alanyl-tRNA synthetase from Histoplasma capsulatum G186AR
38% identity, 84% coverage

• Extracellular Vesicle-Mediated RNA Release in Histoplasma capsulatum.
  Alves, mSphere 2019
  • “...60S ribosomal protein L5 HCBG_05566 C0NQR6 60S ribosomal protein L9B HCBG_05346 C0NPC0 Acyl-RNA-complex subunit HCBG_05000 C0NKL8 Alanine-tRNA ligase (EC 6.1.1.7) (alanyl-tRNA synthetase) (AlaRS) ALA1 HCBG_03698 C0NCS0 Alternative oxidase (EC 1.-.-.-) HCBG_00916 C0ND66 Arginyl-tRNA synthetase HCBG_01062 C0NT82 Asparagine-rich protein HCBG_06362 C0NP94 Asparaginyl-tRNA synthetase HCBG_04974 C0NGY7 Aspartyl-tRNA synthetase...”
• Extracellular Vesicle-Mediated RNA Release in Histoplasma capsulatum
  Alves, mSphere 2019
  • “...L9B HCBG_05346 C0NPC0 Acyl-RNA-complex subunit HCBG_05000 C0NKL8 Alanine-tRNA ligase (EC 6.1.1.7) (alanyl-tRNA synthetase) (AlaRS) ALA1 HCBG_03698 C0NCS0 Alternative oxidase (EC 1.-.-.-) HCBG_00916 C0ND66 Arginyl-tRNA synthetase HCBG_01062 C0NT82 Asparagine-rich protein HCBG_06362 C0NP94 Asparaginyl-tRNA synthetase HCBG_04974 C0NGY7 Aspartyl-tRNA synthetase HCBG_02609 C0NNJ3 ATP-dependent helicase NAM7 HCBG_04723 C0NIT7 ATP-dependent RNA...”

AFUA_8G03880 alanyl-tRNA synthetase, putative from Aspergillus fumigatus Af293
Q4WCM7 Alanine--tRNA ligase from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
42% identity, 69% coverage

• Interplay between Gliotoxin Resistance, Secretion, and the Methyl/Methionine Cycle in Aspergillus fumigatus
  Owens, Eukaryotic cell 2015
  • “...20,904.6 35,523.1 29,061.1 AFUA_7G05660 AFUA_8G03880 AFUA_1G02030 AFUA_4G08110 AFUA_1G15270 AFUA_4G03760 AFUA_4G07360 AFUA_2G12870 AFUA_7G05210 AFUA_4G07360...”
• The proteomic signature of Aspergillus fumigatus during early development
  Cagas, Molecular & cellular proteomics : MCP 2011
  • “...Weight UniProt ID AFUA_4G09870 AFUA_5G04170 AFUA_8G03880 AFUA_6G05200 AFUA_5G07020 AFUA_1G07440 AFUA_3G13320 AFUA_6G06370 AFUA_3G07640 AFUA_1G12170 AFUA_5G06130...”
• Integrative analysis of the heat shock response in Aspergillus fumigatus
  Albrecht, BMC genomics 2010
  • “...1.20 1.10 0.22 0.71 Yes AFUA_7G05660 (translation elongation factor eEF-3) 2.02 1.43 -0.19 0.70 Yes AFUA_8G03880 (alanyl-tRNA synthetase) 1.37 0.80 -0.22 0.32 Yes Transcription AFUA_1G15620 (DEAD box RNA helicase HelA) 1.43 1.40 0.24 0.70 Yes Cell cycle AFUA_2G17110 (cell division control protein Cdc48) 1.01 1.11 0.50...”
• The Aspergillus fumigatus transcriptional regulator AfYap1 represents the major regulator for defense against reactive oxygen intermediates but is dispensable for pathogenicity in an intranasal mouse infection model
  Lessing, Eukaryotic cell 2007
  • “...9 Protein translocation IDI2 (AFUA_4G05830) Alanyl-tRNA synthetase (AFUA_8G03880) 1.0 1.6 1.8 1.4 10 11 Pentose phosphate pathway Transketolase TktA...”
• The proteomic signature of Aspergillus fumigatus during early development
  Cagas, Molecular & cellular proteomics : MCP 2011
  • “...Q4WXU5 Q6J9U0 Q4WPZ9 Q4W9X3 Q4WJM1 Q4WCM7 Q4X1V2 Q4WTZ9 AFUA_4G07690 AFUA_6G06340 AFUA_1G14220 AFUA_2G16880 AFUA_1G07280 AFUA_3G08460 AFUA_4G10800 AFUA_7G05290...”

Smp_038240 putative alanyl-tRNA synthetase from Schistosoma mansoni
35% identity, 89% coverage

• Gene expression patterns in larval Schistosoma mansoni associated with infection of the mammalian host
  Parker-Manuel, PLoS neglected tropical diseases 2011
  • “...lysyl-tRNA synthetase Smp_104470 3.66 1.00 2.28 ribosomal protein S11 Smp_032760 3.65 1.00 - alanyl-tRNA synthetase Smp_038240 3.13 1.00 - ribosomal protein S2, eukaryotic and archaeal form Smp_179180 2.80 1.00 2.13 28S ribosomal protein S30 Smp_135810 2.79 1.25 1.00 28S ribosomal protein S5 Smp_145780 2.74 1.00 1.12...”

G8C0Z7 alanine-tRNA ligase (EC 6.1.1.7) from Tetrapisispora phaffii (see paper)
36% identity, 91% coverage

MSC_0178 alanine-tRNA ligase from Mycoplasma mycoides subsp. mycoides SC str. PG1
35% identity, 95% coverage

• Identification of genes coding for B cell antigens of Mycoplasma mycoides subsp. mycoides Small Colony (MmmSC) by using phage display
  Miltiadou, BMC microbiology 2009
  • “...Prolipoprotein LppC (LppC) Yes (1) No CAE76772 MSC_0122 Alanine-tRNA ligase (AlaS) Yes (1) No CAE76823 MSC_0178 DNA gyrase subunit B (GyrB) Yes (1) Yes (1) CAE76659 MSC_0006 Methionine adenosyltransferase (MetK) Yes (1) No CAE77120 MSC_0492 Glyceraldehyde-3-phosphate dehydrogenase (GapN) Yes (1) No CAE77137 b MSC_0509 Glycerol-3-phosphate oxidase...”

CNBF2180, XP_774788 hypothetical protein from Cryptococcus neoformans var. neoformans B-3501A
37% identity, 85% coverage

• Novel and unique domains in aminoacyl-tRNA synthetases from human fungal pathogens Aspergillus niger, Candida albicans and Cryptococcus neoformans
  Datt, BMC genomics 2014
  • “...TyrRS CNBJ0260 Mito 478 1.2e-169 47 ValRS CNBB3840 Mito 1109 0 47 Class II AlaRS CNBF2180 Mito 1012 0 49 AsnRS CNBD2410 Mito 513 1.7e-157 38 AsnRS CNBE1330 Cyto 600 1.8e-251 48 AspRS CNBK1200 Mito 693 8.5e-193 36 AsxRS CNBG4380 Cyto 884 0 42 GlyRS CNBF3810...”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...Sp, S. pombe (NP_593640); Ag, Ashbya gossypii (NP_984459); Cg, Candida glabrata (XP_445923); Cn, Cryptococcus neoformans (XP_774788); Dh, Debaryomyces hansenii (XP_456501); Kl, Kluyveromyces lactis (XP_455190); Mg, Malassezia globosa (XP_001731546); Pg, Pichia guilliermondii (XP_001486846); Ps, Pichia stipitis (XP_001383420); and Vp, Vanderwaltozyma polyspora (VpAlaRS1, XP_001643652; VpAlaRS2, XP_001642960). ( B...”

J9EZY7 Alanine--tRNA ligase from Wuchereria bancrofti
37% identity, 94% coverage

• Biosynthesis and characterization of Ocimum sanctum green silver nanoparticles and unravelling their enhanced anti-filarial activity through a HRAMS proteomics approach
  Mishra, RSC advances 2024
  • “...6 25.98 A0A0H5S5U2 BMA-CUL-3 0.01 1 10 17 6.22 A0A1I8EF89 Phenylalanine--tRNA ligase 0.561 0.01791942 7.23 J9EZY7 Alanine--tRNA ligase 0.538 0.010388903 11.52 A0A0J9Y3N8 RNA helicase 0.01 1 10 17 3.2 A0A0J9Y0Q8 BMA-HIP-1 0.607 0.045063353 73.05 A0A1I8ESJ2 PHB domain-containing protein 0.449 0.000683132 36.93 A0A1I8EPC5 Ge1_WD40 domain-containing protein 0.598...”

TGME49_219540 cytosolic tRNA-Ala synthetase from Toxoplasma gondii ME49
39% identity, 58% coverage

• Protein Lactylation and Metabolic Regulation of the Zoonotic Parasite Toxoplasma gondii
  Yin, Genomics, proteomics & bioinformatics 2023
  • “...include the proteasome 26S regulatory subunit (TGME49_313410), uncharacterized protein (TGME49_205320), uncharacterized protein (TGME49_240220), alanine-tRNA ligase (TGME49_219540), inner membrane complex protein IMC17 (TGME49_286580), elongation factor 2 family protein (TGME49_286080), and histidyl-tRNA synthetase (TGME49_280600). As shown in Figure S15 , these proteins were differentially modified by lysine 2-hydroxyisobutyrylation...”

LINJ_22_1390 putative alanyl-tRNA synthetase from Leishmania infantum JPCM5
A4I013 Alanine--tRNA ligase from Leishmania infantum
37% identity, 88% coverage

• Unravelling the proteomic signature of extracellular vesicles released by drug-resistant Leishmania infantum parasites
  Douanne, PLoS neglected tropical diseases 2020
  • “...no no (0.400) no 23 LINJ_32_3200 Leucine-rich repeat protein-putative 9.3 no no (0.568) no 24 LINJ_22_1390 AlaninetRNA ligase 9.0 no no (0.324) no 25 LINJ_36_1000 40S ribosomal protein S18-putative 8.3 no no (0.667) no 26 LINJ_10_0070 Dehydrogenase like protein 8.3 yes 0.820, but prediction of a...”
• Potential selection of antimony and methotrexate cross-resistance in Leishmania infantum circulating strains
  Bernardo, PLoS neglected tropical diseases 2024
  • “...particularly those exhibiting the highest Tm , we identified several key proteins: an alanine-tRNA ligase (A4I013), two ribosomal proteinsthe 60S acidic ribosomal protein P0 and the 40S ribosomal protein S24 (A4I2U1 and A4ID74, respectively), a putative 60S ribosomal protein (L10A), a putative ATP synthase F1 subunit...”
  • “...easy identification. Sb Accession Gene ID Description Tm (C) Tm (C) + Sb - Sb A4I013 LINF 220021600 Alanine tRNA ligase 49.65 40.39 9.26 A4I2U1 LINF 270020500 60S acidic ribosomal protein P0 48.56 43.75 4.81 A4ID74 LINF 360036600 40S ribosomal protein S24 40.36 37.07 3.29 A4HXT8...”

CNAG_05722 alanine-tRNA ligase from Cryptococcus neoformans var. grubii H99
36% identity, 85% coverage

• Characterization of Lipids and Proteins Associated to the Cell Wall of the Acapsular Mutant Cryptococcus neoformans Cap 67
  Longo, The Journal of eukaryotic microbiology 2015
  • “...HcPb CNAG_06026 aspartateaminotransferase Pb HcPbSc CNAG_06088 aspartateaminotransferase, mitchondrial - - CNAG_00136 ubiquitin-activatingenzyme E1 - Sc CNAG_05722 alanine-tRNAligase Sc Sc CNAG_04906 26S protease regulatory subunit 10B - - CNAG_05886 ubiquitin-conjugatingenzyme E2 Pb - CNAG_06755 threonine-tRNAligase - Sc Carbohydratemetabolism CNAG_00061 citratesynthase, mitochondrial Ca CnHcPbSc CNAG_00937 aconitatehydratase, mitochondrial Ca...”

1yfrA / O67323 Crystal structure of alanyl-tRNA synthetase in complex with atp and magnesium (see paper)
54% identity, 50% coverage

• Ligands: magnesium ion; adenosine-5'-triphosphate (1yfrA)

SYAM_HUMAN / Q5JTZ9 Alanine--tRNA ligase, mitochondrial; Alanyl-tRNA synthetase; AlaRS; Protein lactyltransferase AARS2; EC 6.1.1.7; EC 6.-.-.- from Homo sapiens (Human) (see 3 papers)
Q5JTZ9 alanine-tRNA ligase (EC 6.1.1.7) from Homo sapiens (see 3 papers)
NP_065796 alanine--tRNA ligase, mitochondrial from Homo sapiens
36% identity, 87% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain (PubMed:21549344). In presence of high levels of lactate, also acts as a protein lactyltransferase that mediates lactylation of lysine residues in target proteins, such as CGAS (PubMed:39322678). Acts as an inhibitor of cGAS/STING signaling by catalyzing lactylation of CGAS, preventing the formation of liquid-like droplets in which CGAS is activated (PubMed:39322678).
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  catalytic activity: (S)-lactate + ATP + H(+) = (S)-lactoyl-AMP + diphosphate (RHEA:80271)
  catalytic activity: (S)-lactoyl-AMP + L-lysyl-[protein] = N(6)-[(S)-lactoyl]-L- lysyl-[protein] + AMP + 2 H(+) (RHEA:80275)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Monomer.
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...(NP_417177); G. lamblia , Giardia lamblia (XP_001704452); H. sapiens , Homo sapiens (HsAlaRS1, BAA06808; HsAlaRS2, NP_065796); M. jannaschii , Methanocaldococcus jannaschii (NP_247543); M. thermautotrophicus , Methanothermobacter thermautotrophicus (NP_276794); T. thermophilus , Thermus thermophilus (YP_145097); T. vaginalis , Trichomonas vaginalis (AAT95880.1). DISCUSSION As aaRSs are likely to...”
• Mitochondria-derived vesicles and their potential roles in kidney stone disease.
  Chaiyarit, Journal of translational medicine 2023
  • “...(Adenosine diphosphoribose pyrophosphatase) (ADPR-PPase) (Nucleoside diphosphate-linked moiety X motif 9) (Nudix motif 9) 30 AARS2 Q5JTZ9 AlaninetRNA ligase, mitochondrial (EC 6.1.1.7) (Alanyl-tRNA synthetase) (AlaRS) 31 AARS2 Q5JTZ9 AlaninetRNA ligase, mitochondrial 32 ALDH1B1 P30837 Aldehyde dehydrogenase X, mitochondrial (EC 1.2.1.3) (Aldehyde dehydrogenase 5) (Aldehyde dehydrogenase family 1...”
• A specific selenium-chelating peptide isolated from the protein hydrolysate of Grifola frondosa
  Xiong, RSC advances 2021
  • “...= Homo sapiens GN = AMOT PE = 1 SV = 1 1084 1.253906 0.00667 Q5JTZ9 Alanine-tRNA ligase, mitochondrial OS = Homo sapiens GN = AARS2 PE = 1 SV = 1 985 1.252551 0.0296 Q15642 Cdc42-interacting protein 4 OS = Homo sapiens GN = TRIP10...”
• Alendronate-induced Perturbation of the Bone Proteome and Microenvironmental Pathophysiology.
  Kim, International journal of medical sciences 2021
  • “...isomerase-like 3 (PPIase) 0.8257 0.1129 0.1055 0.0408 P00439 PAH Phenylalanine-4-hydroxylase (PAH) 0.8024 0.0475 0.1114 0.0206 Q5JTZ9 AARS2 Alanine--tRNA ligase, mitochondrial 0.7071 0.0877 0.0325 0.0118 Q9UKN8 GTF3C4 General transcription factor 3C polypeptide 4 0.6861 0.0038 0.1761 0.0055 Q92747 ARPC1A Actin-related protein 2/3 complex subunit 1A (SOP2-like protein)...”
• Progesterone at high doses reduces the growth of U87 and A172 glioblastoma cells: Proteomic changes regarding metabolism and immunity
  Altinoz, Cancer medicine 2020
  • “...5102 P15531 NDKA Nucleoside diphosphate kinase A 4519 Q9UJZ1 STML2 Stomatinlike protein 2, mitochondrial 3603 Q5JTZ9 SYAM AlaninetRNA ligase, mitochondrial Downregulated in 100M P4 7604 P26641 EF1G Elongation factor 1gamma 6802 P15311 EZRI Ezrin 7604 Q9UQ80 PA2G4 Proliferationassociated protein 2G4 6706 P49368 TCPG Tcomplex protein 1...”
• The G3-U70-independent tRNA recognition by human mitochondrial alanyl-tRNA synthetase.
  Zeng, Nucleic acids research 2019
  • “...hmtRNA Ala recognition mechanism by human mitochondrial AlaRS (hmtAlaRS, encoded by AARS2 , Uniprot No. Q5JTZ9), which has not been reported. Figure 1. Cloverleaf structure of Escherichia coli tRNA Ala (UGC) and hmtRNA Ala with the third base pair of each tRNA indicated. Sequences were obtained...”
• Global analysis of ginsenoside Rg1 protective effects in β-amyloid-treated neuronal cells.
  Shim, Journal of ginseng research 2017
  • “...Histone H2A type 1-B/E 0.64 P84103-2 SRSF3 Isoform 2 of serine/arginine-rich splicing factor 3 0.64 Q5JTZ9 AARS2 Alanine-tRNA ligase, mitochondrial 0.64 P08621-2 SNRNP70 Isoform 2 of U1 small nuclear ribonucleoprotein 70 kDa 0.65 P61086-2 UBE2K Isoform 2 of ubiquitin-conjugating enzyme E2 K 0.65 P62314 SNRPD1 Small...”
• Spiro[pyrrolidine-3, 3´-oxindole] as potent anti-breast cancer compounds: Their design, synthesis, biological evaluation and cellular target identification.
  Hati, Scientific reports 2016
  • “...2 Structural 3 Q9P2E9 Ribosome-binding protein 1 Receptor 4 Q08J23 tRNA (cytosine (34)-C(5))-methyltransferase Enzyme 5 Q5JTZ9 AlaninetRNA ligase, mitochondrial Enzyme 6 Q13423 NAD(P) transhydrogenase, mitochondrial Enzyme 7 Q9NQC3 Reticulon-4 Growth Factor...”
• Proteomic analysis reveals that the protective effects of ginsenoside Rb1 are associated with the actin cytoskeleton in β-amyloid-treated neuronal cells.
  Hwang, Journal of ginseng research 2016
• More

PF3D7_1367700 alanine--tRNA ligase from Plasmodium falciparum 3D7
32% identity, 61% coverage

• Reaction hijacking inhibition of Plasmodium falciparum asparagine tRNA synthetase
  Xie, Nature communications 2024
  • “...AsnRS, Pf GDH3 and Pf NT4. We also modulated the level of cytoplasmic Pf AlaRS (PF3D7_1367700) and Pf GlyRS (PF3D7_1420400), given that we observed production of a low level of adducts of OSM-S-106 with these amino acids. OSM-S-106 contains a sulfonamide group that is predicted to...”
  • “...Conditional knockdown (cKD) P. falciparum lines were generated for the cytosolic AsnRS (PF3D7_0211800), cytosolic AlaRS (PF3D7_1367700), cytosolic GlyRS (GlyRS; PF3D7_1420400), Pf NT4 (PF3D7_0103200), P. falciparum glutamate dehydrogenase3 (GDH3; PF3D7_0802000), and P. falciparum carbonic anhydrase (CA, PF3D7_1140000) by fusing the coding sequences and non-coding RNA aptamer sequences...”
• Reaction hijacking inhibition of Plasmodium falciparum asparagine tRNA synthetase
  Tilley, 2023
• Cytoplasmic isoleucyl tRNA synthetase as an attractive multistage antimalarial drug target
  Istvan, Science translational medicine 2023
  • “...or apicoplast), and a few are dual-targeted to both the cytoplasm and apicoplast (e.g. PfARS (PF3D7_1367700)) ( 6 ). Inhibitors to approximately one dozen of these enzymes have been reported ( 7 ). Drug-like, submicromolar compounds that have been identified include cladasporin (cKRS; c for cytoplasmic,...”
• Widespread occurrence of lysine methylation in Plasmodium falciparum proteins at asexual blood stages
  Kaur, Scientific reports 2016
  • “...protein, unknown function K12(Methyl); K26(Methyl) IP ENILEILDEEk PF3D7_1366400 rhoptry protein RHOP148 (RHOP148) K11(Trimethyl) HILIC ETnFYYEnGGQIYDTGIIQNDNMkFQVLNVQK PF3D7_1367700 alaninetRNA ligase (AlaRS) K24(Trimethyl) IP YQqSNDTYkQLHELLEK PF3D7_1372500 stevor, pseudogene K9(Methyl) HILIC SSLPGSIqk PF3D7_1373400 rifin (RIF) K9(Dimethyl) IP FcLTQNGSAGGGGSGnASGSSGDcGGGNSDSSLCEPWk PF3D7_1373500 erythrocyte membrane protein 1, PfEMP1 (VAR) K38(Trimethyl) HILIC IHIFLNnENMDELIkNNILELSFGLHFGWAIEGAIGSSYK PF3D7_1404600.2 adenylyl...”
• Genome-wide transcriptome profiling reveals functional networks involving the Plasmodium falciparum drug resistance transporters PfCRT and PfMDR1
  Adjalley, BMC genomics 2015
  • “...putative PF3D7_1454400 aminopeptidase P PF3D7_1126000 threonine--tRNA ligase (ThrRS) PF3D7_1332800 translation initiation factor 6, putative Translation PF3D7_1367700 alanine--tRNA ligase (AlaRS) PF3D7_1445100 histidine--tRNA ligase, putative PF3D7_1204300 eukaryotic translation initiation factor 5A (EIF5A) PF3D7_0422500 pre-mRNA-splicing helicase BRR2, putative (BRR2) RNA metabolism PF3D7_0623900 ribonuclease H2 subunit A, putative PF3D7_1421400 DNA-directed...”

SYAM_MOUSE / Q14CH7 Alanine--tRNA ligase, mitochondrial; Alanyl-tRNA synthetase; AlaRS; Protein lactyltransferase AARS2; EC 6.1.1.7; EC 6.-.-.- from Mus musculus (Mouse) (see paper)
36% identity, 88% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain (By similarity). In presence of high levels of lactate, also acts as a protein lactyltransferase that mediates lactylation of lysine residues in target proteins, such as CGAS (PubMed:39322678). Acts as an inhibitor of cGAS/STING signaling by catalyzing lactylation of CGAS, preventing the formation of liquid-like droplets in which CGAS is activated (PubMed:39322678).
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  catalytic activity: (S)-lactate + ATP + H(+) = (S)-lactoyl-AMP + diphosphate (RHEA:80271)
  catalytic activity: (S)-lactoyl-AMP + L-lysyl-[protein] = N(6)-[(S)-lactoyl]-L- lysyl-[protein] + AMP + 2 H(+) (RHEA:80275)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Monomer.
• NEAT1 inhibits the angiogenic activity of cerebral arterial endothelial cells by inducing the M1 polarization of microglia through the AMPK signaling pathway.
  Chen, Cellular & molecular biology letters 2024
  • “...2.71 O35955 Psmb10 Proteasome subunit beta type-10 2.65 Q9DBL2 Gdap2 Ganglioside-induced differentiation-associated protein 2 2.60 Q14CH7 Aars2 AlaninetRNA ligase, mitochondrial 2.60 Q91VT4 Cbr4 3-Oxoacyl-[acyl-carrier-protein] reductase 2.60 Q8K4R9 Dlgap5 Disks large-associated protein 5 2.47 Q8CC86 Naprt Nicotinate phosphoribosyltransferase 2.43 Q8K2F8 Lsm14a Protein LSM14 homolog A 2.41 Q5SRY7...”
• The G3-U70-independent tRNA recognition by human mitochondrial alanyl-tRNA synthetase.
  Zeng, Nucleic acids research 2019
  • “...method, the molecular masses of mature mouse mtAlaRS (mmtAlaRS, encoded by Aars2 , Uniprot No. Q14CH7) (Ser 26 -Leu 980 ) with a C-terminal His 6 -tag (calculated molecular mass of 107 kDa) and E. coli AlaRS ( Ec AlaRS, Uniprot No. P00957, calculated molecular mass...”

MCJ_003040 Alanyl-tRNA synthetase from Mycoplasma conjunctivae HRC/581
37% identity, 81% coverage

• Comparative genomics of Mycoplasma: analysis of conserved essential genes and diversity of the pan-genome
  Liu, PloS one 2012
  • “...- hypothetical protein MC Lineage MCJ_005740 525.955 9.30% COG1196D putative ABC transporter ATP-binding protein P MCJ_003040 547.097 7.90% COG0013J alanyl-tRNA synthetase MCJ_007160 227.357 8.10% COG2176L DNA polymerase III PolC MCJ_002410 488.408 7.20% COG4608E oligopeptide ABC transporter ATP-binding protein MCJ_000340 316.719 5.10% COG0556L excinuclease ABC subunit B...”

MPN418 alanyl-tRNA synthetase from Mycoplasma pneumoniae M129
31% identity, 96% coverage

• Transcription profiles of the bacterium Mycoplasma pneumoniae grown at different temperatures
  Weiner, Nucleic acids research 2003
  • “...MPN242, MPN254, MPN270, MPN272, MPN296, MPN377, MPN388, MPN418, MPN482, MPN495, MPN605) (20), which were identi(R)ed after the original publication appeared,...”
  • “...11 of the 12 new genes. The transcription signal for MPN418 (hypothetical protein) fell 6310 Nucleic Acids Research, 2003, Vol. 31, No. 21 Figure 2. A series of...”
• Re-annotating the Mycoplasma pneumoniae genome sequence: adding value, function and reading frames
  Dandekar, Nucleic acids research 2000
  • “...PID:g1674117 F11_orf879 MPN073 082.0 PID:g1673736 D09_orf388 MPN418 421.0-422.0 hypothetical 140 aa MPN077 078.0 PID:g1673732 R02_orf469 MPN427 413.0...”

SYAM_CAEEL / Q23122 Alanine--tRNA ligase, mitochondrial; AlaRS B; Alanyl-tRNA synthetase; EC 6.1.1.7 from Caenorhabditis elegans (see paper)
36% identity, 81% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Monomer.

5knnA / P49588 Evolutionary gain of alanine mischarging to non-cognate trnas with a g4:u69 base pair (see paper)
47% identity, 49% coverage

• Ligand: '5'-o-(n-(l-alanyl)-sulfamoyl)adenosine (5knnA)

SYAM_DROME / Q9VRJ1 Alanine--tRNA ligase, mitochondrial; Alanyl-tRNA synthetase; AlaRS; EC 6.1.1.7 from Drosophila melanogaster (Fruit fly) (see 2 papers)
Q9VRJ1 alanine-tRNA ligase (EC 6.1.1.7) from Drosophila melanogaster (see paper)
32% identity, 74% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Monomer.

O83980 Alanine--tRNA ligase from Treponema pallidum (strain Nichols)
TP1017 alanyl-tRNA synthetase (alaS) from Treponema pallidum subsp. pallidum str. Nichols
42% identity, 50% coverage

• A dual-specificity aminoacyl-tRNA synthetase in the deep-rooted eukaryote Giardia lamblia
  Bunjun, Proceedings of the National Academy of Sciences of the United States of America 2000
  • “...Thermus aquaticus (sp P74941), and Treponema pallidum (sp O83980). The following amino acid sequences for previously described ProRS proteins were also obtained...”
• Genome scale identification of Treponema pallidum antigens
  McKevitt, Infection and immunity 2005
  • “...TP0412; TP0399; TP0537; TP0047; TP0029; TP1038; TP0368; TP1017; TP0315; TP1040; TP1039; ORF; putative function (gene)a TABLE 2. Rabbit humoral immune response...”

MTH1683 alanyl-tRNA synthetase from Methanothermobacter thermautotrophicus str. Delta H
27% identity, 96% coverage

• An aminoacyl-tRNA synthetase:elongation factor complex for substrate channeling in archaeal translation
  Hausmann, Nucleic acids research 2007
  • “...previously described ( 15 ). C-terminal His 6 tagged fusion derivatives of EF-1 and AlaRS (MTH1683) were prepared by inserting the corresponding PCR amplified genes into pET11a and pET33b vectors, respectively. For the His 6 -EF-1 construct, forward primer 5-CATATGGCTAAAGAAAAAGAACACA TGA-3 and reverse primer 5-TGCTCTTCCGCATTTTGCTGGTACGAGGTCTATG-3 were...”
  • “...EF-1. The fourth category was composed of proteins involved in translation, LeuRS (MTH1508) and AlaRS (MTH1683), which were each identified once in the screen ( Table 2 ). To gain insight into possible links between EFs and other cellular components involved in translation, associations between EF-1...”

3wqyA / O28029 Crystal structure of archaeoglobus fulgidus alanyl-tRNA synthetase in complex with wild-type tRNA(ala) having g3.U70 (see paper)
29% identity, 96% coverage

• Ligands: rna; '5'-o-(n-(l-alanyl)-sulfamoyl)adenosine (3wqyA)

SYA_ARCFU / O28029 Alanine--tRNA ligase; Alanyl-tRNA synthetase; AlaRS; EC 6.1.1.7 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
O28029 alanine-tRNA ligase (EC 6.1.1.7) from Archaeoglobus fulgidus (see paper)
WP_010879744 alanine--tRNA ligase from Archaeoglobus fulgidus DSM 4304
29% identity, 96% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Incorrectly charged aminoacyl-tRNA(Ala) is also edited in situ by the editing domain.
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Homodimer.
• A dual-specificity aminoacyl-tRNA synthetase in the deep-rooted eukaryote Giardia lamblia
  Bunjun, Proceedings of the National Academy of Sciences of the United States of America 2000
  • “...thaliana (sp P36428), Archaeoglobus fulgidus (sp O28029), Bacillus subtilis (sp O34526), Borrelia burgdorferi (sp O51238), Caenorhabditis elegans (gb...”
• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(NP_001596); Dmel , Drosophila melanogaster (NP_523511); Scer , Saccharomyces cerevisiae (EDV10897); Aful , Archaeoglobus fulgidus (WP_010879744); Phor , Pyrococcus horikoshii (WP_010884393); whole sequences were aligned by ClustalW [ 32 ] and ESPript 3 [ 33 ]. K73 in E. coli AlaRS is shown with the gray...”

BB0220 alanyl-tRNA synthetase (alaS) from Borrelia burgdorferi B31
37% identity, 50% coverage

• A manganese transporter, BB0219 (BmtA), is required for virulence by the Lyme disease spirochete, Borrelia burgdorferi
  Ouyang, Proceedings of the National Academy of Sciences of the United States of America 2009
  • “...thwarting Lyme disease. Fig. 1. bb0219 is cotranscribed with bb0220 - bb0224. (A) Schematic representation of the putative bb0219 - bb0224 operon in Bb. (B)...”
  • “...Within a 6-Gene Operon. In the Bb genome, bb0219, bb0220, bb0221, bb0222, bb0223, and bb0224 are oriented in the same direction (Fig. 1A). In this region,...”
• Borrelia burgdorferi adhesins identified using in vivo phage display
  Antonara, Molecular microbiology 2007
  • “...and tissue of independent isolates BB0056 BB0057 BB0147 BB0220 BB0329 BB0337 BB0388 BB0540 BB0630 BB0681 BB0805 BBA34 BBB23 BBG21 BBG29 Phosphoglycerate kinase...”
• Identification of potential virulence determinants by Himar1 transposition of infectious Borrelia burgdorferi B31
  Botkin, Infection and immunity 2006
  • “...glucose-6-phosphate-1-dehydrogenase (BB0222), an alanyl t-RNA synthetase (BB0220), and a putative zinc permease (BB0219). Thus, disruption of BB0221 could...”

HVO_0206 alanyl-tRNA synthetase from Haloferax volcanii DS2
30% identity, 93% coverage

• Archaeal ubiquitin-like SAMP3 is isopeptide-linked to proteins via a UbaA-dependent mechanism
  Miranda, Molecular & cellular proteomics : MCP 2014
  • “...292656231 292656305 292656456 292493996 292494257 HVO_0078 HVO_0206 HVO_0337 HVO_0359e HVO_0455 HVO_0736 HVO_0835 HVO_0860 HVO_0966f HVO_1081 HVO_1289 HVO_1495...”
  • “...on ribosomal S24e protein (HVO_1896), alanine-tRNA ligase (HVO_0206), and translation elongation factor EF-1 (HVO_0359) homologs, the latter two of which were...”

SYA_METJA / Q57984 Alanine--tRNA ligase; Alanyl-tRNA synthetase; AlaRS; EC 6.1.1.7 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
NP_247543 alanyl-tRNA synthetase (alaS) from Methanocaldococcus jannaschii DSM 2661
26% identity, 95% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala) (By similarity). Also functions in trans to edit the amino acid moiety from incorrectly charged Ser-tRNA(Ala), and maybe also from Gly-tRNA(Ala).
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
• Trans-editing of mischarged tRNAs
  Ahel, Proceedings of the National Academy of Sciences of the United States of America 2003
  • “...M. barkeri AlaRS (ZP00077929), M. jannaschii AlaRS (Q57984), Thermoplasma volcanium ThrRS (Q978W0), Bacillus halodurans ThrRS (Q9K866), T. maritima ThrRS...”
  • “...the E. coli AlaRS enzymes. M.jan, M. jannaschii (Q57984); P.aby, Pyrococcus abyssi (Q9UY36); E.col, E. coli (Q8XE27); B.sub, B. subtilis (P18256); M.bar, M....”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...(XP_001704452); H. sapiens , Homo sapiens (HsAlaRS1, BAA06808; HsAlaRS2, NP_065796); M. jannaschii , Methanocaldococcus jannaschii (NP_247543); M. thermautotrophicus , Methanothermobacter thermautotrophicus (NP_276794); T. thermophilus , Thermus thermophilus (YP_145097); T. vaginalis , Trichomonas vaginalis (AAT95880.1). DISCUSSION As aaRSs are likely to be one of the most ancient...”

SYA_PYRHO / O58035 Alanine--tRNA ligase; Alanyl-tRNA synthetase; AlaRS; EC 6.1.1.7 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
O58035 alanine-tRNA ligase (EC 6.1.1.7) from Pyrococcus horikoshii (see paper)
WP_010884393 alanine--tRNA ligase from Pyrococcus horikoshii
26% identity, 94% coverage

• function: Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Edits incorrectly charged Ser-tRNA(Ala). Incorrectly charged amino acids occur because the of inherent physicochemical limitations on discrimination between closely related amino acids (Gly and Ser) in the charging step.
  catalytic activity: tRNA(Ala) + L-alanine + ATP = L-alanyl-tRNA(Ala) + AMP + diphosphate (RHEA:12540)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Homodimer.
• The G3-U70-independent tRNA recognition by human mitochondrial alanyl-tRNA synthetase
  Zeng, Nucleic acids research 2019
  • “...AlaRS, Thermus thermophilus AlaRS (Uniprot No. P74941) and Ph AlaRS, Pyrococcus horikoshii AlaRS (Uniprot No. O58035). ( B ) Location and orientation of Arg 631 (Arg 663 inhmtAlaRS)in the structure of the Af AlaRS/tRNA Ala complex (PDB ID: 3WQY). Cyan, aminoacylation domain; Pink, tRNA recognition domain;...”
• A dual-specificity aminoacyl-tRNA synthetase in the deep-rooted eukaryote Giardia lamblia
  Bunjun, Proceedings of the National Academy of Sciences of the United States of America 2000
  • “...(sp O07438), Pyrococcus horikoshii OT3 (sp O58035), Rickettsia prowazekii (sp Q9ZCA4), Saccharomyces cerevisiae (sp P40825), Sulfolobus solfataricus (sp...”
• Lysine Acetylation Regulates Alanyl-tRNA Synthetase Activity in Escherichia coli
  Umehara, Genes 2018
  • “...(NP_523511); Scer , Saccharomyces cerevisiae (EDV10897); Aful , Archaeoglobus fulgidus (WP_010879744); Phor , Pyrococcus horikoshii (WP_010884393); whole sequences were aligned by ClustalW [ 32 ] and ESPript 3 [ 33 ]. K73 in E. coli AlaRS is shown with the gray box and lies on the...”
• Crystal structure of alanyl-tRNA synthetase editing-domain homolog (PH0574) from a hyperthermophile, Pyrococcus horikoshii OT3 at 1.45 A resolution.
  Ishijima, Proteins 2006 (PubMed)
  • GeneRIF: Ribbon diagram consists of a large domain and a small domain. The Zn2+ ion is located between the two domains.

TK1567 alanyl-tRNA synthetase from Thermococcus kodakaraensis KOD1
28% identity, 94% coverage

• Indole-3-glycerol-phosphate synthase is recognized by a cold-inducible group II chaperonin in Thermococcus kodakarensis
  Gao, Applied and environmental microbiology 2012
  • “...fold(s)a Scoreb TK1292 TK1637 TK1177 TK0781 TK2202 TK0459 TK0298 TK0566 TK1567 TK0348 87.6 29.3 38.2 38.3 51.3 43.5 49.3 96.2 105.1 29.7 5.2 4.9 5.4 5.5 8.7 7.1...”

2zzeA / O58035 Crystal structure of alanyl-tRNA synthetase without oligomerization domain in lysine-methylated form (see paper)
26% identity, 79% coverage

• Ligand: zinc ion (2zzeA)

MNEG_4651 alanyl-tRNA synthetase from Monoraphidium neglectum
59% identity, 21% coverage

• Quantitative Proteomics of Chromochloris zofingiensis Reveals the Key Proteins Involved in Cell Growth and Bioactive Compound Biosynthesis
  Qiu, Plants (Basel, Switzerland) 2022
  • “...vs. G Regulation p -Value CHLREDRAFT_38643 A8J0R6 Alanine-tRNA ligase (Fragment) 0.73 up 7.29 10 5 MNEG_4651 A0A0D2L8Z9 Alanyl-tRNA synthetase 0.64 up 3.26 10 5 CHLRE_06g279150v5 A8J1X8 Aspartyl-tRNA synthetase 0.62 up 3.96 10 5 ATF1 A8IZE7 Glutamine-fructose6-phosphate transaminase (isomerizing) 0.59 up 1.99 10 3 HemA Q9FPR7 Glutamyl-tRNA...”

Q971J4 Alanine--tRNA ligase from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
27% identity, 80% coverage

• Sample Stability and Protein Composition of Saliva: Implications for Its Use as a Diagnostic Fluid.
  Esser, Biomarker insights 2008
  • “...L5 # Q8CRH2 Micro organism 20236 Acetyl-CoA acetyltransferase # P45359 Energy/metabolism 41241 Alanyl-tRNA synthetase # Q971J4 Micro organism 103675 Alpha-2-macroglobulin precursor P01023 Protein Degradation/Inhibitor 163278 Bact.l/permeability-increasing protein- like 1 prec. Q8N4F0 Transport 49172 Beta crystallin B1 (Beta-35) # P53674 Cell Growth/Differentiation 27892 Carbonyl reductase [NADPH] 1...”

SCO7600 alanyl tRNA synthetase from Streptomyces coelicolor A3(2)
34% identity, 47% coverage

• The WblC/WhiB7 Transcription Factor Controls Intrinsic Resistance to Translation-Targeting Antibiotics by Altering Ribosome Composition
  Lee, mBio 2020
  • “...suggest that the requirements of those genes may differ during antibiotic stress. For instance, alaS2 (SCO7600) and alaS (SCO1501) are paralogous genes encoding Ala-tRNA synthetases, and expression of the former is dependent on WblC and tetracycline but expression of the latter is not ( Fig.S5 and...”
  • “...in bold text. Locus tags of each gene are shown in parentheses as follows: alaS2 (SCO7600), alaS (SCO1501), trpS (SCO3334), trpS2 (SCO4839), thrS2 (SCO3778), thrS (SCO1531), lrm (SCO6089), ksgA (SCO3149), arfB (SCO4278), prfB (SCO2972), tuf3 (SCO1321), tuf1 (SCO4662), fusB (SCO6589), tetM (SCO0783), and fusA (SCO4661). Download...”
• Comparative genomics of Streptomyces avermitilis, Streptomyces cattleya, Streptomyces maritimus and Kitasatospora aureofaciens using a Streptomyces coelicolor microarray system
  Hsiao, Antonie van Leeuwenhoek 2008
  • “...SCO5800 (Bentley etal. 2002 ). The regions between SCO1100 and SCO2050 and between SCO5800 and SCO7600 are also quite well conserved between the Streptomyces studied here as well as being syntenous between the S. coelicolor and S. avermitilis genome sequences. However they are not present when...”
  • “...dramatically in the terminal region. The regions from the left terminus to SCO1100 and from SCO7600 to the right terminus show much higher gene divergence that the rest of the chromosome. This agrees with the results for the S. ambofaciens sequencing studies of that species terminal...”

SLIV_01315 alanine--tRNA ligase-related protein from Streptomyces lividans TK24
34% identity, 47% coverage

• Extensive Reannotation of the Genome of the Model Streptomycete Streptomyces lividans TK24 Based on Transcriptome and Proteome Information
  Droste, Frontiers in microbiology 2021
  • “...bold. Attenuator Affected transcripts Description Leader peptide Sequence position alaL ( SLIV_01313 ) alaS ( SLIV_01315 ) Alanyl-tRNA synthetase MNVIGRNIF A T A R A TSSPV AAA * 270,351 ilvL ( SLIV_10947 ) ilvBHC operon Biosynthesis of Val, Leu, Ile MRTR ILVL GKRVG* 2,517,781 thrL (...”

GL50803_96460, XP_001704452 Alanyl-tRNA synthetase from Giardia intestinalis
25% identity, 76% coverage

• A Detailed Gene Expression Map of Giardia Encystation
  Rojas-López, Genes 2021
  • “...of 9 tRNA synthetases (arginyl-tRNA synthetase, GL50803_10521, glutamine-tRNA synthetase, GL50803_9348, valine-tRNA ligase, GL50803_35428, alanyl-tRNA synthetase, GL50803_96460, seryl-tRNA synthetase, GL50803_101501, phenylalanyl-tRNA synthetase beta chain GL50803_101501, phenylalanyl-tRNA synthetase alpha chain, GL50803_12162, lysyl-tRNA synthetase, GL50803_16766, histidyl-tRNA synthetase, GL50803_22808, and methionyl-tRNA synthetase, GL50803_22204). The effect is also seen on translation...”
• Alanyl-tRNA synthetase genes of Vanderwaltozyma polyspora arose from duplication of a dual-functional predecessor of mitochondrial origin
  Chang, Nucleic acids research 2012
  • “...(DmAlaRS1, NP_523511.2; DmAlaRS2, NP_523932.2); E. coli , Escherichia coli (NP_417177); G. lamblia , Giardia lamblia (XP_001704452); H. sapiens , Homo sapiens (HsAlaRS1, BAA06808; HsAlaRS2, NP_065796); M. jannaschii , Methanocaldococcus jannaschii (NP_247543); M. thermautotrophicus , Methanothermobacter thermautotrophicus (NP_276794); T. thermophilus , Thermus thermophilus (YP_145097); T. vaginalis ,...”

CSP5_0404 alanine--tRNA ligase from Cuniculiplasma divulgatum
25% identity, 85% coverage

• Proteome Cold-Shock Response in the Extremely Acidophilic Archaeon, Cuniculiplasma divulgatum
  Bargiela, Microorganisms 2020
  • “...(CSP5_0816, 1.19), leucyl-tRNA synthetase (CSP5_1329, 1.18), phenylalanyl-tRNA synthetase subunit beta (CSP5_1324, 1.14) and alanine-tRNA ligase (CSP5_0404, 1.49-fold). These observations imply the importance of proteins involved in amino acids metabolism, translation, and ribosomal biogenesis for cold shock resistance of C. divulgatum cells. The shock response to the...”

NP_001344929 alanine--tRNA ligase, mitochondrial isoform 2 from Mus musculus
29% identity, 61% coverage

• Editing activity for eliminating mischarged tRNAs is essential in mammalian mitochondria.
  Hilander, Nucleic acids research 2018
  • GeneRIF: Editing-deficient mitochondrial alanyl-tRNA synthetase (mtAlaRS) mice, bearing either a mild or a severe mtAlaRS editing mutation, and indicate that editing of mischarged tRNAs by alanyl-tRNA synthetase is an essential protein quality control mechanism in mammalian mitochondria.

D2S292 Threonyl/alanyl tRNA synthetase SAD from Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / JCM 9101 / NCIMB 13204 / VKM B-1734 / 4k)
29% identity, 42% coverage

• Kelch-like homologue 9 mutation is associated with an early onset autosomal dominant distal myopathy.
  Cirak, Brain : a journal of neurology 2010
  • “...we used the following polymorphic microsatellite markers: locus 2p12-p14 (Miyoshi myopathy and Welander myopathy): D2S303, D2S292, D2S291, D2S169 and D2S329; locus 2q31-q33 (Udd myopathy): D2S138, D2S148, D2S300, D2S385, D2S324, D2S2310, D2S1391, D2S152, D2S389 and D2S315; Locus 9p12-p13 (Nonaka myopathy): D9S43, D9S248, D9S165 and D9S50; and locus...”
• Identification of the first gene locus (SSNS1) for steroid-sensitive nephrotic syndrome on chromosome 2p.
  Ruf, Journal of the American Society of Nephrology : JASN 2003 (PubMed)

HVO_2717 alanyl-tRNA synthetase from Haloferax volcanii DS2
30% identity, 43% coverage

• Screening of a Haloferax volcanii Transposon Library Reveals Novel Motility and Adhesion Mutants
  Legerme, Life (Basel, Switzerland) 2016
  • “...Probable oxidoreductase # hvo_2512 {2378600} Membrane protein [MemP1] GatD (glutamyl-tRNA(Gln) amidotransferase subunit D) Hypothetical protein hvo_2717 {2562834} AlaS2 (alanyl-tRNA synthetase) Acd5 (Acyl-CoA dehydrogenase) Cro/C1 family transcription regulator # hvo_2734 {2580223} GNAT acetyltransferase [GnaT1] # Hypothetical protein Hypothetical protein Annotations from NCBI unless stated otherwise. {} transposon...”

PA2106 hypothetical protein from Pseudomonas aeruginosa PAO1
Q9I209 Alanyl-transfer RNA synthetases family profile domain-containing protein from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
29% identity, 26% coverage

• The Pseudomonas aeruginosa RpoH (σ³²) Regulon and Its Role in Essential Cellular Functions, Starvation Survival, and Antibiotic Tolerance
  Williamson, International journal of molecular sciences 2023
  • “...Molybdopterin biosynthesis MoeB protein 3.3 2.7 10 3 PA2104 Cysteine synthase 3.2 1.9 10 4 PA2106 Metal-dependent hydrolase, contains AlaS domain; alanyl-tRNA synthetase 2.2 2.2 10 3 PA2275 Alcohol dehydrogenase 7.2 2.0 10 4 PA2481 Cytochrome c oxidase, cbb3-type, subunit p 2.1 1.2 10 2 PA2559...”
• Investigating the predictability of essential genes across distantly related organisms using an integrative approach
  Deng, Nucleic acids research 2011
  • “...P. aeruginosa . It is non-essential in P. aeruginosa probably because it has a paralog (PA2106) that carries out the same function. Considering all these limitations, a group of researchers reached a disappointing conclusion that gene conservation among bacteria does not necessarily indicate that essentiality in...”
• A cystic fibrosis epidemic strain of Pseudomonas aeruginosa displays enhanced virulence and antimicrobial resistance
  Salunkhe, Journal of bacteriology 2005
  • “...of unknown function (PA0980 to PA0985, PA2100 to PA2106, PA2218 to PA2228, PA2730 to PA2736, and PA3500 to PA3513). PCR assays targeting PA0203, PA0641,...”
• Complete sequence and organization of pBtoxis, the toxin-coding plasmid of Bacillus thuringiensis subsp. israelensis
  Berry, Applied and environmental microbiology 2002
  • “...to part of Pseudomonas aeruginosa hypothetical protein PA2106 TR:Q9I209 (AE004638) (30.95 in 252 aa) and Homo sapiens alanyl-tRNA synthetase AarS SW:SYA_HUMAN...”
• Proteome-wide identification of druggable targets and inhibitors for multidrug-resistant <i>Pseudomonas aeruginosa</i> using an integrative subtractive proteomics and virtual screening approach
  Vemula, Heliyon 2025

TON_0899 alanyl-tRNA synthetase-related protein from Thermococcus onnurineus NA1
29% identity, 25% coverage

• Proteomic Insights into Sulfur Metabolism in the Hydrogen-Producing Hyperthermophilic Archaeon Thermococcus onnurineus NA1
  Moon, International journal of molecular sciences 2015
  • “...Y Y Y Leucyl-tRNA synthetase TON_0141 Y Y 1.26 Y Y 0.78 Alanyl-tRNA synthetase-related protein TON_0899 Y Y Y Y Y Y Isoleucyl-tRNA synthetase TON_1803 1.82 1.51 2.80 1.00 0.99 1.00 Elongation factor 1- TON_1866 Y Y Y Y Y Y Translation initiation factor IF-2 subunit...”

Dshi_2313 Threonyl/alanyl tRNA synthetase SAD from Dinoroseobacter shibae DFL 12
32% identity, 23% coverage

• Transposon mutagenesis identified chromosomal and plasmid genes essential for adaptation of the marine bacterium Dinoroseobacter shibae to anaerobic conditions
  Ebert, Journal of bacteriology 2013
  • “...encodes a transposase of an IS4 element. The gene Dshi_2313 encodes an HsdR family type I DNase as part of a restriction-modification system (43). In...”

WP_011022008 alanyl-tRNA editing protein AlaXM from Methanosarcina acetivorans C2A
33% identity, 22% coverage

• Natural homolog of tRNA synthetase editing domain rescues conditional lethality caused by mistranslation.
  Chong, The Journal of biological chemistry 2008
  • GeneRIF: Deacylates tRNA(Ala) mischarged with Ser (AlaXp activity)

ALAXM_METMA / Q8Q0A4 Alanyl-tRNA editing protein AlaX-M; AlaX-M; AlaXp; Alanyl-tRNA deacylase AlaX-M from Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia) (see 2 papers)
34% identity, 23% coverage

• function: Functions in trans to edit the amino acid moiety from mischarged Ser-tRNA(Ala). Recognition depends, at least in part, on the acceptor stem of tRNA(Ala).
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)

ALAXM_METBF / Q46AR9 Alanyl-tRNA editing protein AlaX-M; AlaX-M; Alanyl-tRNA deacylase AlaX-M from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
33% identity, 24% coverage

• function: Functions in trans to edit the amino acid moiety from incorrectly charged Ser-tRNA(Ala) or Gly-tRNA(Ala). Has no activity on incorrectly charged Ser-tRNA(Thr), nor on correctly charged Ala- tRNA(Ala) or Ser-tRNA(Ser).
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)

NEQ211 NEQ211 from Nanoarchaeum equitans Kin4-M
22% identity, 34% coverage

• G:U-Independent RNA Minihelix Aminoacylation by Nanoarchaeum equitans Alanyl-tRNA Synthetase: An Insight into the Evolution of Aminoacyl-tRNA Synthetases
  Arutaki, Journal of molecular evolution 2020
  • “...base pair. Materials and Methods Plasmid Construction The coding sequences for AlaRS- (NEQ547) and AlaRS- (NEQ211) of N. equitans were PCR-amplified from genomic DNA of N. equitans (a gift from Dr. Harald Huber, Universitt Regensburg, Germany) using the pairs of primers 5-CAAAAATTCATATGGTTAAAG-3 and 5-GATAACATGGATCCCGCAAAAAG-3 for AlaRS-,...”
• The genome of Nanoarchaeum equitans: insights into early archaeal evolution and derived parasitism
  Waters, Proceedings of the National Academy of Sciences of the United States of America 2003
  • “...(22). N. equitans alaS1 (NEQ547), N. equitans alaS2 (NEQ211) and Methanococcus jannaschii alaS genes were amplified by PCR from the respective genomic DNA and...”
  • “...NEQ495 NEQ547 NEQ156 NEQ396 NEQ318 NEQ506 NEQ096 NEQ211 *Also split in Methanothermobacter thermautotrophicus. Also split in Methanopyrus kandleri, the...”

FN0527 Alanyl-tRNA synthetase from Fusobacterium nucleatum subsp. nucleatum ATCC 25586
23% identity, 34% coverage

• Evolutionary relationships of Fusobacterium nucleatum based on phylogenetic analysis and comparative genomics
  Mira, BMC evolutionary biology 2004
  • “...618 bp 2137 FN0515 to FN0519 Vibrio cholerae 22 Mixed functions cluster 3044 FN0524 to FN0527 23 LPS synthesis and/or decoration and outer membarne stabilization Includes recA and recX proteins with best match to Caulobacter and Vibrio 29100 FN0538 to FN0548 Haemophilus ducreyi 24 Structural lipoprotein...”

ALAXM_PYRHO / O57848 Alanyl-tRNA editing protein AlaX-M; AlaX-M; Alanyl-tRNA deacylase AlaX-M from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
O57848 aminoacyl-tRNA hydrolase (EC 3.1.1.29) from Pyrococcus horikoshii (see paper)
28% identity, 25% coverage

• function: Functions in trans to edit the amino acid moiety from mischarged charged Gly-tRNA(Ala) and Ser-tRNA(Ala).
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Monomer.

PF0086 partial alanyl-tRNA synthetase matches COOH terminus from Pyrococcus furiosus DSM 3638
28% identity, 25% coverage

• Metals in biology: defining metalloproteomes
  Yannone, Current opinion in biotechnology 2012
  • “...chromatography steps. Using this method, a novel metalloprotein was identified as coordinating a nickel atom (PF0086) while the same polypeptide coordinated a Zn atom when expressed in E. coli [ 3 ]. These data further illustrate the complexities of specific metal incorporation into proteins within cells...”
• A computational framework for proteome-wide pursuit and prediction of metalloproteins using ICP-MS and MS/MS data
  Lancaster, BMC bioinformatics 2011
  • “...the 22 candidate Ni-proteins were very recently taken to purity or partial purity (PF0056 and PF0086) by the metal-directed purification and their assignment was confirmed [ 6 ]. This leaves 15 potential novel Ni-containing proteins on which to carry out further experiments. Table 2 Manually Evaluated...”
  • “...8 PF1500 PRC-barrel-like 8 PF1529 Pyroxidine biosynthesis protein 2YZR 12 PF1401 Peptidyl-prolyl cis-trans isomerase 13 PF0086 Alanyl-tRNA synthetase, class IIc 2E1B Zn 13 PF0615 Hydrogenase expression/formation protein A 3A43 Zn Ni 13 PF1272 LamB/YcsF 1V6T 13 PF1684 Acetylglutamate kinase 2EGX 13 PF1861 Lysyl aminopeptidase 2PE3 Zn...”

Q92KC7 Probable alanyl-tRNA synthetase from Rhizobium meliloti (strain 1021)
29% identity, 25% coverage

• Comparative Proteomic Analysis Revealing ActJ-Regulated Proteins in Sinorhizobium meliloti.
  Albicoro, Journal of proteome research 2023

YP_183397 alanyl-tRNA synthetase-related protein (partial) from Thermococcus kodakaraensis KOD1
28% identity, 25% coverage

• The Proteome and Lipidome of Thermococcus kodakarensis across the Stationary Phase
  Gagen, Archaea (Vancouver, B.C.) 2016
  • “...complex that catalyses transamidation to form Gln-tRNA Gln from misacylated Glu-tRNA Gln [ 11 ] YP_183397 Alanyl-tRNA editing protein AlaX 1.81 0.39 tRNA editing Catalyses hydrolysis of misacylated tRNA Ala [ 12 ] YP_183917 30S ribosomal protein S11 3.41 0.63 Translation Part of the 30S subunit...”
  • “...16 Present No 0, 1, 0 YP_183327 3-Hydroxy-3-methylglutaryl-CoA reductase 13 Absent No 0, 2, 1 YP_183397 Alanyl-tRNA editing protein AlaX 15 Present No 0, 0, 0 YP_183662 Hypothetical protein TK1249 13 Absent No 0, 0, 0 YP_183694 Endonuclease 16 Present No 0, 0, 0 YP_183697 Peptidase...”

A2A4P3 Predicted gene, 27029 from Mus musculus
24% identity, 44% coverage

• Dietary intake of micronized avian eggshell membrane in aged mice reduces circulating inflammatory markers, increases microbiota diversity, and attenuates skeletal muscle aging
  Rønning, Frontiers in nutrition 2023
  • “...related to energy metabolism (mitochondrial pyruvate dehydrogenase isoforms), protein synthesis (amino acid AA-synthesis carrier protein A2A4P3), and myotube development (Nascent polypeptide-associated complex subunit alpha, muscle-specific form, NACAM). 3.3 Effect of ESM supplementation on inflammatory markers We investigated a possible immune modulating effect of ESM on low-grade...”
  • “...several proteins associated with energy metabolism (mitochondrial pyruvate dehydrogenase isoforms), protein synthesis (AA-synthesis carrier protein A2A4P3), and myotube development (Nascent polypeptide-associated complex subunit alpha, muscle-specific form, NACAM). The findings in skeletal muscle coincided with an increased gut microbiota diversity and changed the microbiota composition in old...”

Q9BTE6 Alanyl-tRNA editing protein Aarsd1 from Homo sapiens
NP_001248363 alanyl-tRNA editing protein Aarsd1 from Homo sapiens
24% identity, 44% coverage

• Eukaryotic AlaX provides multiple checkpoints for quality and quantity of aminoacyl-tRNAs in translation.
  Li, Nucleic acids research 2024
  • “...antibody was purchased from Abmart (Shanghai, China). Plasmid construction The genes encoding hAlaX (UniProt No. Q9BTE6), hAlaRS (UniPort No. P49588), and hDTD1 (UniPort No. Q8TEA8) were amplified from cDNA obtained by reverse transcription of total RNA from human HEK293T cells. The genes encoding Sc AlaX (UniProt...”
• Baseline Levels of Circulating Inflammatory Biomarkers Stratify Patients with Vitiligo Who Significantly Repigment after Treatment with Ruxolitinib Cream.
  Howell, JID innovations : skin science from molecules to population health 2023
  • “...P02144 1.323 0.027 0.61 PRTN3 Myeloblastin P24158 1.318 0.016 0.53 AARSD1 Alanyl-tRNA editing protein Aarsd1 Q9BTE6 1.305 0.038 0.64 ADM Adrenomedullin P35318 1.302 0.035 0.63 PXN Paxillin P35318 1.289 0.048 0.71 IL-10 IL-10 P22301 1.287 0.026 0.61 ILKAP Integrin-linked kinase-associated serine/threonine phosphatase 2C Q9H0C8 1.282 0.024...”
• Detection of hypothetical proteins in 10 individual human tumor cell lines.
  Afjehi-Sadat, Biochimica et biophysica acta 2005 (PubMed)
• A Remodeled Hsp90 Molecular Chaperone Ensemble with the Novel Cochaperone Aarsd1 Is Required for Muscle Differentiation.
  Echeverría, Molecular and cellular biology 2016
  • GeneRIF: Aarsd1 inhibits the activity of a paradigmatic Hsp90 client protein.

AASD1_MOUSE / Q3THG9 Alanyl-tRNA editing protein Aarsd1; Alanyl-tRNA deacylase alaX; AlaX; AlaXp-II; Alanyl-tRNA synthetase domain-containing protein 1 from Mus musculus (Mouse) (see paper)
24% identity, 44% coverage

• function: Functions in trans to edit the amino acid moiety from incorrectly charged Ser-tRNA(Ala).
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
• The amyloid peptide β disrupts intercellular junctions and increases endothelial permeability in a NADPH oxidase 1-dependent manner.
  Tarafdar, Redox biology 2022
  • “...0.0249278 Q8CFI0 E3 ubiquitin-protein ligase NEDD4-like Nedd4l 0.0294142 Q6I6G8 E3 ubiquitin-protein ligase HECW2 Hecw2 0.0298136 Q3THG9 Alanyl-tRNA editing protein Aarsd1 Aarsd1 0.0370224 O35226 26S proteasome non-ATPase regulatory subunit 4 Psmd4 0.0413585 P70398 Probable ubiquitin carboxyl-terminal hydrolase FAF-X Usp9x 0.0413649 Q99NB8 Ubiquilin-4 Ubqln4 0.0455887 Q9CZD3 Glycine--tRNA ligase...”

Q5XI97 Alanyl-tRNA editing protein Aarsd1 from Rattus norvegicus
24% identity, 44% coverage

• Alterations in mitochondrial protein glycosylation in myocardial ischaemia reperfusion injury.
  Feng, Biochemistry and biophysics reports 2023
  • “...D3ZIL6 Q6AYS7 P57093 Q5BK81 Q3MIE0 Q9EPB1 Q3KRE0 D4A9W3 Q7TMB9 G3V879 Q499R7 P29418 M0R544 A0A140TAE0 A0A023ILN9 Q5XI97 P11951 Q4QRB4 O88637 D4ADD7 Q5RKI8 D3ZBS2 D4A8Y1 Q64560 A0A0G2K719 M0R5R0 Q7TQ70 D3ZFJ6 Q5M891 D3ZY96 Q6IFZ5 A0A096P6L8 A0A0H2UHP1 G3V928 C0JPT7 G3V640 A0A0G2K777 B0BMY7 B2RZ72 Q6P502 Q923V4 A0A0A0MY09 F7F389 G3V6P7 A0A0G2K0X4 Q4PP99...”
• Proteomic analysis of protein composition of rat hippocampus exposed to morphine for 10 days; comparison with animals after 20 days of morphine withdrawal
  Ujcikova, PloS one 2020
  • “...14 -P24090 Alpha-2-HS-glycoprotein 1.9 0.0005 Extracellular region Organ regeneration, negative regulation of cell growth 15 -Q5XI97 Alanyl-tRNA editing protein Aarsd1 1.8 0.0005 Cytoplasm RNA processing 16 -Q68FQ7 RNA polymerase II-associated protein 3 1.8 0.0094 Cytoplasm RNA processing 17 -Q5HZY2 GTP-binding protein SAR1b 1.7 0.0044 Endoplasmic reticulum,...”
• Preliminary quantitative profile of differential protein expression between rat L6 myoblasts and myotubes by stable isotope labeling with amino acids in cell culture.
  Cui, Proteomics 2009
  • “...Glutamyl-prolyl-tRNA synthetase IPI00421357.2 1.98 0.32 3 Q6TXE9 289352 Hypothetical protein LOC619440 IPI00201819.1 1.64 0.05 2 Q5XI97 619440 IKIP1 protein IPI00199778.1 1.620.05 3 Q5EAJ6 314730 Leucine rich repeat containing 47 (predicted) IPI00359172.1 2.00 0.00 2 362672 Leucyl-tRNA synthetase IPI00363236.2 1.57NA 1 Q5PPJ6 291624 Phenylalanine-tRNA synthetase-like, beta subunit...”

VP1766 putative alanyl-tRNA synthetase from Vibrio parahaemolyticus RIMD 2210633
26% identity, 25% coverage

• Gene Regulatory Network of the Noncoding RNA Qrr5 Involved in the Cytotoxicity of Vibrio parahaemolyticus during Infection
  Zha, Microorganisms 2022
  • “...h post-infection were generally in accordance with those by RNA-Seq. At each post-infection time point, VP1766 , VPA1068 , VP0485 , VP2914 , and VP1665 were up-regulated. Moreover, VP2492 , VP0486 , and VPA0628 were up-regulated at 2 h and down-regulated at 0, 4, and 6...”

BP1497 threonine--tRNA ligase from Bordetella pertussis Tohama I
NP_880233 threonyl-tRNA synthetase from Bordetella pertussis Tohama I
32% identity, 15% coverage

• A gel-free proteomic-based method for the characterization of Bordetella pertussis clinical isolates
  Williamson, Journal of microbiological methods 2012
  • “...Serotype 2 fimbrial subunit P05788 BP1119 fim2 23 E 21 (2) Cell integrity Threonyl-tRNA-synthetase NP_880233 BP1497 thrS 71 C 8 (3) Translation ABC transport protein, ATP-binding component NP_881414 BP2816 metN 40 CM 10 (2) Membrane transport HP BP3441 NP_881967 BP3441 HP 36 M/U 19 (3) HP...”
• A gel-free proteomic-based method for the characterization of Bordetella pertussis clinical isolates
  Williamson, Journal of microbiological methods 2012
  • “...processing Serotype 2 fimbrial subunit P05788 BP1119 fim2 23 E 21 (2) Cell integrity Threonyl-tRNA-synthetase NP_880233 BP1497 thrS 71 C 8 (3) Translation ABC transport protein, ATP-binding component NP_881414 BP2816 metN 40 CM 10 (2) Membrane transport HP BP3441 NP_881967 BP3441 HP 36 M/U 19 (3)...”

BT_0566, BT_RS02775 hypothetical protein from Bacteroides thetaiotaomicron VPI-5482
BT0566 alanyl-tRNA synthetase from Bacteroides thetaiotaomicron VPI-5482
27% identity, 14% coverage

• Iron Deficiency Modulates Metabolic Landscape of Bacteroidetes Promoting Its Resilience during Inflammation
  Lewis, Microbiology spectrum 2023
  • “...05 BT0551 to 52 Asparagine synthase B, glutamate synthase subunit beta 2.96 0.014 BT_RS02775 BT0566, BT_0566 Hypothetical protein 3.4 to 2.6 1E-05 to 0.007 rsxC, BT_RS03050 BT0618 to 22 Electron transport complex subunit rsxc, rnfabcdge type electron transport complex sub D, rnfabcdge type electron transport complex...”
  • “...BT_RS02700 to 05 BT0551 to 52 Asparagine synthase B, glutamate synthase subunit beta 2.96 0.014 BT_RS02775 BT0566, BT_0566 Hypothetical protein 3.4 to 2.6 1E-05 to 0.007 rsxC, BT_RS03050 BT0618 to 22 Electron transport complex subunit rsxc, rnfabcdge type electron transport complex sub D, rnfabcdge type electron...”
• Iron Deficiency Modulates Metabolic Landscape of Bacteroidetes Promoting Its Resilience during Inflammation
  Lewis, Microbiology spectrum 2023
  • “...to 05 BT0551 to 52 Asparagine synthase B, glutamate synthase subunit beta 2.96 0.014 BT_RS02775 BT0566, BT_0566 Hypothetical protein 3.4 to 2.6 1E-05 to 0.007 rsxC, BT_RS03050 BT0618 to 22 Electron transport complex subunit rsxc, rnfabcdge type electron transport complex sub D, rnfabcdge type electron transport...”

NCU00535 alanyl-tRNA synthetase from Neurospora crassa OR74A
25% identity, 25% coverage

• Discovering functions of unannotated genes from a transcriptome survey of wild fungal isolates
  Ellison, mBio 2014
  • “...asi-1 deletion a ID Annotation DE P value Coexpression correlation NCU00522 Cystathionine beta-lyase 2.3104e05 0.78 NCU00535 Alanyl-tRNA synthetase 0.0054 0.84 NCU02019 FAD-dependent oxidoreductase 1.5469e-08 0.82 NCU02543 Aspartate aminotransferase 0.0027 0.92 NCU05045 MFS monocarboxylate transporter 1.8375e09 0.90 NCU05256 Hypothetical 0.0013 0.81 NCU07126 Acetyltransferase (GNAT) family 0.0503 0.83...”

ALAXM_SACS2 / Q97ZX2 Alanyl-tRNA editing protein AlaX-M; AlaX-M; Alanyl-tRNA deacylase AlaX-M from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
SSO0450 Alanyl-tRNA synthetase truncated homolog (alaS-like1) from Sulfolobus solfataricus P2
24% identity, 23% coverage

• function: Functions in trans to edit the amino acid moiety from incorrectly charged Ser-tRNA(Ala).
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
• A single-base resolution map of an archaeal transcriptome
  Wurtzel, Genome research 2010
  • “...(Dashed arrow) Marks the previous annotation of gene SSO0450 (conserved protein implicated in secretion) that was computationally predicted to begin in position...”

DVU3166 alanyl-tRNA synthetase family protein, putative from Desulfovibrio vulgaris Hildenborough
24% identity, 24% coverage

• Antimicrobial Effects of Free Nitrous Acid on Desulfovibrio vulgaris: Implications for Sulfide-Induced Corrosion of Concrete
  Gao, Applied and environmental microbiology 2016
  • “...DVU1574 DVU0928 DVU1303 DVU1315 DVU1318 DVU2927 DVU1089 DVU3166 DVU1248 DVU3367 DVU0808 DVU1885 DVU0001 DVU2252 DVU0004 DVU0003 DVU0483 DVU0002 DVU1193 DVU1899...”

SYT1_BACSU / P18255 Threonine--tRNA ligase 1; Threonyl-tRNA synthetase 1; ThrRS 1; EC 6.1.1.3 from Bacillus subtilis (strain 168) (see paper)
BSU28950 threonyl-tRNA synthetase from Bacillus subtilis subsp. subtilis str. 168
27% identity, 17% coverage

• function: Catalyzes the attachment of threonine to tRNA(Thr) in a two- step reaction: L-threonine is first activated by ATP to form Thr-AMP and then transferred to the acceptor end of tRNA(Thr). Also edits incorrectly charged L-seryl-tRNA(Thr).
  catalytic activity: tRNA(Thr) + L-threonine + ATP = L-threonyl-tRNA(Thr) + AMP + diphosphate + H(+) (RHEA:24624)
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Homodimer.
• The Blueprint of a Minimal Cell: MiniBacillus
  Reuß, Microbiology and molecular biology reviews : MMBR 2016
  • “...BSU28640 Yes Yes 6.1.1.20 2RHQ S. haemolyticus BSU16570 BSU00130 BSU28950 BSU11420 BSU29670 BSU28090 Yes Yes No Yes Yes Yes Yes Yes Yes Yes Yes 6.1.1.15...”
• S-bacillithiolation protects conserved and essential proteins against hypochlorite stress in firmicutes bacteria
  Chi, Antioxidants & redox signaling 2013
  • “...Table 1. (Continued) 1284 YumC ThrS QueF O05268 P18255 O31678 A7ZAR2 PpaC B. amyloliquefaciens A7Z3U1 MetE YphP*,# AroA P39912 P54170 SerA* P35136 GuaB PpaC*...”

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.