PaperBLAST
PaperBLAST Hits for sp|Q51567|SUCD_PSEAE Succinate--CoA ligase [ADP-forming] subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=sucD PE=1 SV=2 (295 a.a., MSVLINKDTK...)
Show query sequence
>sp|Q51567|SUCD_PSEAE Succinate--CoA ligase [ADP-forming] subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=sucD PE=1 SV=2
MSVLINKDTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVKEA
VEATGAEASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLDAKVKCDELGVRLI
GPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTCVGIGG
DPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAFIKANVTKPVVSYIAGVTAP
PGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTGWEVKKA
Running BLASTp...
Found 250 similar proteins in the literature:
SUCD_PSEAE / Q51567 Succinate--CoA ligase [ADP-forming] subunit alpha; Succinyl-CoA synthetase subunit alpha; SCS-alpha; EC 6.2.1.5 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
PA14_43940 succinyl-CoA synthetase alpha chain from Pseudomonas aeruginosa UCBPP-PA14
NP_250280 succinyl-CoA ligase subunit alpha from Pseudomonas aeruginosa PAO1
PA1589 succinyl-CoA synthetase alpha subunit from Pseudomonas aeruginosa PAO1
100% identity, 100% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit. Can also generate UTP or CTP, although it preferentially synthesizes ATP and/or GTP.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
catalytic activity: GTP + succinate + CoA = succinyl-CoA + GDP + phosphate (RHEA:22120)
subunit: Heterotetramer of two alpha and two beta subunits. - Gene Expression Profiling of <i>Pseudomonas aeruginosa</i> Upon Exposure to Colistin and Tobramycin
Cianciulli, Frontiers in microbiology 2021 - “...nuoE PA14_29980 NADH dehydrogenase subunit E 13.55 5.35 icd PA14_30190 Iisocitrate dehydrogenase 3.09 ND sucD PA14_43940 Succinyl-CoA synthetase subunit alpha 9.39 3.27 sucC PA14_43950 Succinyl-CoA synthetase subunit beta 3.73 ND lpdG PA14_43970 Dihydrolipoamide dehydrogenase 16.47 5.26 sucB PA14_44000 Dihydrolipoamide succinyltransferase 10.98 9.15 sucA PA14_44010 2-oxoglutarate dehydrogenase...”
- Identification of complex III, NQR, and SDH as primary bioenergetic enzymes during the stationary phase of Pseudomonas aeruginosa cultured in urine-like conditions
Hu, Frontiers in microbiology 2024 - “...complex dihydrolipoyllysine-residue succinyltransferase PA1588 NP_250279 1,167 sucC Succinyl-coenzyme A synthetase Succinyl-CoA ligase subunit beta PA1589 NP_250280 888 sucD Succinyl-CoA ligase subunit alpha PA1583 NP_250274 1773 sdhA Succinate dehydrogenase Succinate dehydrogenase flavoprotein subunit PA1584 NP_250275 708 sdhB Succinate dehydrogenase ironsulfur subunit PA1582 NP_250273 369 sdhD Succinate dehydrogenase...”
- Over-Expression of Hypochlorite Inducible Major Facilitator Superfamily (MFS) Pumps Reduces Antimicrobial Drug Susceptibility by Increasing the Production of MexXY Mediated by ArmZ in Pseudomonas aeruginosa
Dulyayangkul, Frontiers in microbiology 2020 - “...subunit beta SucC <0.05 0.003 0.10 0.005 Q51422 AspartatetRNA(Asp/Asn) ligase AspS <0.05 0.019 0.19 0.049 Q51567 SuccinateCoA ligase [ADP-forming] subunit alpha SucD <0.05 0.002 <0.05 0.002 Q9HTD0 Probable biotin carboxylase subunit of a transcarboxylase PA5436 <0.05 0.027 <0.05 0.027 Q9HVI7 Serine hydroxymethyltransferase 3 GlyA2 <0.05 0.000...”
- Proteomic Analysis of Resistance of Gram-Negative Bacteria to Chlorhexidine and Impacts on Susceptibility to Colistin, Antimicrobial Peptides, and Ceragenins
Hashemi, Frontiers in microbiology 2019 - “...GTP in TCA cycle. Nucleoside triphosphate biosynthetic process, protein autophosphorylation, tricarboxylic acid cycle. 1522.01 28 Q51567 SuccinateCoA ligase [ADP-forming] subunit alpha (SucD) Provides coenzyme A and phosphate binding specificity in the coupling of hydrolysis of succinyl-CoA with synthesis of ATP or GTP in TCA cycle. Nucleoside...”
- Integrating Cross-Linking Experiments with Ab Initio Protein-Protein Docking.
Vreven, Journal of molecular biology 2018 - “...B7I6T1 -subunit B7I6T2 1SCU (71%/65%) 1OI7 (57%) none 3.56 (5.19/n/a) Homology/Bound 2D Succinyl-CoA ligase -subunit Q51567 -subunit P53593 1SCU (89%/77%) 1OI7 (58%) none 2.72 (3.95/n/a) Homology/Bound 2E Succinyl-CoA ligase -subunit Q9WUM5 -subunit Q9Z2I8 1EUC (94%/93%) 1OI7 (55%) none 1.14 (1.71/n/a) Homology/Bound 2F Succinyl-CoA ligase -subunit Q9WUM5...”
- Identification of complex III, NQR, and SDH as primary bioenergetic enzymes during the stationary phase of Pseudomonas aeruginosa cultured in urine-like conditions
Hu, Frontiers in microbiology 2024 - “...dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase PA1588 NP_250279 1,167 sucC Succinyl-coenzyme A synthetase Succinyl-CoA ligase subunit beta PA1589 NP_250280 888 sucD Succinyl-CoA ligase subunit alpha PA1583 NP_250274 1773 sdhA Succinate dehydrogenase Succinate dehydrogenase flavoprotein subunit PA1584 NP_250275 708 sdhB Succinate dehydrogenase ironsulfur subunit PA1582 NP_250273 369 sdhD Succinate...”
- The Breadth and Molecular Basis of Hcp-Driven Type VI Secretion System Effector Delivery
Howard, mBio 2021 - “...4.8 2.73 Succinate-CoA ligase (ADP-forming) subunit beta 41.5 PA0317 4.8 2.02 d -2-Hydroxyglutarate dehydrogenase 51.3 PA1589 SucD 4.5 1.78 Succinate-CoA ligase (ADP-forming) subunit alpha 30.3 PA5427 AdhA 4.5 1.90 Alcohol dehydrogenase 35.9 PA2553 4.5 2.42 Probable acyl-CoA thiolase 41.4 PA4854 PurH 4.4 2.02 Bifunctional purine biosynthesis...”
- LTQ-XL mass spectrometry proteome analysis expands the Pseudomonas aeruginosa AmpR regulon to include cyclic di-GMP phosphodiesterases and phosphoproteins, and identifies novel open reading frames
Kumari, Journal of proteomics 2014 - “...Phosphorylations under negative AmpR-regulation included proteins involved in energy utilization such as SucC (PA1588), SucD (PA1589), a transcription regulator Anr (PA1544), outer membrane protein OprM (PA0427) involved in the antibiotic efflux, proteins involved in translation including PpiA (PA3227), RplE (PA4251), and RplP (PA4256). Anr is an...”
- “...division protein ZipA K.LKFKLDRSFANLPDDDGDSphosAELLGPAR.V PA1544 transcriptional regulator Anr R.FRARGFSAQQFRLAMSphosR.N PA1588 succinyl-CoA synthetase beta chain K.ILVESCTDIDKELYphosLGAVVDRSSRR.I PA1589 succinyl-CoA synthetase alpha chain R.SLADIGKALAELTphosGWEVK.K PA1805 peptidyl-prolyl cis-trans isomerase D K.GEDFAALAKEFSphosQDIGSAATGGDLGYAGR.G PA2015 putative isovaleryl-CoA dehydrogenase R.AYLYphosAVAAACDRGETTRK.D PA2229 conserved hypothetical protein R.CHPDWSLLRLSphosEVLFDR.R PA2291 probable glucose-sensitive porin K.MSphosGSGTKGALLPVELIWQPK.V PA2304 AmbC R.NYRAGLGLSphosWREAFQTDSR.A PA2462...”
- A theoretical and experimental proteome map of Pseudomonas aeruginosa PAO1
Lecoutere, MicrobiologyOpen 2012 - “...PA1588 sucC Succinyl CoA synthetase beta C C 41.5 41 5.83 5.82 0.814 0.065 41 PA1589 sucD Succinyl CoA synthetase alpha C U 30.3 32 5.79 5.72 0.854 0.192 42 PA1589 sucD Succinyl CoA synthetase alpha C U 30.3 32 5.79 5.55 0.854 0.192 43 PA1589...”
- Fitness of isogenic colony morphology variants of Pseudomonas aeruginosa in murine airway infection
Rakhimova, PloS one 2008 - “...Probable bacteriophage integrase PA0785 * - azoR Azobenzene reductase PA0920 - - Hypothetical membrane protein PA1589 - sucD Succinyl-CoA synthetase alpha chain PA1633 - kdpA Potassium-transporting ATPase PA1823 - - Hypothetical protein, predicted NADH pyrophosphatase PA2706 - - Hypothetical protein PA2946 - - Hypothetical protein; predicted...”
- Proteomic, microarray, and signature-tagged mutagenesis analyses of anaerobic Pseudomonas aeruginosa at pH 6.5, likely representing chronic, late-stage cystic fibrosis airway conditions
Platt, Journal of bacteriology 2008 - “...TCA cycle enzymes, including sucCD (PA1588 and PA1589; succinyl coenzyme A [CoA] synthase), icd (PA2623; isocitrate dehydrogenase), gltA (PA1580; citrate...”
- Clustering of Pseudomonas aeruginosa transcriptomes from planktonic cultures, developing and mature biofilms reveals distinct expression profiles
Waite, BMC genomics 2006 - “...encoding enzymes involved the tri-carboxylic acid (TCA) cycle succinate dehydrogenase, 2-oxoglutarate dehydrogenase, succinyl-CoA synthetase (PA1581 PA1589, cluster 4). Also, present in cluster 5, are the chaperonins ( groEL and groES ) and a well characterised transcriptional regulator Vfr, which regulates the las quorum sensing system [...”
PP4185, PP_4185 succinyl-CoA synthetase, alpha subunit from Pseudomonas putida KT2440
Q88FB3 Succinate--CoA ligase [ADP-forming] subunit alpha from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
T1E_0425 succinate--CoA ligase subunit alpha from Pseudomonas putida DOT-T1E
98% identity, 100% coverage
- Tuning a high performing multiplexed-CRISPRi Pseudomonas putida strain to further enhance indigoidine production
Czajka, Metabolic engineering communications 2022 - “...CRISPRi array dcpf1-RBS optimized sequence} This study JBEI-230,534 This study JBEI-230,533 4185 4186 a KT2440 PP_4185 PP_4186 PP_5402::arap-Sc.bpsA,Bc.sfp {p/pTE442 neo BBR1 lacuv5p-dcpf1 14 gene CRISPRi array optimized dcpf1-RBS optimized sequence} This study JBEI-230,532 0751 a KT2440 PP_0751 PP_5402::arap-Sc.bpsA,Bc.sfp {p/pTE442 neo BBR1 lacuv5p-dcpf1 14 gene CRISPRi array...”
- “...of carbon from the system ( Fig. 3 d and Fig. S6 ). The sucC (PP_4185) and sucD (PP_4186) subunits of succinyl-CoA synthetase complex were selected as the next gene targets to prevent succinate build-up and secretion. Similarly, the extracellular data indicated that knockdown of the...”
- Pseudomonas putida Responds to the Toxin GraT by Inducing Ribosome Biogenesis Factors and Repressing TCA Cycle Enzymes
Ainelo, Toxins 2019 - “...0.00001 PP_0988 gcvP1 Glycine dehydrogenase (decarboxylating) 1 3.16 0.00013 PP_4012 idh Isocitrate dehydrogenase 2.87 0.00002 PP_4185 sucD Succinate--CoA ligase [ADP-forming] subunit alpha 2.52 0.00005 PP_4189 sucA 2-oxoglutarate decarboxylase, thiamine-requiring E1 subunit 2.12 0.00017 PP_1245 Uncharacterized protein 2.01 0.00018 PP_1800 rmd Oxidoreductase Rmd 2.01 0.00001 PP_0637 PP_4025...”
- Integrated analysis of gene expression and metabolic fluxes in PHA-producing Pseudomonas putida grown on glycerol
Beckers, Microbial cell factories 2016 - “...Isocitrate dehydrogenase 0.38 0.14 0.10 1.97 sucA PP4189 2-Oxoglutarate dehydrogenase 0.37 0.08 0.10 0.17 sucD PP4185 Succinyl-CoA synthetase sub alpha 0.6 0.35 0.10 0.13 sucC PP4186 Succinyl-CoA synthetase sub beta 0.47 0.35 0.10 0.14 sdhA PP4191 Succinate dehydrogenase 0.24 0.30 0.10 0.04 fumC PP0944 Fumarate hydratase...”
- Production of medium chain length polyhydroxyalkanoate in metabolic flux optimized Pseudomonas putida
Borrero-de, Microbial cell factories 2014 - “...0.7 0.3 icd PP4011 Isocitrate dehydrogenase 0.3 -0.5 sucA PP4189 2-Oxoglutarate dehydrogenase -0.7 -0.2 sucD PP4185 Succinyl-CoA synthetase sub alpha -0.1 -0.3 sucC PP4186 Succinyl-CoA synthetase sub beta 0.2 0.3 sdhA PP4191 Succinate dehydrogenase 0.3 0.4 fumC PP0944 Fumarate hydratase 0.5 -1.1 mdh PP0654 Malate dehydrogenase...”
- “...-0.2 0.3 icd PP4011 Isocitrate dehydrogenase -0.3 -0.3 sucA PP4189 2-Oxoglutarate dehydrogenase -0.6 0.2 sucD PP4185 Succinyl-CoA synthetase sub alpha -0.2 0.5 sucC PP4186 Succinyl-CoA synthetase sub beta -0.1 0.1 sdhA PP4191 Succinate dehydrogenase -0.7 0.3 fumC PP0944 Fumarate hydratase 1.1 -0.4 mdh PP0654 Malate dehydrogenase...”
- Regulatory tasks of the phosphoenolpyruvate-phosphotransferase system of Pseudomonas putida in central carbon metabolism
Chavarría, mBio 2012 - “...SucA, 2-oxoglutarate dehydrogenase E1 component (PP_4189); SucC, succinyl-CoA synthetase beta subunit (PP_4186); SucD, succinyl-CoA synthetase (PP_4185); SdhA, succinate dehydrogenase flavoprotein subunit (PP_4191); SdhB, succinate dehydrogenase iron sulfur subunit (PP_4190); SdhC, succinate dehydrogenase, cytochrome b556 subunit (PP_4193); SdhD, succinate dehydrogenase, hydrophobic membrane anchor protein (PP_4192); Fum, fumarate...”
- Random and cyclical deletion of large DNA segments in the genome of Pseudomonas putida
Leprince, Environmental microbiology 2012 - “...adhesion protein LapF; PP_1896, encoding an ABC transporter; PP_4111, encoding an elongation factor G; and PP_4185, encoding a succinyl-CoA synthetase subunit alpha. These six genes illustrate properly the case of a persistent gene coding for non-essential function for the survival of the cell under experimental conditions....”
- The metabolic response of P. putida KT2442 producing high levels of polyhydroxyalkanoate under single- and multiple-nutrient-limited growth: highlights from a multi-level omics approach
Poblete-Castro, Microbial cell factories 2012 - “...-2.3 30 1.0 n.s. Differential protein expression of N vs. C Energy metabolism Succinyl-CoA synthetase PP4185 SucD only in N 8 1.2 n.s. ATP synthase F1, alpha sub PP5415 AtpA only in N 13 ND ND Glycogen debranching PP4055 GlgX 12.3 31 2.4 n.s. Electron transfer...”
- “...the elevated level of enzymes participating in the Krebs cycle. Succinyl-CoA synthase SucD (encoded by PP_4185), which participates in the synthesis of the high-energy compounds ATP and GTP, was identified in cells only under strict nitrogen limitation. Examining the metabolome, we found a decreased pool size...”
- ATP-dependent RecG helicase is required for the transcriptional regulator OxyR function in Pseudomonas species
Yeom, The Journal of biological chemistry 2012 - “...PP5171 (cysP) PP3123 PP0223 PP2333 PP0252 (hslO) PP4620 PP2337 PP4185 (sucD) 17.39 1.09 14.83 1.12 12.13 0.09 10.27 1.11 6.92 0.11 5.62 0.09 4.96 0.04 3.41 0.33...”
- Enhancing curcumin's solubility and antibiofilm activity via silica surface modification
Barros, Nanoscale advances 2020 - “...diphosphate kinase 10 Q88QL8 30S ribosomal protein S5 11 Q88BX2 ATP synthase subunit alpha 12 Q88FB3 Succinate--CoA ligase [ADP-forming] subunit alpha 13 Q88QN2 50S ribosomal protein L2 14 Q88DU1 Protein GrpE 15 Q88DE8 30S ribosomal protein S6 16 Q88KJ1 Trigger factor 17 Q88Q10 50S ribosomal protein...”
- “...10 Q88P78 Putative DNA-binding protein HU, form N 11 Q88QN9 30S ribosomal protein S7 12 Q88FB3 Succinate--CoA ligase [ADP-forming] subunit alpha 13 Q88DU2 Chaperone protein DnaK 14 Q88DU1 Protein GrpE 15 Q88QN8 Elongation factor G 1 16 P0A157 50S ribosomal protein L7/L12 17 Q88F97 Electron transfer...”
- Insights into the susceptibility of Pseudomonas putida to industrially relevant aromatic hydrocarbons that it can synthesize from sugars
García-Franco, Microbial cell factories 2023 - “...in the culture medium. Some of the genes were organized in clusters such as suc (T1E_0425 to T1E_0429), sdh and icd/idh genes (T1E_0537 and T1E_0538). Two citrate synthase genes ( glt A and prp C) (T1E_0434 and T1E_5347) were also induced, leading to an increased ability...”
BOW65_RS07790 succinate--CoA ligase subunit alpha from Pseudomonas koreensis
96% identity, 99% coverage
- Bacterial Analogs of Plant Tetrahydropyridine Alkaloids Mediate Microbial Interactions in a Rhizosphere Model System
Lozano, Applied and environmental microbiology 2019 - “...BOW65_RS28295 Acetylglutamate kinase Metabolism 12 BOW65_RS08620 Methylcitrate synthase Metabolism 13 BOW65_RS24475 Ketol-acid reductoisomerase Metabolism 14 BOW65_RS07790 Succinyl-CoA synthetase subunit alpha Metabolism 15 BOW65_RS08625 2-Methylisocitrate dehydratase Metabolism 16 a BOW65_RS24600 3-Methyl-2-oxobutanoate hydroxymethyltransferase Metabolism 16 a BOW65_RS24605 Pantoate-beta-alanine ligase Metabolism a Transposon insertion in the promoter 5 region...”
A0KJL0 Succinate--CoA ligase [ADP-forming] subunit alpha from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
89% identity, 98% coverage
SEN0689 succinyl-CoA synthetase alpha chain from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
92% identity, 96% coverage
STM0739 succinyl-CoA synthetase, alpha subunit from Salmonella typhimurium LT2
SPC_0736 succinyl-CoA synthetase alpha subunit from Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
STMMW_07961 succinate--CoA ligase subunit alpha from Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
92% identity, 96% coverage
KP1_1690 succinyl-CoA synthetase alpha subunit from Klebsiella pneumoniae NTUH-K2044
90% identity, 96% coverage
VpaChn25_0845 succinate--CoA ligase subunit alpha from Vibrio parahaemolyticus
88% identity, 98% coverage
VAA_RS05370 succinate--CoA ligase subunit alpha from Vibrio anguillarum 775
88% identity, 98% coverage
- Characterization of the <i>Vibrio anguillarum Va</i>RyhB regulon and role in pathogenesis
Li, Frontiers in cellular and infection microbiology 2024 - “...-0.12 0.560 -2.32 0.004 Negative susC VAA_RS05365 -ketoglutarate dehydrogenase 0.95 0.066 -1.70 0.0002 Negative susD VAA_RS05370 Succinate-CoA synthetase -0.12 0.640 -2.54 0.0005 Negative sdhC VAA_RS05335 Succinate dehydrogenase -0.71 0.059 -1.05 0.025 Negative sdhA VAA_RS05345 Succinate dehydrogenase -0.74 0.026 -1.00 0.037 Negative Fe-S assembly hscA VAA_RS11355 Fe-S...”
WU75_19800 succinate--CoA ligase subunit alpha from Vibrio parahaemolyticus
87% identity, 98% coverage
- Identification of Antibacterial Components and Modes in the Methanol-Phase Extract from a Herbal Plant Potentilla kleiniana Wight et Arn
Tang, Foods (Basel, Switzerland) 2023 - “...Wight et Arn. For instance, the DEGs ( sucABCD, WU75_19785 and WU75_19790 , WU75_19795, and WU75_19800 ), encoding a 2-oxoglutarate dehydrogenase, a dihydrolipoamide succinyltransferase, and succinyl-CoA synthetase subunits alpha and beta, respectively, were highly inhibited (0.146-fold, 0.133-fold, 0.134-fold, and 0.16-fold) ( p < 0.05). Moreover, the...”
- “...WU75_11550 acnB 0.143 Bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase WU75_19795 sucC 0.134 Succinyl-CoA synthetase subunit beta WU75_19800 sucD 0.16 Succinyl-CoA synthetase subunit alpha WU75_19770 sdhD 0.199 Succinate dehydrogenase WU75_19780 sdhB 0.157 Succinate dehydrogenase WU75_19765 sdhC 0.182 Succinate dehydrogenase WU75_13785 fumA 0.497 Fumarate hydratase WU75_09605 icd 0.179 Isocitrate...”
VF_0826 succinyl-CoA synthetase subunit alpha from Vibrio fischeri ES114
VF_0826 succinate--CoA ligase subunit alpha from Aliivibrio fischeri ES114
88% identity, 98% coverage
VAS14_17766 succinate--CoA ligase subunit alpha from Photobacterium angustum S14
VAS14_17766 succinyl-CoA synthetase alpha subunit from Vibrio angustum S14
87% identity, 98% coverage
JHW33_RS09920 succinate--CoA ligase subunit alpha from Rahnella perminowiae
88% identity, 97% coverage
SBAL678_RS36490 succinate--CoA ligase subunit alpha from Shewanella baltica OS678
86% identity, 98% coverage
plu1433 succinyl-CoA synthetase alpha chain from Photorhabdus luminescens subsp. laumondii TTO1
88% identity, 97% coverage
SO1933 succinyl-CoA synthase, alpha subunit from Shewanella oneidensis MR-1
SO_1933 succinate--CoA ligase subunit alpha from Shewanella oneidensis MR-1
86% identity, 98% coverage
- Transcriptional analysis of Shewanella oneidensis MR-1 with an electrode compared to Fe(III)citrate or oxygen as terminal electron acceptor
Rosenbaum, PloS one 2012 - “...II 1.51245 SO1929 succinate dehydrogenase 0.0351 TCA-cycle, Complex II 1.41192 SO1932 succinyl-CoA synthase 0.0115 1.495658 SO1933 succinyl-CoA synthase 0.0010 1.89302 SO1962 MelA 0.0077 1.466551 SO2222 fumarate hydratase 0.0053 TCA-cycle 2.163865 SO2304 alanine dehydrogenase 0.0002 1.388457 SO2330 flavodoxin 0.0083 1.355206 SO2336 phosphoglucomutase 0.0066 Glycolysis/Gluconeogenesis 2.091597 SO2339 alpha...”
- Fnr (EtrA) acts as a fine-tuning regulator of anaerobic metabolism in Shewanella oneidensis MR-1
Cruz-García, BMC microbiology 2011 - “...2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase SO1932 sucC 3.29 ( 0.98) succinyl-CoA synthase, beta subunit SO1933 sucD 3.28 ( 1.24) succinyl-CoA synthase, alpha subunit SO2361 ccoP 2.30 ( 0.92) cytochrome c oxidase, cbb3-type, subunit III SO2362 ccoQ 3.44 ( 1.16) cytochrome c oxidase, cbb3-type, CcoQ subunit...”
- An empirical strategy for characterizing bacterial proteomes across species in the absence of genomic sequences
Turse, PloS one 2010 - “...sdhA 5 4 2 SO1929 sdhB SO1930 sucA SO1931 sucB 9 SO1932 sucC 5 2 SO1933 sucD 6 4 SO2222 SO2222 12 2 SO2629 icd 50 12 4 SO4118 SO4118 4 Data represented here are from highly conserved central metabolic pathways, as unique peptide count the...”
- “...4 3 3 4 SO1932 CN32_2267 suc C 3 2 4 3 2 2 2 SO1933 CN32_2266 suc D 4 2 4 2 4 2 4 SO2222 CN32_1807 SO2222 7 6 5 5 5 8 6 6 SO2629 CN32_2230 icd 15 5 12 10 8 7...”
- Genomic analysis of carbon source metabolism of Shewanella oneidensis MR-1: Predictions versus experiments
Serres, Journal of bacteriology 2006 - “...of the two missing reactions. The succinyl-CoA ligase (SO1932 and SO1933) might serve as the malyl-CoA ligase if it also had the ability to bind malate. As a...”
- Supplementation with Amino Acid Sources Facilitates Fermentative Growth of Shewanella oneidensis MR-1 in Defined Media
Ikeda, Applied and environmental microbiology 2023 (secret) - Electrochemically active bacteria sense electrode potentials for regulating catabolic pathways
Hirose, Nature communications 2018 - “...complex dehydrogenase E1 component 1.75 SO_1931 sucB 2-Oxoglutarate dehydrogenase complex succinyl-CoA:dihydrolipoate S-succinyltransferase E2 component 1.77 SO_1933 sucD Succinyl-CoA synthase alpha subunit 1.66 NADH oxidation SO_1010 nuoM NADH-ubiquinone oxidoreductase subunit M 2.85 SO_1012 nuoK NADH-ubiquinone oxidoreductase subunit K 2.68 SO_1013 nuoJ NADH-ubiquinone oxidoreductase subunit J 2.58 SO_1014...”
SucD / b0729 succinyl-CoA synthetase subunit α (EC 6.2.1.5) from Escherichia coli K-12 substr. MG1655 (see 11 papers)
sucD / P0AGE9 succinyl-CoA synthetase subunit α (EC 6.2.1.5) from Escherichia coli (strain K12) (see 8 papers)
SUCD_ECOLI / P0AGE9 Succinate--CoA ligase [ADP-forming] subunit alpha; Succinyl-CoA synthetase subunit alpha; SCS-alpha; EC 6.2.1.5 from Escherichia coli (strain K12) (see 3 papers)
P0AGE9 succinate-CoA ligase (ADP-forming) (EC 6.2.1.5) from Escherichia coli K-12 (see paper)
sucD / ECOCYC|SUCCCOASYN-ALPHA succinyl-CoA synthetase subunit alpha from Escherichia coli K12 (see 6 papers)
b0729 succinyl-CoA synthetase subunit alpha from Escherichia coli str. K-12 substr. MG1655
NP_415257 succinyl-CoA synthetase subunit alpha from Escherichia coli str. K-12 substr. MG1655
P0AGF1 Succinate--CoA ligase [ADP-forming] subunit alpha from Escherichia coli O157:H7
UTI89_C0724 succinyl-CoA synthetase, alpha subunit from Escherichia coli UTI89
Z0883 succinyl-CoA synthetase, alpha subunit from Escherichia coli O157:H7 EDL933
ECs0754 succinyl-CoA synthetase alpha subunit from Escherichia coli O157:H7 str. Sakai
BC33_RS19225, D1792_24740 succinate--CoA ligase subunit alpha from Escherichia coli
89% identity, 96% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit. Can use either ATP or GTP, but prefers ATP. It can also function in the other direction for anabolic purposes, and this may be particularly important for providing succinyl-CoA during anaerobic growth when the oxidative route from 2-oxoglutarate is severely repressed.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
catalytic activity: GTP + succinate + CoA = succinyl-CoA + GDP + phosphate (RHEA:22120)
subunit: Heterotetramer of two alpha and two beta subunits. - DeepSub: Utilizing Deep Learning for Predicting the Number of Subunits in Homo-Oligomeric Protein Complexes
Deng, International journal of molecular sciences 2024 - “...protein complex. For example, Succinyl-CoA synthetase is a heterotetramer containing two alpha subunits (encoded by b0729 with an MW of 29.777 kDa) and two beta subunits (encoded by b0728 with an MW of 41.393 kDa). Consequently, the MW of this enzyme complex should be 142.34 kDa...”
- Tracing the phylogenetic history of the Crl regulon through the Bacteria and Archaea genomes
Santos-Zavaleta, BMC genomics 2019 - “...11 ] recombinational repair, DNA replication, cellular response to DNA damage stimulus, SOS response sucA b0729 sucA B sucA BC D ArcA(+/), FNR(), IHF() + GEA, IMP [ 11 ] glycolytic process, tricarboxylic acid cycle, metabolic process, oxidation-reduction process sucD b2464 sucA B sucA BC D...”
- Identification of Modules With Similar Gene Regulation and Metabolic Functions Based on Co-expression Data
Galán-Vásquez, Frontiers in molecular biosciences 2019 - “...with enzymes, the genes with the highest connectivity were sucB (b0727), sucC (b0728), and sucD (b0729), which are associated with the citrate cycle, an important aerobic pathway for the final steps of the oxidation of carbohydrates and fatty acids (Buck et al., 1986 ); nuoH (b2282),...”
- Gap-filling analysis of the iJO1366 Escherichia coli metabolic network reconstruction for discovery of metabolic functions
Orth, BMC systems biology 2012 - “...(EcoCyc) CITL IV Hypothesized gap-filling reactions Reaction Category Putative gene E-value R00352 (R) IV sucD (b0729) 2.00E-20 R00373 (F) I global orphan R00400 (F) I global orphan R00507 (R) IV yhfW (b3380) 0.47 R00529 (F) IV cysN (b2751) and cysD (b2752) * R00530 (F) IV global...”
- Accurate estimation of nucleic acids by amplification efficiency dependent PCR
Chatterjee, PloS one 2012 - “...transferase 1.95 1.98 0.57 0.67 1.42 b0728 succinyl CoA synthetase,sucC 1.91 1.93 1.13 1.31 1.65 b0729 succinyl CoA synthetase,sucD 1.91 1.92 2.74 2.59 1.55 b0721 succinate dehydrogenase 1.99 1.90 2.28 0.85 1.41 b1611 fumarate hydratase 1.90 1.73 0.95 0.12 1.45 The relative ratios are calculated with...”
- Control and benefits of CP4-57 prophage excision in Escherichia coli biofilms
Wang, The ISME journal 2009 - “...1.6 Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex sucC b0728 1.9 Succinyl-CoA synthetase, -subunit sucD b0729 1.7 Succinyl-CoA synthetase, -subunit aceA b4015 1.7 Isocitrate lyase aceB b4014 1.5 Malate synthetase A mglA b2149 1.6 Alactoside transport and galactose taxis mglC b2148 1.7 Alactoside transport and galactose...”
- The HU regulon is composed of genes responding to anaerobiosis, acid stress, high osmolarity and SOS induction
Oberto, PloS one 2009 - “...1.97 1 0.16 0.19 0.84 1 0.33 0.72 0.66 FRec succinyl-CoA synthetase, beta subunit sucD b0729 sdhCDAB-b0725-sucABCD 1 2.26 0.69 1.95 1 0.14 0.14 0.62 1 0.42 0.74 0.49 FRec succinyl-CoA synthetase, alpha subunit fumA b1612 fumA 1 5.47 0.82 3.05 1 0.34 0.23 1.13 1...”
- Characterization of Escherichia coli MG1655 grown in a low-shear modeled microgravity environment
Tucker, BMC microbiology 2007 - “...present LSMMG down-regulated genes apt b0469 -2.22 0.0005 adenine phosphoribosyltransferase, adenine salvage cytoplasm present sucD b0729 -2.15 0.0001 succinyl-coA synthetase alpha subunit cytoplasm present rplY b2185 -7.57 0.0506 50S ribosomal subunit protein L25 cytoplasm present rplS b2606 yes -2.99 0.0597 50S ribosomal subunit protein L19 cytoplasm...”
- “...coli LB LSMMG down-regulated homologous Salmonella genes gene b# ratio gene STM ID# ratio sucD b0729 -1.77 sucD STM0739 -3.33 rimM b2608 -2.07 rimM STM2675 <2 rpsP b2609 -2.48 rpsP STM2676 <2 rplA b3984 -2.03 rplA STM4150 <2 rplJ b3985 -2.49 rplJ STM4151 <2 rpsF b4200...”
- More
- Participation of Cys123alpha of Escherichia coli succinyl-CoA synthetase in catalysis.
Hidber, Acta crystallographica. Section D, Biological crystallography 2007 (PubMed)- GeneRIF: explain why this cysteine residue is conserved in the sequences of succinyl-CoA synthetases from different sources
- sucAB and sucCD are mutually essential genes in Escherichia coli.
Yu, FEMS microbiology letters 2006 (PubMed)- GeneRIF: sucAB and sucCD are mutually essential genes for production of succinyl Coa that is essential for cell viability
- Identification of phosphoproteins in Escherichia coli.
Freestone, Molecular microbiology 1995 (PubMed)- GeneRIF: N-terminus verified by Edman degradation on mature peptide
- Functional Prediction of Biological Profile During Eutrophication in Marine Environment
Sbaoui, Bioinformatics and biology insights 2022 - “...regulator Sqr P0AC41 Sulfide: quinone reductase StfR P76072 Rac prophage; putative tail fiber protein Suc P0AGE9 Succinyl-CoA synthetase SucA P0AFG3 2-Oxoglutarate dehydrogenase E1 component SulA P0AFZ5 Suppressor of ion; inhibitor of cell division and FtsZ ring formation on DNA damage/inhibition TktA P27302 Transketolase 1 TorC P33226...”
- Integrating Cross-Linking Experiments with Ab Initio Protein-Protein Docking.
Vreven, Journal of molecular biology 2018 - “...at the center [ 41 ]. Indeed, one pair of the cross-linked sites for 2B (P0AGE9 residue 43 with P0A836 residue 172) requires the tetramer structure, whereas both pairs of cross-linked sites of 2A are consistent with a dimeric complex structure. Consequently, we used the monomeric...”
- “...P53597 -subunit Q96I99 1EUC (96%/96%) 1OI7 (54%) none 1.02 (1.53/n/a) Homology/Bound 2B Succinyl-CoA ligase -subunit P0AGE9 -subunit P0A836 1SCU (100%/100%) 1OI7 (44%) none 0.66 (1.02/n/a) Homology/Bound 2C Succinyl-CoA ligase -subunit B7I6T1 -subunit B7I6T2 1SCU (71%/65%) 1OI7 (57%) none 3.56 (5.19/n/a) Homology/Bound 2D Succinyl-CoA ligase -subunit Q51567...”
- Comprehensively Characterizing the Thioredoxin Interactome In Vivo Highlights the Central Role Played by This Ubiquitous Oxidoreductase in Redox Control
Arts, Molecular & cellular proteomics : MCP 2016 - “...P0A870 P0ABH7 P08200 P61889 P0A836 P0AGE9 Acetate kinase Lactaldehyde dehydrogenase Phosphopentomutase Deoxyribose-phosphate aldolase UTP-glucose-1-phosphate...”
- Novel characteristics of succinate coenzyme A (Succinate-CoA) ligases: conversion of malate to malyl-CoA and CoA-thioester formation of succinate analogues in vitro
Nolte, Applied and environmental microbiology 2014 - “...Amplification of sucCDBL21 (GenBank accession no. P0A836 and P0AGE9) from the genomic DNA of E. coli BL21 was performed by use of oligonucleotides...”
- Expression of the mevalonate pathway enzymes in the Lutzomyia longipalpis (Diptera: Psychodidae) sex pheromone gland demonstrated by an integrated proteomic approach.
González-Caballero, Journal of proteomics 2014 - “...kinase family. A. darlingi 2 Phosphoglycerate kinase (Pfam) Phosphoglycerate kinase (SUPERFAMILY) Succinyl-CoA synthetase alpha subunit P0AGE9 Succinyl-CoA ligase [ADP-forming] subunit alpha Belongs to the succinate/malate CoA ligase alpha subunit family. + LL-149 Succinyl-CoA synthetase, alpha subunit/Kog database 17 Transketolase + Q17CT0 AAEL004434-PA A. aegypti 2 4...”
- The Escherichia coli proteome: past, present, and future prospects
Han, Microbiology and molecular biology reviews : MMBR 2006 - “...beta chain 5.37/41,392.65 5.30/42,377 SucD P0AGE9 Succinyl-CoA synthetase alpha chain 6.31/29,646.28 6.16/31,613 5.73/29,525 (5-6) 5.86/28,860 (5.5-6.7)...”
- GlnH, a Novel Antigen That Offers Partial Protection against Verocytotoxigenic Escherichia coli Infection
Quinn, Vaccines 2023 - “...Caco-2 only 5 Q8XBL3 Phosphoenolpyruvate-protein phosphotransferase (PPP) 23.1 15 4.78 63.7 323.31 Caco-2 only 6 P0AGF1 SuccinateCoA ligase (ADP-forming) subunit alpha (SucD) 66.4 14 6.32 30.1 247.46 HT29 only 7 Q7ABI1 Protein GrpE 67.5 17 4.68 21.8 258.66 HT29 & Caco-2 8 Q8XD03 Phosphoglycerate kinase (PgK)...”
- Glycosuria Alters Uropathogenic Escherichia coli Global Gene Expression and Virulence
Islam, mSphere 2022 - “...2.0640* 2-Oxoglutarate dehydrogenase E1 component UTI89_C0723 sucC 0.0118 1.5590* 1.5540* ADP-forming succinateCoA ligase subunit beta UTI89_C0724 sucD 0.0688 1.5421* 1.5935* Succinate-CoA ligase subunit alpha UTI89_C1438 adhE 0.0074 2.0939* 2.1154* Bifunctional acetaldehyde-CoA/alcohol dehydrogenase UTI89_C1547 acnA 0.0207 1.8463* 1.8493* Aconitate hydratase AcnA UTI89_C1619 nifJ b 0.6094 0.5765 1.1706*...”
- Transcriptomic analysis reveals specific metabolic pathways of enterohemorrhagic Escherichia coli O157:H7 in bovine digestive contents
Segura, BMC genomics 2018 - “...2.91 3.11E-04 NDE Z0882 sucC Succinyl-CoA synthetase ( subunit) NDE NDE NDE 2.93 2.18E-04 NDE Z0883 sucD Succinyl-CoA synthetase ( subunit) NDE NDE NDE 2.89 1.78E-04 NDE Z5501 talC Fructose 6-phosphate aldolase 2 2.45 3.24E-05 NDE 2.61 1.21E-05 NDE 2.16 3.41E-04 Z4469 tdcB Threonine dehydratase 6.04...”
- Disruption of rcsB by a duplicated sequence in a curli-producing Escherichia coli O157:H7 results in differential gene expression in relation to biofilm formation, stress responses and metabolism
Sharma, BMC microbiology 2017 - “...sucB Z0881 Dihydrolipoamide succinyltransferase 2.62 0.039 sucC Z0882 Succinyl-CoA synthetase subunit beta 2.64 0.029 sucD Z0883 Succinyl-CoA synthetase subunit alpha 2.37 0.054 nadA Z0919 Quinolate synthetase 1.82 0.002 galM Z0926 Galactose-1-epimerase 1.33 0.047 galE Z0929 UDP-galactose-4-epimerase 1.46 0.019 ybjW Z1107 Hydroxylamine reductase +1.98 9/0E-03 galU Z2012...”
- The gluconeogenesis pathway is involved in maintenance of enterohaemorrhagic Escherichia coli O157:H7 in bovine intestinal content
Bertin, PloS one 2014 - “...sucB 2-oxoglutarate dehydrogenase (E2 component) 2.37 3.6E-03 Z0882 sucC Succinyl-CoA synthetase (b subunit) 3.00 5.6E-03 Z0883 sucD Succinyl-CoA synthetase (a subunit) 2.70 6.8E-03 Glycerol and glycerol-3P Z4786 glpD Glycerol-3-phosphate dehydrogenase 4.18 7.6E-03 Z5472 glpF Facilitated diffusion of glycerol 3.64 6.0E-03 Z5471 glpK Glycerol kinase 5.74 7.3E-04...”
- The attachment process and physiological properties of Escherichia coli O157:H7 on quartz
Wang, BMC microbiology 2020 - “...tricarboxylic acid (TCA) cycle-related enzymes, including phosphoenolpyruvate carboxykinase ( Ecs4245 (2.3)), succinyl-CoA synthase subunit ( Ecs0754 (1.0)), succinate dehydrogenase/fumarate reductase ( Ecs0748 (1.1) and Ecs0749 (1.1)), fumarate hydrolase ( Ecs2317 (1.8), Ecs2318 (1.7) and Ecs5132 (2.4)), malate dehydrogenase ( Ecs4109 (1.0)) and the epsilon subunit of...”
- “...confirmed through RT-qPCR experiments that attachment inhibited the expression of the TCA-related genes Ecs4245 , Ecs0754 , s dhA , sdhB , fumC , Ecs2318 , and Ecs4109 and promoted the expression of the fermentation metabolism-related genes pstC , Ecs4664 , Ecs2907 , Ecs2846 , pgk...”
- Genomic and Transcriptomic Analysis of Colistin-Susceptible and Colistin-Resistant Isolates Identify Two-Component System EvgS/EvgA Associated with Colistin Resistance in Escherichia coli
Wan, Infection and drug resistance 2021 - “...protein 5 D1792_11760 3.7 MarR family transcriptional regulator 6 glcB 3.6 Malate synthase B 7 D1792_24740 3.4 Succinyl-CoA ligase subunit 8 D1792_12370 3.2 Glycolate oxidase 9 D1792_16520 3.0 Low affinity typtophan permease 10 D1792_12360 -2.6 Glycolate oxidase iron-sulfur subunit In E. coli ATCC 25922-R and its...”
- Transcriptomic analysis reveal differential gene expressions of Escherichia coli O157:H7 under ultrasonic stress
Li, Ultrasonics sonochemistry 2021 - “...component BC33_RS19235 sucB 2.2 2-oxoglutarate dehydrogenase E2 component BC33_RS19230 sucC 2.5 succinyl-CoA synthetase beta subunit BC33_RS19225 sucD 2.8 succinyl-CoA synthetase alpha subunit BC33_RS19250 sdhA 2.4 succinate dehydrogenase, flavoprotein subunit BC33_RS19245 sdhB 2.2 succinate dehydrogenase, iron-sulfur subunit BC33_RS14160 fumA 2.3 fumarate hydratase, class I BC33_RS14165 fumC 2.8...”
1scuA / P0AGE9 The crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution (see paper)
89% identity, 96% coverage
- Ligand: coenzyme a (1scuA)
y3064 succinyl-CoA synthetase, alpha subunit from Yersinia pestis KIM
YPO1116 succinyl-CoA synthetase alpha chain from Yersinia pestis CO92
YPTB1150 succinyl-CoA synthetase alpha chain from Yersinia pseudotuberculosis IP 32953
87% identity, 96% coverage
- Proteomic analysis of iron acquisition, metabolic and regulatory responses of Yersinia pestis to iron starvation
Pieper, BMC microbiology 2010 - “...katE catalase; hydroperoxidase HPII(III) CY RyhB 481 66313 6.09 0.04 1.20 0.032 0.000 0.113 41 y3064 sucD succinyl-CoA synthetase, alpha subunit CY 597 33015 6.04 0.33 0.91 0.363 0.000 0.472 42 y3067 sucA 2-oxoglutarate dehydrogenase (decarboxylase component) CY 1153 102739 5.98 - 0.43 < 0.05 N.D....”
- The cyclic AMP receptor protein, CRP, is required for both virulence and expression of the minimal CRP regulon in Yersinia pestis biovar microtus
Zhan, Infection and immunity 2008 - “...3.30 YPO1114 2 sucC 3.17 YPO1115 2 sucD 3.12 YPO1116 2 cydA 3.24 cydB 2.03 gntT 5.88 A AAACTGTGATTTGACTC ACTCTG D/321/9.24 YPO2982 R/136/9.24 YPO2983 D/327/9.93...”
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...YPTB1149 YPO1115 sucC putative succinyl-CoA synthetase beta chain 0.419 (< 0.001) 0.205 (< 0.001) YPTB1150 YPO1116 sucD putative succinyl-CoA synthetase alpha chain 0.525 (< 0.001) 0.236 (0.001) YPTB1148 YPO1114 sucB putative dihydrolipoamide succinyltransferase component 0.610 (0.014) 0.267 (0.003) YPTB1147 YPO1113 sucA putative 2-oxoglutarate dehydrogenase E1 component...”
- “...(0.013) 0.671 (0.04) YPTB1149 (sucC) YPO1115 succinyl-CoA synthetase beta chain 0.419 (< 0.001) YPTB1150 (sucD) YPO1116 succinyl-CoA synthetase alpha chain 0.524 (< 0.001) YPTB1151 (cydA) YPO1117 cytochrome D ubiquinol oxidase subunit I 0.442 (< 0.001) YPTB1152 (cydB) YPO1118 cytochrome D ubiquinol oxidase subunit II 0.565 (0.004)...”
- IscR is essential for yersinia pseudotuberculosis type III secretion and virulence
Miller, PLoS pathogens 2014 - “...component nagE 5.2 YPTB1148 dihydrolipoamide succinyltransferase sucB 2.1 YPTB1149 succinyl-CoA synthetase beta chain sucC 3.0 YPTB1150 succinyl-CoA synthetase alpha chain sucD 3.1 YPTB1358 glutaredoxin 1 grxA 2.3 YPTB1418 integration host factor beta-subunit ihfB 2.7 YPTB2047 pyruvate kinase II pykA 2.3 YPTB2143 aconitate hydratase 1 acnA 2.2...”
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...0.001) YPTB1149 YPO1115 sucC putative succinyl-CoA synthetase beta chain 0.419 (< 0.001) 0.205 (< 0.001) YPTB1150 YPO1116 sucD putative succinyl-CoA synthetase alpha chain 0.525 (< 0.001) 0.236 (0.001) YPTB1148 YPO1114 sucB putative dihydrolipoamide succinyltransferase component 0.610 (0.014) 0.267 (0.003) YPTB1147 YPO1113 sucA putative 2-oxoglutarate dehydrogenase E1...”
- “...dehydro 0.61 (0.013) 0.671 (0.04) YPTB1149 (sucC) YPO1115 succinyl-CoA synthetase beta chain 0.419 (< 0.001) YPTB1150 (sucD) YPO1116 succinyl-CoA synthetase alpha chain 0.524 (< 0.001) YPTB1151 (cydA) YPO1117 cytochrome D ubiquinol oxidase subunit I 0.442 (< 0.001) YPTB1152 (cydB) YPO1118 cytochrome D ubiquinol oxidase subunit II...”
SG0879 succinyl-CoA synthase alpha subunit from Sodalis glossinidius str. 'morsitans'
85% identity, 96% coverage
Q0VPF8 succinate-CoA ligase (ADP-forming) (EC 6.2.1.5) from Alcanivorax borkumensis (see paper)
ABO_1492 succinyl-CoA synthetase, alpha subunit from Alcanivorax borkumensis SK2
82% identity, 98% coverage
HI1197 succinyl-CoA synthetase, alpha subunit (sucD) from Haemophilus influenzae Rd KW20
80% identity, 97% coverage
HS_0956 succinyl-CoA synthetase, alpha subunit from Haemophilus somnus 129PT
80% identity, 97% coverage
CBU_1396 succinyl-CoA synthetase, alpha subunit from Coxiella burnetii RSA 493
75% identity, 98% coverage
- Proteomics paves the way for Q fever diagnostics
Kowalczewska, Genome medicine 2011 - “...CBU_1706, CBU_12190, CBU_0495, CBU_0780, CBU_0955, Phase-II-specific SP: CBU_1290, CBU_0235, CBU_0215, CBU_0572, CBU_1398, CBU_0236, CBU_0092, CBU_1241, CBU_1396, CBU_1227, CBU_0481, CBU_0299, CBU_0481, CBU_0495, CBU_0482, CBU_0937, CBU_0236 [ 68 ] RP-based approaches Candidate RPs for Q fever vaccine development and serodiagnosis TAP products and expression of selected SP HS...”
FTN_0593 succinyl-CoA synthetase, alpha subunit from Francisella tularensis subsp. novicida U112
76% identity, 98% coverage
- Glutamate utilization couples oxidative stress defense and the tricarboxylic acid cycle in Francisella phagosomal escape
Ramond, PLoS pathogens 2014 - “...two genes encoding enzymes of the TCA cycle ( sucA , FTN_1635 ; sucD , FTN_0593 ); m iddle panel : two genes encoding enzymes, converting glutamate (Glu) to glutathione (GSH) ( gshA , FTN_0277 ; gshB , FTN_0804 ); r ight panel: two genes encoding...”
- “...either from oxoglutarate, glutamine, GSH or even proline (according to KEGG metabolic pathways). Expression of FTN_0593 ( sucD ), FTN_0127 ( gabD ) and FTN_1532 ( gdhA ), was significantly decreased in the gadC mutant under oxidative stress, whereas their expression was moderately increased in the...”
- Macrophage replication screen identifies a novel Francisella hydroperoxide resistance protein involved in virulence
Llewellyn, PloS one 2011 - “...NA conserved hypothetical protein [50] FTN_0546 FTT0455c flmK dolichyl-phosphate-mannose-protein mannosyltransferase family protein [50] , [115] FTN_0593 FTT0503c sucD succinyl-CoA synthetase, alpha subunit [51] [89] , [114] FTN_0594 FTT0504c sucC succinyl-CoA synthetase subunit beta [51] , [112] [114] FTN_0599 FTT0509c NA conserved hypothetical protein [50] FTN_0812 FTT0934c...”
- Francisella-arthropod vector interaction and its role in patho-adaptation to infect mammals
Akimana, Frontiers in microbiology 2011 - “...(D, K and N) FTN_0577 DNA mismatch repair enzyme with ATPase activity mutL FTN_0588 Asparaginase FTN_0593 Succinyl-CoA synthetase, alpha subunit sucD FTN_0599 Conserved hypothetical protein FTN_0599 Protein of unknown function FTN_0600 DNA gyrase subunit B gyrB FTN_0603 Formamidopyrimidine-DNA glycosylase mutM FTN_0623 2-C-methyl- d -erythritol 4-phosphate cytidylyltransferase...”
- Molecular bases of proliferation of Francisella tularensis in arthropod vectors
Asare, Environmental microbiology 2010 - “...synthetase class II (D, K and N) 6 2 tnfn1_pw060510p03q171 FTN_0588 asparaginase 2 2 tnfn1_pw060419p03q116 FTN_0593 sucD succinyl-CoA synthetase, alpha subunit 2 2 tnfn1_pw060418p02q128 FTN_0633 katG peroxidase/catalase 7 7 tnfn1_pw060328p06q130 FTN_0692 nadA quinolinate sythetase A 3 2 # tnfn1_pw060419p04q164 FTN_0692 nadA quinolinate sythetase A 2 2...”
- “...protein, subunit 1 tnfn1_pw060323p06q168 FTN_0545 glycosyl transferase, group 2 tnfn1_pw060419p02q135 FTN_0560 ksgA dimethyladenosine transferase tnfn1_pw060419p03q116 FTN_0593 sucD succinyl-CoA synthetase, alpha subunit tnfn1_pw060510p04q147 FTN_0599 protein of unknown function tnfn1_pw060323p06q164 FTN_0624 serine permease tnfn1_pw060418p02q128 FTN_0633 katG peroxidase/catalase tnfn1_pw060420p01q168 FTN_0646 cscK ROK family protein tnfn1_pw060419p01q168 FTN_0651 cdd cytidine deaminase...”
- Molecular complexity orchestrates modulation of phagosome biogenesis and escape to the cytosol of macrophages by Francisella tularensis
Asare, Environmental microbiology 2010 - “...synthetase class II (D, K and N) 5 2 tnfn1_pw060510p03q171 FTN_0588 asparaginase 2 2 tnfn1_pw060419p03q116 FTN_0593 sucD succinyl-CoA synthetase, alpha subunit 2 2 tnfn1_pw060418p02q128 FTN_0633 katG peroxidase/catalase 7 7 tnfn1_pw060328p06q130 FTN_0692 nadA quinolinate sythetase A 3 2 # tnfn1_pw060419p04q164 FTN_0692 nadA quinolinate sythetase A 2 2...”
- “...protein, subunit 1 tnfn1_pw060323p06q168 FTN_0545 glycosyl transferase, group 2 tnfn1_pw060419p02q135 FTN_0560 ksgA dimethyladenosine transferase tnfn1_pw060419p03q116 FTN_0593 sucD succinyl-CoA synthetase, alpha subunit tnfn1_pw060510p04q147 FTN_0599 protein of unknown function tnfn1_pw060323p06q164 FTN_0624 serine permease tnfn1_pw060418p02q128 FTN_0633 katG peroxidase/catalase tnfn1_pw060420p01q168 FTN_0646 cscK ROK family protein tnfn1_pw060419p01q168 FTN_0651 cdd cytidine deaminase...”
- Exploitation of host cell biology and evasion of immunity by francisella tularensis
Asare, Frontiers in microbiology 2010 - “...Glycosyl transferase, group 2 FTN_0567 tRNA synthetase class II (D, K, and N) FTN_0588 Asparaginase FTN_0593 sucD Succinyl-CoA synthetase, alpha subunit FTN_0598 tRNA-dihydrouridine synthase FTN_0633 katG Peroxidase/catalase FTN_0692 nadA Quinolinate synthetase A FTN_0695 Add Deoxyadenosine deaminase/adenosine deaminase FTN_0746 Alr Alanine racemase FTN_0806 Glycosyl hydrolase family 3...”
6mggC / Q5NHF4 Succinyl-coa synthase from francisella tularensis, phosphorylated, in complex with coa
75% identity, 98% coverage
- Ligand: coenzyme a (6mggC)
FTS_1518 succinate--CoA ligase subunit alpha from Francisella tularensis subsp. holarctica FSC200
75% identity, 98% coverage
- Early infection-induced natural antibody response
Kubelkova, Scientific reports 2021 - “...family protein (FTS_1295), fumarate hydratase (FTS_0527), succinyl-CoA synthetase subunit beta (FTS_1517), succinyl-CoA synthetase subunit alpha (FTS_1518), DNA-directed RNA polymerase subunit alpha (FTS_0258), transcription elongation factor GreA (FTS_1440), glycerophosphoryl diester phosphodiesterase (FTS_1476), 30S ribosomal protein S1 (FTS_1862), bacterioferritin (FTS_0617), and trigger factor (FTS_0882). Moreover, 2 proteins, namely...”
NGO0912 putative succinyl-CoA synthetase alpha subunit from Neisseria gonorrhoeae FA 1090
75% identity, 97% coverage
NMB0960 succinyl-CoA synthetase alpha subunit from Neisseria meningitidis MC58
75% identity, 97% coverage
ABUW_0876, DJ41_3577 succinate--CoA ligase subunit alpha from Acinetobacter baumannii
D0CDT6 Succinate--CoA ligase [ADP-forming] subunit alpha from Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81)
73% identity, 97% coverage
- Insights into the Periplasmic Proteins of Acinetobacter baumannii AB5075 and the Impact of Imipenem Exposure: A Proteomic Approach
Scribano, International journal of molecular sciences 2019 - “...0.952 0.927 SpI score = 25.1318 Protein fate 0.212 A0A0Q1DNT0 Succinate-CoA ligase [ADP-forming] subunit alpha ABUW_0876 sucD Sec SP MLCS: 128 [AQA-LD]. Rs: 0.943 0.302 0.140 CYT score = 0.200913 Energy metabolism 0.208 A0A0D5YF99 Carbamoyl-phosphate synthase small chain ABUW_0894 carA Sec SP MLCS: 122 [IGA-TG]. Rs:...”
- Metabolic Responses to Polymyxin Treatment in Acinetobacter baumannii ATCC 19606: Integrating Transcriptomics and Metabolomics with Genome-Scale Metabolic Modeling
Zhu, mSystems 2019 - “...(DJ41_1103, 2.7-fold), 2-oxoglutarate dehydrogenase (DJ41_3573 and DJ41_3574, 1.9 and 2.5-fold, respectively), succinyl-CoA ligase (DJ41_3576 and DJ41_3577, 2.1-fold for both), fumarate hydratase (DJ41_227, 2.6-fold), and malate dehydrogenase (DJ41_3006, 1.8-fold). However, the fluxes and metabolites throughout the TCA cycle decreased. In contrast, upregulated malate synthase (DJ41_669, 1.6-fold) and...”
- Proteomic and Systematic Functional Profiling Unveils Citral Targeting Antibiotic Resistance, Antioxidant Defense, and Biofilm-Associated Two-Component Systems of Acinetobacter baumannii To Encumber Biofilm and Virulence Traits
Selvaraj, mSystems 2020 - “...12 D0CBH8 Electron transfer flavoprotein subunit alpha etfA 19 61 1.94181 0.0030139 8,564 6 6 D0CDT6 Succinate-CoA ligase (ADP-forming) subunit alpha sucD 20 62 1.93165 0.00672927 4,654 28 6 D0C6C9 Biotin carboxyl carrier protein of acetyl-CoA carboxylase accB 21 64 1.90147 0.030785 1.57E+13 30 21 D0CEK4...”
V6E02_03145 succinate--CoA ligase subunit alpha from Thiobacter aerophilum
71% identity, 100% coverage
- <i>Thiobacter aerophilum</i> sp. nov., a Thermophilic, Obligately Chemolithoautotrophic, Sulfur-Oxidizing Bacterium from a Hot Spring and Proposal of <i>Thiobacteraceae</i> fam. nov
Dukat, Microorganisms 2024 - “...including citrate synthase (V6E02_06885), aconitate hydratase (V6E02_07900), isocitrate dehydrogenase (V6E02_11500), 2-oxoacid/ferredoxin oxidoreductases (V6E02_02945-V6E02_02960), succinyl-CoA synthetase (V6E02_03145 and V6E02_06280), succinate dehydrogenase (V6E02_00295-V6E02_00310), and class II fumarate hydratase (V6E02_07515). The gene encoding NAD-dependent malate dehydrogenase was absent, while the gene encoding NADP-dependent malic enzyme (V6E02_08360) was detected. It...”
CV_1076 succinyl-CoA synthetase alpha chain from Chromobacterium violaceum ATCC 12472
76% identity, 97% coverage
GL4_0107 succinate--CoA ligase subunit alpha from Methyloceanibacter caenitepidi
73% identity, 97% coverage
- Possible cross-feeding pathway of facultative methylotroph Methyloceanibacter caenitepidi Gela4 on methanotroph Methylocaldum marinum S8
Takeuchi, PloS one 2019 - “...sucA 386 652 0.75 0.000 GL4_0109 2-oxoglutarate dehydrogenase E2 component sucB 265 585 1.14 0.000 GL4_0107 Succinyl-CoA ligase alpha chain sucD 132 700 2.40 0.000 GL4_0106 Succinyl-CoA ligase beta chain sucC 217 673 1.63 0.000 GL4_0100 Succinate dehydrogenase flavoprotein subunit sdhA 252 217 -0.22 0.004 GL4_0101...”
- “...malate dehydrogenase ( mdh , GL4_0105), succinyl-CoA synthethase ( sucC and sucD ; GL4_0106 and GL4_0107) and 2-oxoglutarate dehydrogenase (sucA and sucB; GL4_0108 and GL4_0109) were upregulated ( Fig 3 , Table 1 ). The TCA cycle was also found to be upregulated according to the...”
XAC3235 succinyl-CoA synthetase alpha subunit from Xanthomonas axonopodis pv. citri str. 306
74% identity, 97% coverage
SMLT_RS17870 succinate--CoA ligase subunit alpha from Stenotrophomonas maltophilia
73% identity, 97% coverage
H375_1770 succinate--CoA ligase subunit alpha from Rickettsia prowazekii str. Breinl
71% identity, 97% coverage
c5037 Succinyl-CoA synthetase alpha chain from Escherichia coli CFT073
67% identity, 100% coverage
- Transcriptomic and Metabolomic Profiling Reveals That KguR Broadly Impacts the Physiology of Uropathogenic Escherichia coli Under in vivo Relevant Conditions
Yang, Frontiers in microbiology 2021 - “...c5032 - c5035 in a genomic island) and a succinyl-CoA synthetase (encoded by c5036 - c5037 immediately downstream of c5035 ) as well as a KG transporter under anaerobic conditions and contributes to the utilization of KG. Lack of c5032 - c5037 dramatically impaired the growth...”
- “...in the group Mean log 2 fold change -ketoglutarate utilization 7 genes: kguS c5032 - c5037 c5039 7.99 Acid resistance 8 genes: hdeABD gadABC gadE mdtE 3.9 Iron uptake system 12 genes: sitABCD entABCDEF chuS hutX 3.4 Amino acid metabolism 4 genes: cysK carA lysA leuA...”
- A novel two-component signaling system facilitates uropathogenic Escherichia coli's ability to exploit abundant host metabolites
Cai, PLoS pathogens 2013 - “...with similarity of 64%, 69%, and 55%, respectively; whereas, the proteins encoded by c5036 and c5037 are 70% and 83% similar to the beta- and alpha-subunits of succinyl-CoA synthetase from E. coli . -KG dehydrogenase converts -KG to succinyl-CoA, which can be further transformed to succinate...”
- “...In addition, the regulation of other target genes ( c5034 , c5035 , c5036 , c5037 , and c5039 ) in the genomic island in response to -KG by C5040 was confirmed using qRT-PCR ( Fig. S4 ). Together, these results indicate that -KG induction of...”
- Defining genomic islands and uropathogen-specific genes in uropathogenic Escherichia coli
Lloyd, Journal of bacteriology 2007 - “...AL. J. BACTERIOL. TABLE 5--Continued Genea c5035 c5036 c5037 c5038 c5039 c5040 c5060 c5061 yddO c5078 yddQ yddR c5081 Putative periplasmic binding protein...”
XF_2548 succinate--CoA ligase subunit alpha from Xylella fastidiosa 9a5c
XF2548 succinyl-CoA synthetase, alpha subunit from Xylella fastidiosa 9a5c
72% identity, 97% coverage
PD1931 succinyl-CoA synthetase, alpha subunit from Xylella fastidiosa Temecula1
72% identity, 97% coverage
RSP_0966 Succinyl-CoA synthetase, alpha subunit from Rhodobacter sphaeroides 2.4.1
67% identity, 98% coverage
Gmet_2260 Succinyl-CoA ligase, alpha subunit from Geobacter metallireducens GS-15
67% identity, 97% coverage
T0C0Z3 Succinate--CoA ligase [ADP-forming] subunit alpha from Alicyclobacillus acidoterrestris (strain ATCC 49025 / DSM 3922 / CIP 106132 / NCIMB 13137 / GD3B)
67% identity, 93% coverage
- Surface Immunoproteomics Reveals Potential Biomarkers in Alicyclobacillus acidoterrestris
Shi, Frontiers in microbiology 2018 - “...Hypothetical protein N007_04435 T0C6H1 N007_04435 32737.6/5.18 499 14 56.56 12 Succinate-CoA ligase [ADP-forming] subunit alpha T0C0Z3 sucD 31636.3/5.37 469 15 50.66 13 Polyamine aminopropyl transferase T0DMQ2 speE 31094.8/5.52 308 16 65.7 14 Hypothetical protein N007_08970 T0BYX4 N007_08970 114313.8/4.01 183 6 4.87 16 Hypothetical protein N007_08970 T0BYX4...”
CA51_28020 succinate--CoA ligase subunit alpha from Rosistilla oblonga
69% identity, 97% coverage
Mal33_49450 succinate--CoA ligase subunit alpha from Rosistilla oblonga
69% identity, 97% coverage
Poly24_21030 succinate--CoA ligase subunit alpha from Rosistilla carotiformis
68% identity, 97% coverage
SUCA2_ARATH / Q8LAD2 Succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial; Succinyl-CoA synthetase subunit alpha-2; SCS-alpha-2; EC 6.2.1.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT5G23250 succinyl-CoA ligase (GDP-forming) alpha-chain, mitochondrial, putative / succinyl-CoA synthetase, alpha chain, putative / SCS-alpha, putative from Arabidopsis thaliana
69% identity, 84% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
subunit: Heterodimer of an alpha and a beta subunit. - Quantitative Proteomics Reveals the Dynamic Regulation of the Tomato Proteome in Response to Phytophthora infestans
Fan, International journal of molecular sciences 2021 - “...(SCoAL) AT2G20420 3 0.058 0.107 3 0.039 0.888 3 0.602 0.016 Solyc01g007910 succinyl-CoA ligase (SCoAL) AT5G23250 3 0.131 0.132 3 0.295 0.529 3 0.630 0.035 Solyc09g075450 fumarase (FUM) AT2G47510 3 0.088 0.362 3 0.091 0.691 3 0.953 0.004 Solyc08g066360 malic enzyme (ME) AT1G79750 3 0.007 0.978...”
- Target of Rapamycin Regulates Genome Methylation Reprogramming to Control Plant Growth in Arabidopsis
Zhu, Frontiers in genetics 2020 - “...0.5323 Hypo Promoter MDH1| Lactate dehydrogenase/glycoside hydrolas AT4G13890 0.5464 Hypo Exon SHM5| Pyridoxal phosphate-dependent transferase AT5G23250 0.6175 Hypo Exon/intron/utr3 ATP-citrate lyase/succinyl-CoA ligase AT4G26970 0.6402 Hypo Exon/intron ACO3| Aconitase/3-isopropylmalate dehydratase AT1G22020 0.6478 Hypo Exon/intron SHM6| Pyridoxal phosphate-dependent transferase AT5G11670 0.6696 Hypo Promoter NADP-ME2| Malic enzyme, NAD-binding AT1G79530...”
- Consequences of Oxidative Stress on Plant Glycolytic and Respiratory Metabolism
Dumont, Frontiers in plant science 2019 - “...75/363 ] 13 17 [Cys 116 ], 18 [Cys 75/116/131/269 ] Succinyl-CoA ligase SCS (At2g20420, At5g23250) 13 SCS (At5g08300) 13 16 Succinate dehydrogenase SDH1 (At5g66760) 10 [Cys 526 ] 13 SDH5 (At1g47420) 17 [Cys 230 ] Fumarase FUM1 (At2g47510) 1 8 [Cys 155 ] 13 17...”
- Heterologous Expression of the Transcription Factor EsNAC1 in Arabidopsis Enhances Abiotic Stress Resistance and Retards Growth by Regulating the Expression of Different Target Genes
Liu, Frontiers in plant science 2018 - “...proteins with transport or membrane binding abilities [ GOLS2 , SUCCINYL-COA LIGASE ( CoA , AT5G23250 ), VIM3 , BETA-AMYLASE 1 ( BAM1 , AT5G65700 )] showed opposite expression patterns in the HE lines and the RD26OX line ( Figure 6 ). The upregulated expression of...”
- Nitric Oxide Regulates Seedling Growth and Mitochondrial Responses in Aged Oat Seeds
Mao, International journal of molecular sciences 2018 - “...cycle I1LYN0 AT2G20420 Succinate-CoA ligase [ADP-forming] subunit beta, mitochondrial Glycine max 1.25 0.67 ns K3ZV34 AT5G23250 Succinate-CoA ligase [ADP-forming] subunit alpha, mitochondrial Setaria italica 1.33 0.76 ns Q10LR5 AT5G50950 Fumarate hydratase 1, mitochondrial, putative, expressed Oryza sativa subsp. japonica 1.25 ns 2.56 R4X771 AT5G50950 Fumarate hydratase,...”
- “...0.73 B4FRH5 AT2G20420 Succinate-CoA ligase [ADP-forming] subunit beta, mitochondrial Zea mays ns 0.79 ns W5C4B7 AT5G23250 Succinate-CoA ligase [ADP-forming] subunit alpha, mitochondrial Triticum aestivum ns 0.67 ns V4KMJ1 AT5G66760 Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial Eutrema salsugineum ns 1.52 ns M3AS20 AT5G40650 Succinate dehydrogenase [ubiquinone] iron-sulfur...”
- iTRAQ Mitoproteome Analysis Reveals Mechanisms of Programmed Cell Death in Arabidopsis thaliana Induced by Ochratoxin A
Wang, Toxins 2017 - “...4.7 (2.4) AT4G26910 2-oxoacid dehydrogenase family protein 3.8 (1.9) AT2G05710 Aconitate hydratase (Aconitase) 4.0 (2.0) AT5G23250 Succinyl-CoA ligase, putative 2.2 (1.3) AT5G40650, Succinate dehydrogenase (SDH2-2) 2.5 (1.3) AT2G47510 Fumarase 1 (FUM1) 3.4 (1.8) AT5G09660 NAD-malate dehydrogenase 2 (PMDH2) 2.3 (1.2) Oxidative phosphorylation Complex I AT3G12260 Complex...”
- Identification of cleavage sites and substrate proteins for two mitochondrial intermediate peptidases in Arabidopsis thaliana
Carrie, Journal of experimental botany 2015 - “...AT5G08300 Succinyl-CoA ligase, alpha subunit; F FASDPHPPAAVFVDKNTR ASDPHPPAAVFVDKNTR 69 AT5G09590 Hsp70-2 F FSSKPAGNDVIGIDLGTTNSCVAVMEGKNPKVIENAEGAR SSKPAGNDVIGIDLGTTNSCVAVMEGKNPKVIENAEGAR 70 AT5G23250 Succinyl-CoA ligase F FGTTPPPPAAVFVDKNTR GTTPPPPAAVFVDKNTR 71 AT5G67590 NADH-ubiquinone oxidoreductase-related F FATDAVVESDYKR ATDAVVESDYKRGEIGKVSGIPEEHLSR 72 AT5G64050 Glutamate tRNA synthetase F FAVVACSTPVNNGGSVR AVVACSTPVNNGGSVR 73 AT1G53240 Lactate/malate dehydrogenase family protein F FSSGSVPER 74 AT1G47720...”
Q39TX7 Succinate--CoA ligase [ADP-forming] subunit alpha from Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Gmet_2068 Succinyl-CoA ligase, alpha subunit from Geobacter metallireducens GS-15
66% identity, 97% coverage
Dshi_2882 succinyl-CoA synthetase, alpha subunit from Dinoroseobacter shibae DFL 12
67% identity, 98% coverage
LT988_08455 succinate--CoA ligase subunit alpha from Thiocapsa bogorovii
70% identity, 98% coverage
SUCA1_ARATH / P68209 Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial; Succinyl-CoA synthetase subunit alpha-1; SCS-alpha-1; EC 6.2.1.5 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT5G08300 succinyl-CoA ligase (GDP-forming) alpha-chain, mitochondrial, putative / succinyl-CoA synthetase, alpha chain, putative / SCS-alpha, putative from Arabidopsis thaliana
68% identity, 82% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
subunit: Heterodimer of an alpha and a beta subunit. - Proteome and Interactome Linked to Metabolism, Genetic Information Processing, and Abiotic Stress in Gametophytes of Two Woodferns
Ojosnegros, International journal of molecular sciences 2023 - “...64100-316_1_ORF1 O82662 AT2G20420 SUCCINATE-COA LIGASE [ADP-FORMING] SUBUNIT BETA 50 9 0 4 0 Carbohydrates 8279-816_3_ORF2 P68209 AT5G08300 SUCCINATE-COA LIGASE [ADP-FORMING] SUBUNIT ALPHA-1 34.6 9 2 3 0 Carbohydrates 222487-119_2_ORF2 P93819 MDH1 MALATE DEHYDROGENASE 1 38.4 20 2 16 0 Carbohydrates 156827-185_4_ORF1 Q9SH69 PGD1 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING...”
- Improving plant miRNA-target prediction with self-supervised k-mer embedding and spectral graph convolutional neural network
Zhang, PeerJ 2024 - “...2 AT3G60630 0.98 PmiREN 3 AT4G00150 0.98 PmiREN, TarDB 4 AT2G45160 0.98 PmiREN, TarDB 5 AT5G08300 0.97 PmiREN, TarDB Arabidopsis miR408 1 AT1G72230 0.99 PmiREN 2 AT2G44790 0.99 PmiREN 3 AT3G02200 0.98 PmiREN, TarDB 4 AT1G15830 0.97 PmiREN 5 AT2G02850 0.96 PmiREN, TarDB Discussion In this...”
- Proteome and Interactome Linked to Metabolism, Genetic Information Processing, and Abiotic Stress in Gametophytes of Two Woodferns
Ojosnegros, International journal of molecular sciences 2023 - “...citrate/tricarboxylic acid cycle, SUCCINATE-CoA LIGASE [ADP-FORMING] SUBUNIT BETA (AT2G20420) and SUCCINATE-CoA LIGASE [ADP-FORMING] SUBUNIT ALPHA-1 (AT5G08300), which are involved in the only phosphorylation step at the substrate level of this cycle. Another protein is MALATE DEHYDROGENASE 1 (MDH1), which catalyzes a reversible NAD-dependent dehydrogenase reaction involved...”
- “...O82662 AT2G20420 SUCCINATE-COA LIGASE [ADP-FORMING] SUBUNIT BETA 50 9 0 4 0 Carbohydrates 8279-816_3_ORF2 P68209 AT5G08300 SUCCINATE-COA LIGASE [ADP-FORMING] SUBUNIT ALPHA-1 34.6 9 2 3 0 Carbohydrates 222487-119_2_ORF2 P93819 MDH1 MALATE DEHYDROGENASE 1 38.4 20 2 16 0 Carbohydrates 156827-185_4_ORF1 Q9SH69 PGD1 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING 1...”
- Transcriptome and metabolome analyses revealed that narrowband 280 and 310 nm UV-B induce distinctive responses in Arabidopsis
Tsurumoto, Scientific reports 2022 - “...(-ketoglutarate) dehydrogenase complex, KGDHE2 and At4g26910 , dihydrolipoyl dehydrogenase, LPD2 , succinyl CoA ligase -subunit, At5g08300 , succinate dehydroganases, SDH1-1 , SDH2-1 , and SDH2-2 , fumarase, FUM2 , and mitochondrial malate dehydrogenase, mMDH2 , in 280-2d were confirmed (Fig. 6 ). Figure 5 Gene expression...”
- Integrative Analysis of Transcriptomic and Proteomic Changes Related to Cytoplasmic Male Sterility in Spring Stem Mustard (Brassica juncea var. tumida Tsen et Lee)
Shen, International journal of molecular sciences 2022 - “...DOWN DAP BjuB029356 K00627 Acetyltransferase component of pyruvate AT1G54220 UP DAP BjuB040953 K01899 dehydrogenase complex AT5G08300 DOWN DAP BjuO005963 K01214 SuccinateCoA ligase AT2G39930 DOWN DAP BjuA013768 K02267 ISA1 AT5G57815 UP DAP BjuB028190 K03953 Cytochrome c oxidase subunit AT2G20360 UP DAP BjuB004697 K02154 V-type proton ATPase subunit...”
- “...AT4G35260 UP DAP BjuB019661 K00026 Malate dehydrogenase, chloroplastic AT3G47520 UP DAP BjuB040953 K01899 SuccinateCoA ligase AT5G08300 DOWN DAP BjuB027452 K03963 Uncharacterized protein AT2G02050 UP DAP BjuA012602 K03966 Uncharacterized protein AT3G18410 UP DAP BjuA004528 K03966 Uncharacterized protein AT3G18410 UP DAP BjuB003649 K02266 Uncharacterized protein AT4G37830 DOWN DAP...”
- Gel-based proteomic map of Arabidopsis thaliana root plastids and mitochondria
Grabsztunowicz, BMC plant biology 2020 - “...by the action of succinyl-CoA synthetase (or ligase) [ 58 ]. Succinyl-CoA ligase subunits alpha-1 (At5g08300) and beta (At 2g20420) were identified in spots 7578 and 85, and in spots 62 and 63, respectively. Next, succinate is oxidized to fumarate by succinate dehydrogenase complex, which participates...”
- Target of Rapamycin Regulates Genome Methylation Reprogramming to Control Plant Growth in Arabidopsis
Zhu, Frontiers in genetics 2020 - “...Hypo Promoter PGDH2| Allosteric substrate binding domain AT3G52200 0.3913 Hypo Exon/intron LTA3| 2-oxoacid dehydrogenase acyltransferase AT5G08300 0.5078 Hypo Promoter ATP-citrate lyase/succinyl-CoA ligase AT1G04410 0.5323 Hypo Promoter MDH1| Lactate dehydrogenase/glycoside hydrolas AT4G13890 0.5464 Hypo Exon SHM5| Pyridoxal phosphate-dependent transferase AT5G23250 0.6175 Hypo Exon/intron/utr3 ATP-citrate lyase/succinyl-CoA ligase AT4G26970...”
- Consequences of Oxidative Stress on Plant Glycolytic and Respiratory Metabolism
Dumont, Frontiers in plant science 2019 - “...17 [Cys 116 ], 18 [Cys 75/116/131/269 ] Succinyl-CoA ligase SCS (At2g20420, At5g23250) 13 SCS (At5g08300) 13 16 Succinate dehydrogenase SDH1 (At5g66760) 10 [Cys 526 ] 13 SDH5 (At1g47420) 17 [Cys 230 ] Fumarase FUM1 (At2g47510) 1 8 [Cys 155 ] 13 17 [Cys 155 ],...”
- A Microsomal Proteomics View of H₂O₂- and ABA-Dependent Responses
Alqurashi, Proteomes 2017 - “...TCA cycle, citrate synthase (AT2G44350), aconitase 3 (AT2G05710), isocitrate dehydrogenase (AT1G65930), succinyl-CoA ligase, alpha subunit (AT5G08300), and ATP citrate lyase/succinyl-CoA synthetase (AT2G20420), an enzyme that cleaves citrate to oxaloacetate and acetyl CoA in the presence of ATP and CoA, and is implicated in carbohydrate metabolism and...”
- “...0.5 4.5 AT2G05710 Aconitase 3 0.0002 2.5 12.0 AT2G20420 ATP citrate lyase 0.022 ns 5.0 AT5G08300 Succinyl-CoA ligase, alpha subunit 0.006 2.4 2.5 AT2G44350 Citrate synthase family protein 0.026 ns 5.9 AT1G65930 Cyt. NADP + -dep. isocitrate dehydrogenase 0.033 0.1 2.9 AT1G15120 Ubiquinol-cytochrome C reductase hinge...”
- More
W5C4B7 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Triticum aestivum
67% identity, 86% coverage
- Nitric Oxide Regulates Seedling Growth and Mitochondrial Responses in Aged Oat Seeds
Mao, International journal of molecular sciences 2018 - “...the aged seeds (A0/CK), such as the subunit of Succinate-CoA ligase (I1LYN0, K3ZV34, B4FRH5 and W5C4B7), fumarate hydratase (R4X771), malic enzyme (K3ZRI5), aldehyde dehydrogenase (K3YRJ0), and a subunit of Succinate-CoA dehydrogenase (M3AS20). However, the proteins of the subunit of Succinate-CoA ligase (I1LYN0 and K3ZV34) were only...”
- “...0.77 0.73 B4FRH5 AT2G20420 Succinate-CoA ligase [ADP-forming] subunit beta, mitochondrial Zea mays ns 0.79 ns W5C4B7 AT5G23250 Succinate-CoA ligase [ADP-forming] subunit alpha, mitochondrial Triticum aestivum ns 0.67 ns V4KMJ1 AT5G66760 Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial Eutrema salsugineum ns 1.52 ns M3AS20 AT5G40650 Succinate dehydrogenase [ubiquinone]...”
P80865 Succinate--CoA ligase [ADP-forming] subunit alpha from Bacillus subtilis (strain 168)
BSU16100 succinyl-CoA synthetase subunit alpha from Bacillus subtilis subsp. subtilis str. 168
QU35_08905 succinate--CoA ligase subunit alpha from Bacillus subtilis subsp. subtilis str. 168
66% identity, 96% coverage
- Correction: Comprehensive Analysis of Temporal Alterations in Cellular Proteome of Bacillus subtilis under Curcumin Treatment
Reddy, PloS one 2015 - “...component of 2-oxoglutarate dehydrogenase complex OdhB 54.44 18 1.18 2.51 3.30 13 1.101 1.669 2.818 P80865 Succinyl-CoA ligase [ADP-forming] subunit alpha SucD 33.00 6 1.12 2.73 3.39 4 2.458 2.642 3.074 P80886 Succinyl-CoA ligase [ADP-forming] subunit beta SucC 55.32 22 1.11 3.26 4.08 14 1.185 3.907...”
- Proteomics analyses of Bacillus subtilis after treatment with plumbagin, a plant-derived naphthoquinone
Reddy, Omics : a journal of integrative biology 2015 - “...P80886 Succinyl-CoA ligase [ADPforming] subunit beta P80865 Succinyl-CoA ligase [ADPforming] subunit alpha P08066 Succinate dehydrogenase iron-sulfur subunit...”
- Comprehensive analysis of temporal alterations in cellular proteome of Bacillus subtilis under curcumin treatment
Reddy, PloS one 2015 - “...component of 2-oxoglutarate dehydrogenase complex OdhB 54.44 18 1.18 2.51 3.30 13 2.203 4.063 3.053 P80865 Succinyl-CoA ligase [ADP-forming] subunit alpha SucD 33.00 6 1.12 2.73 3.39 4 1.553 2.023 3.060 P80886 Succinyl-CoA ligase [ADP-forming] subunit beta SucC 55.32 22 1.11 3.26 4.08 15 1.252 5.002...”
- Identification of an RNA sponge that controls the RoxS riboregulator of central metabolism in Bacillus subtilis
Durand, Nucleic acids research 2021 - “...control of GltC activity CitA BSU09440 0.78 FsrA and RoxS Minor citrate synthase Unknown SucD BSU16100 0.76 RoxS Succinyl-CoA synthetase (alpha subunit) TCA Cycle YpbR/DynA BSU22030 0.73 RoxS Dynamin-like protein fusion of membranes YkrA BSU14550 0.62 RoxS Unknown YcsA BSU04000 0.62 RoxS Putative tartrate dehydrogenase Unknown...”
- Lessons and Considerations for the Creation of Universal Primers Targeting Non-Conserved, Horizontally Mobile Genes
Brown, Applied and environmental microbiology 2021 - “...(QU35_03810), encoding an ATP-dependent DNA helicase, and a gene for the succinyl-CoA synthetase alpha subunit (QU35_08905), both in Bacillus subtilis , as well as to a cupin gene (GSUB_03070) in Geoalkalibacter subterraneus . This example illustrates undesired targeting that does not provide any sort of additional...”
D5APB4 Succinate--CoA ligase [ADP-forming] subunit alpha from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
67% identity, 96% coverage
Mal52_36710, Pan258_35790 succinate--CoA ligase subunit alpha from Symmachiella dynata
67% identity, 96% coverage
- Three Planctomycetes isolated from biotic surfaces in the Mediterranean Sea and the Pacific Ocean constitute the novel species Symmachiella dynata gen. nov., sp. nov. and Symmachiella macrocystis sp. nov
Salbreiter, Antonie van Leeuwenhoek 2020 - “...dehydrogenase complex 2.3.1.61 sucB Pan258_17100 Mal52_17290 CA54_02340 SuccinateCoA ligase [ADP-forming] subunit alpha 6.2.1.5 sucD Pan258_35790 Mal52_36710 CA54_52680 SuccinateCoA ligase [ADP-forming] subunit beta 6.2.1.5 sucC Pan258_35780 Mal52_36700 CA54_52670 Succinate dehydrogenase flavoprotein subunit 1.3.5.1 sdhA Pan258_24540 Mal52_24830 CA54_44660 Succinate dehydrogenase iron-sulfur subunit 1.3.5.1 sdhB Pan258_24530 Mal52_24820 CA54_44670 Succinate...”
- “...2-oxoglutarate dehydrogenase complex 2.3.1.61 sucB Pan258_17100 Mal52_17290 CA54_02340 SuccinateCoA ligase [ADP-forming] subunit alpha 6.2.1.5 sucD Pan258_35790 Mal52_36710 CA54_52680 SuccinateCoA ligase [ADP-forming] subunit beta 6.2.1.5 sucC Pan258_35780 Mal52_36700 CA54_52670 Succinate dehydrogenase flavoprotein subunit 1.3.5.1 sdhA Pan258_24540 Mal52_24830 CA54_44660 Succinate dehydrogenase iron-sulfur subunit 1.3.5.1 sdhB Pan258_24530 Mal52_24820 CA54_44670...”
SUCA1_SOLLC / Q8GTQ9 Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial; Succinyl-CoA synthetase subunit alpha-1; SCS-alpha-1; EC 6.2.1.5 from Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (see paper)
67% identity, 86% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
subunit: Heterodimer of an alpha and a beta subunit. - Proteome-Wide Identification of Lysine Succinylation in the Proteins of Tomato (Solanum lycopersicum)
Jin, PloS one 2016 - “...component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61] K4DCI6; K4AXC0 CS: citrate synthase [EC:2.3.3.1] K4CFD4 ACO: aconitate hydratase [EC:4.2.1.3] Q8GTQ9 LSC1: succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5] Q84LB6 LSC2: succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5] Lysine Succinylation of Histone Proteins in Tomato Previous studies demonstrated that histone modifications are involved...”
M1BCU6 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Solanum tuberosum
67% identity, 86% coverage
CA54_52680 succinate--CoA ligase subunit alpha from Symmachiella macrocystis
67% identity, 96% coverage
Q07UX7 Succinate--CoA ligase [ADP-forming] subunit alpha from Rhodopseudomonas palustris (strain BisA53)
67% identity, 97% coverage
K3ZV34 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Setaria italica
67% identity, 86% coverage
- Nitric Oxide Regulates Seedling Growth and Mitochondrial Responses in Aged Oat Seeds
Mao, International journal of molecular sciences 2018 - “...were down-regulated in the aged seeds (A0/CK), such as the subunit of Succinate-CoA ligase (I1LYN0, K3ZV34, B4FRH5 and W5C4B7), fumarate hydratase (R4X771), malic enzyme (K3ZRI5), aldehyde dehydrogenase (K3YRJ0), and a subunit of Succinate-CoA dehydrogenase (M3AS20). However, the proteins of the subunit of Succinate-CoA ligase (I1LYN0 and...”
- “...to fumarate. In our proteome analysis results, the subunit of Succinate-CoA ligase [ADP-forming] (I1LYN0 and K3ZV34) in aged seeds was significantly lower compared to CK. Succinate-CoA ligase can catalyze a reversible reaction, transforming succinyl-CoA and ADP or GDP to succinate and ATP or GTP [ 33...”
Q6ZL94 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Oryza sativa subsp. japonica
67% identity, 86% coverage
W8Y7A6 Succinate--CoA ligase [ADP-forming] subunit alpha from Bacillus thuringiensis DB27
67% identity, 95% coverage
- Role of hsp20 in the Production of Spores and Insecticidal Crystal Proteins in Bacillus thuringiensis
Xie, Frontiers in microbiology 2019 - “...citB Aconitate hydratase A W8Y5Y6 0.46 thiM Hydroxyethylthiazole kinase W8Y9G2 0.46 icd Isocitrate dehydrogenase [NADP] W8Y7A6 0.46 sucD Succinate CoA ligase [ADP-forming] subunit alpha W8YK96 0.45 metG Methionine tRNA ligase W8Y8A7 0.45 ndk Nucleoside diphosphate kinase W8Z497 0.44 pdhC Dihydrolipoyllysine-residue acetyltransferase W8YKA7 0.44 mfd Transcription-repair-coupling factor...”
SACOL1263 succinyl-CoA synthase, alpha subunit from Staphylococcus aureus subsp. aureus COL
P99070 Succinate--CoA ligase [ADP-forming] subunit alpha from Staphylococcus aureus (strain N315)
SA1089 succinyl-CoA synthetase alpha subunit from Staphylococcus aureus subsp. aureus N315
SAOUHSC_01218 succinyl-CoA synthetase, alpha subunit, putative from Staphylococcus aureus subsp. aureus NCTC 8325
SAUSA300_1139 succinyl-CoA synthetase, alpha subunit from Staphylococcus aureus subsp. aureus USA300_FPR3757
SAUSA300_RS06165 succinate--CoA ligase subunit alpha from Staphylococcus aureus subsp. aureus USA300_FPR3757
65% identity, 95% coverage
- Redox sensing by a Rex-family repressor is involved in the regulation of anaerobic gene expression in Staphylococcus aureus
Pagels, Molecular microbiology 2010 - “...SACOL1123 Pyruvate carboxylase SAOUHSC_01218 SucD 1.4 (1.1) 3.8 (1.5) 1.6 (1.2) 2.4 (1.3) 0.9 (0.9) SACOL1263 Succinyl-CoA synthetase subunit alpha SAOUHSC_01266 1.3 (1.2) 5.5 (4.4) 6.5 (5.2) 0.8 (0.8) 0.2 (0.2) SACOL1308 Pyruvate ferredoxin oxidoreductase, alpha subunit SAOUHSC_01337 Tkt 1.8 (1.8) 2.6 (3.4) 1.9 (2.3) 1.4...”
- Complete and SOS-mediated response of Staphylococcus aureus to the antibiotic ciprofloxacin
Cirz, Journal of bacteriology 2007 - “...ORFs SA1245 SACOL1158 SACOL1159 SACOL1160 SACOL1262 SACOL1263 SACOL1385 SACOL1448 SACOL1449 SACOL1741 SACOL1908 SACOL2424 SACOL2426 SACOL2427 SACOL2428 Gene S....”
- Impacts of the Type I Toxin-Antitoxin System, SprG1/SprF1, on Staphylococcus aureus Gene Expression
Chlebicka, Genes 2021 - “...Pyruvate dehydrogenase E1 component subunit (PdhB) P99063 2.19 1.82 2 Succinate--CoA ligase (ADP-forming) subunit (SucD) P99070 1.55 3 Putative peptidyl-prolyl cis-trans isomerase (PpiB) Q7A6I1 2.19 1.82 4 3-hydroxyacyl-(acyl-carrier-protein) dehydrataseFabZ (FabZ) P64108 2.36 5 6,7-dimethyl-8-ribityllumazine synthase (RibH) P99141 1.58 2.36 6 Alanine dehydrogenase 2 (Ald2) Q99TF4 1.86...”
- Exposure of clinical MRSA heterogeneous strains to β-lactams redirects metabolism to optimize energy production through the TCA cycle
Keaton, PloS one 2013 - “...2.5 fumarate hydratase, class-II Involved in the TCA cycle (converts (S)-malate to fumarate and water). SA1089 sucD 3.3 succinyl-CoA synthetase alpha subunit Catalyzes the only substrate-level phosphorylation in the TCA cycle. SA0963 pycA 3 pyruvate carboxylase Involved in the TCA cycle, alanine and aspartate metabolism, pyruvate...”
- Experimental discovery of small RNAs in Staphylococcus aureus reveals a riboregulator of central metabolism
Bohn, Nucleic acids research 2010 - “...f 21.13 Hypothetical protein SA1088 ( sucC ) 0.54 f 18.24 SuccinylCoA synthetase subunit beta SA1089 ( sucD ) 0.47 f 15.51 SuccinylCoA synthetase subunit alpha SA1184 ( citB ) 0.47 15.61 Aconitate hydratase SA1365 ( gcvPB ) 0.48 Glycine dehydrogenase subunit 2 SA1366 ( gcvPA...”
- “...SA1432 and SA0645 encoding putative manganese and anion transporters, respectively, (iii) sucC (SA1088) and sucD (SA1089) encoding the succinylCoA synthetase alpha and beta subunits, respectively, (iv) gcvP (SA1366) and gcvT (SA1367), encoding enzymes from the glycine cleavage pathway, (v) acsA (SA1554) encoding the acetylCoA synthetase and...”
- An RpoB mutation confers dual heteroresistance to daptomycin and vancomycin in Staphylococcus aureus
Cui, Antimicrobial agents and chemotherapy 2010 - “...SA0945 phdB pdhC SA0946 pdhD SA0994 SA0995 SA0996 SA1088 SA1089 SA1131 SA1132 SA1184 SA1244 SA1245 SA1349 SA1517 SA1518 SA1609 sdhC sdhA sdhB sucC sucD Cell...”
- Transcriptome and functional analysis of the eukaryotic-type serine/threonine kinase PknB in Staphylococcus aureus
Donat, Journal of bacteriology 2009 - “...ET AL. TABLE 3--Continued Gene SA0995 SA0996 SA1088 SA1089 SA1141 SA1142 SA1184 SA1517 SA1553 SA1554 SA1609 SA1669 SA1679 SA1927 SA2155 SA2304 SAS020 sdhA sdhB...”
- Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
Seggewiss, Journal of bacteriology 2006 - “...SA1184 SA1244 SA1141 SA0728 SA2007 SA0729 SA0182 SA1553 SA1089 SA2327 SA1554 SA0232 SA0219 Description 7770 J. BACTERIOL. SEGGEWI ET AL. TABLE 2--Continued P...”
- Proteomic and Metabolomic Analyses of a Tea-Tree Oil-Selected Staphylococcus aureus Small Colony Variant
Torres, Antibiotics (Basel, Switzerland) 2019 - “...serine/threonine protein phosphatase uncharacterized 1.1 SAOUHSC_01198 FabD malonyl CoA-acyl carrier protein transacylase lipid metabolism 3.0 SAOUHSC_01218 SucD succinyl-CoA synthetase subunit alpha carbohydrate metabolism 4.0 SAOUHSC_01261 CinA competence-damage inducible protein stress response 2.6 SAOUHSC_01264 71 aa protein uncharacterized 18.4 SAOUHSC_01346 OpuD proline/choline/glycine betaine transporter transporter 3.0 SAOUHSC_01348...”
- The conserved regulatory RNA RsaE down-regulates the arginine degradation pathway in Staphylococcus aureus
Rochat, Nucleic acids research 2018 - “...Gene Annotation RsaE** + RsaE*** TCA cycle SAOUHSC_01216 sucC Succinyl-CoA synthetase, beta subunit 2.69 0.64 SAOUHSC_01218 sucD Succinyl-CoA synthetase, alpha subunit 2.40 0.63 SAOUHSC_01347 citB Aconitate hydratase 1 1.82 0.38 SAOUHSC_01416 sucB 2-oxoglutarate dehydrogenase, E2 component 1.35 0.53 SAOUHSC_01418 sucA 2-oxoglutarate dehydrogenase, E1 component 1.36 0.48...”
- Bacterial Hypoxic Responses Revealed as Critical Determinants of the Host-Pathogen Outcome by TnSeq Analysis of Staphylococcus aureus Invasive Infection
Wilde, PLoS pathogens 2015 - “...(5 genes). In the TCA cycle, mutations in genes sucB (SAOUHSC_01416), sucC (SAOUHSC_01216), and sucD (SAOUHSC_01218), which encode enzymes responsible for the conversion of -ketoglutarate to succinate, each resulted in compromised growth during osteomyelitis. Moreover, genes encoding enzymes in pathways that feed into the TCA cycle...”
- The Staphylococcus aureus KdpDE two-component system couples extracellular K+ sensing and Agr signaling to infection programming
Xue, Infection and immunity 2011 - “...SAOUHSC_00899 SAOUHSC_02118 SAOUHSC_01191 SAOUHSC_01216 SAOUHSC_01218 SAOUHSC_00195 SAOUHSC_00196 SAOUHSC_00197 SAOUHSC_00198 SAOUHSC_00199 SAOUHSC_00206...”
- Advantage of upregulation of succinate dehydrogenase in Staphylococcus aureus biofilms
Gaupp, Journal of bacteriology 2010 - “...SucD, succinyl-CoA synthetase subunit alpha (SAOUHSC_01218); SdhC, succinate dehydrogenase cytochrome b558 subunit (SAOUHSC_01103); SdhA, succinate...”
- Redox sensing by a Rex-family repressor is involved in the regulation of anaerobic gene expression in Staphylococcus aureus
Pagels, Molecular microbiology 2010 - “...Pyc 2 1.4 (11.4) 1.7 (1.4) 5.3 (6.8) 0.3 (0.2) 0.3 (1.7) SACOL1123 Pyruvate carboxylase SAOUHSC_01218 SucD 1.4 (1.1) 3.8 (1.5) 1.6 (1.2) 2.4 (1.3) 0.9 (0.9) SACOL1263 Succinyl-CoA synthetase subunit alpha SAOUHSC_01266 1.3 (1.2) 5.5 (4.4) 6.5 (5.2) 0.8 (0.8) 0.2 (0.2) SACOL1308 Pyruvate ferredoxin...”
- Defining the Roles of Pyruvate Oxidation, TCA Cycle, and Mannitol Metabolism in Methicillin-Resistant Staphylococcus aureus Catheter-Associated Urinary Tract Infection
Paudel, Microbiology spectrum 2023 - “...TCA cycle enzyme fumarase ( fumC , SAUSA300_1801), (iii) succinyl CoA synthase ( sucD , SAUSA300_1139), or (iv) mannitol metabolism enzyme mannitol-1-phosphate dehydrogenase, also known as M1PDH ( mtlD , SAUSA300_2108). MRSA 1369 sucD and fumC mutants did not show delayed in vitro growth in HU,...”
- “...b NE1263 SAUSA300_2108 mtlD 0.42 0.48 2.88 b NE1610 SAUSA300_0996 lpdA 0.59 0.43 0.66 NE1770 SAUSA300_1139 sucC 0.36 0.49 4.09 b a Log 2 (FC) refers to average log 2 (fold change) of normalized counts for triplicate samples, MRSA 1369 exposed for 2 h in vitro...”
- Identification of Methicillin-Resistant Staphylococcus aureus (MRSA) Genetic Factors Involved in Human Endothelial Cells Damage, an Important Phenotype Correlated with Persistent Endovascular Infection
Xiao, Antibiotics (Basel, Switzerland) 2022 - “...SAUSA300_0068 hypothetical cadmium-exporting ATPase, truncation 2.79 a 8.85 SAUSA300_1870 hypothetical hypothetical protein 2.92 a 15.58 SAUSA300_1139 sucD succinyl-CoA synthetase subunit alpha 2.94 a 8.32 SAUSA300_0918 ugtP diacylglycerol glucosyltransferase 3.09 a 8.63 SAUSA300_0597 hypothetical putative endonuclease III 3.15 a 14.78 SAUSA300_0326 hypothetical hypothetical protein 3.64 a 2.40...”
- Human Urine Alters Methicillin-Resistant Staphylococcus aureus Virulence and Transcriptome
Paudel, Applied and environmental microbiology 2021 (secret) - Heparin Mimics Extracellular DNA in Binding to Cell Surface-Localized Proteins and Promoting Staphylococcus aureus Biofilm Formation
Mishra, mSphere 2017 - “...acid dehydratase 3 3 15 None SAUSA300_2190 30S ribosomal protein S8 2 3 24 None SAUSA300_1139 Succinyl-CoA synthetase, alpha subunit 5 5 26 GRKTRL SAUSA300_0531 30S ribosomal protein S7 2 3 19 None SAUSA300_0672 MarR family transcriptional regulator 3 3 30 None SAUSA300_0688 Oxidoreductase/aldo-keto reductase family...”
- Network-based genetic investigation of virulence-associated phenotypes in methicillin-resistant Staphylococcus aureus
Kim, Scientific reports 2018 - “...blood agar plates (see the Methods section for more details). Among the 10 tested genes, SAUSA300_RS06165, which encodes succinyl-CoA ligase subunit alpha, produced the gamma-hemolysis (non-hemolytic) phenotype in a mutant strain, whereas the wild-type strain exhibited the beta-hemolysis (complete hemolysis) phenotype (Fig. 4A ). We also...”
- “...strain ( P -value=0.0013, two-tailed t-test) (Fig. 4B ). As expected, the novel hemolysis gene SAUSA300_RS06165 was highly connected to the guide genes, and the updated network of hemolysis genes showed significantly higher within-group edge count score than those for random gene sets (Fig. 4C )....”
Q6GHI9 Succinate--CoA ligase [ADP-forming] subunit alpha from Staphylococcus aureus (strain MRSA252)
65% identity, 95% coverage
Q8NX01 Succinate--CoA ligase [ADP-forming] subunit alpha from Staphylococcus aureus (strain MW2)
65% identity, 95% coverage
RPA0190 succinyl-CoA synthetase alpha-subunit from Rhodopseudomonas palustris CGA009
66% identity, 97% coverage
RDJ18_RS08935 succinate--CoA ligase subunit alpha from Staphylococcus aureus
65% identity, 95% coverage
- Multiomics analysis of Staphylococcus aureus ST239 strains resistant to virulent Herelleviridae phages
Kornienko, Scientific reports 2024 - “...acid cycle, evidenced by reduced abundance of dihydrolipoyllysine-residue succinyltransferase (RDJ18_RS08040) and succinateCoA ligase subunit alpha (RDJ18_RS08935), along with changes in gluconeogenesis attributed to underrepresentation of the key enzyme, phosphoenolpyruvate carboxykinase (RDJ18_RS06075). Compensating for decreased energy production through the tricarboxylic acid cycle, there was an increased abundance...”
BC3833 Succinyl-CoA synthetase alpha chain from Bacillus cereus ATCC 14579
66% identity, 95% coverage
GRMZM2G072054 succinyl-CoA ligase alpha-chain 2 from Zea mays
66% identity, 86% coverage
A9HRF1 Succinate--CoA ligase [ADP-forming] subunit alpha from Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
GDI_2952 succinate--CoA ligase subunit alpha from Gluconacetobacter diazotrophicus PA1 5
65% identity, 97% coverage
- Arabidopsis thaliana exudates induce growth and proteomic changes in Gluconacetobacter diazotrophicus
Dos, PeerJ 2020 - “...protein GDI0354 8.00 4,390.16 0.47 A9H073 Alcohol dehydrogenase GroES domain protein GDI_3142 4.00 1,094.65 0.48 A9HRF1 Succinate--CoA ligase (ADP-forming) subunit alpha sucD 5.00 2,866.13 0.51 A9HPH9 10 kDa chaperonin groS 5.00 4,835.59 0.54 A9HNP0 D-xylose ABC transporter, periplasmic substrate-binding protein xylF 18.00 13,607.54 0.58 A9HK34 Cold-shock...”
- Transcriptomic Response of the Diazotrophic Bacteria Gluconacetobacter diazotrophicus Strain PAL5 to Iron Limitation and Characterization of the fur Regulatory Network
Soares, International journal of molecular sciences 2022 - “...and phosphoenolpyruvate dikinase (GDI_1318) were upregulated in the presence of iron. The sucCD genes (GDI_2951; GDI_2952) involved in TCA, proponoate and C-5 Branched were also upregulated. In addition, the cyoA gene (GDI_2035), which codes for cytochrome ubiquinol oxidase subunit II, and cyoB (GDI_2101), which codes for...”
SUCA2_SOLLC / Q6DQL1 Succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial; Succinyl-CoA synthetase subunit alpha-2; SCS-alpha-2; EC 6.2.1.5 from Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (see paper)
66% identity, 85% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
subunit: Heterodimer of an alpha and a beta subunit. - Integrative Omics Analysis of Three Oil Palm Varieties Reveals (Tanzania × Ekona) TE as a Cold-Resistant Variety in Response to Low-Temperature Stress.
Saand, International journal of molecular sciences 2022 - “...stress [ 6 ]. Two Succinate-CoA ligase [ADP-forming] subunit beta and alpha-2 proteins (Q6K9N6 and Q6DQL1) were suppressed in BE, whereas Q6K9N6 was expressed in the TE variety. Succinate-CoA ligase [ADP-forming] subunit beta was suppressed in brassica leaves in response to cold stress [ 79 ]....”
S101446_00032 succinate--CoA ligase subunit alpha from Komagataeibacter europaeus
65% identity, 98% coverage
Cagg_2819 succinyl-CoA synthetase, alpha subunit from Chloroflexus aggregans DSM 9485
64% identity, 97% coverage
EIO_0116, KVC_0104, KVU_2456 succinate--CoA ligase subunit alpha from Ketogulonicigenium vulgare
64% identity, 97% coverage
- Reconstruction and analysis of carbon metabolic pathway of Ketogulonicigenium vulgare SPU B805 by genome and transcriptome
Wang, Scientific reports 2018 - “...TCA 1.2.4.2 KVC_0103 KvSKV_01120 KVH_01115 KVU_2455 EIO_0115 SucDC TCA 6.2.1.5 KVC_0104 KvSKV_11895 KVH_01125 KVU_2456, 2457 EIO_0116, 0117 SdhA TCA 1.3.5.4 KVC_0109-0111, 0115 KvSKV_01155 KVH_01150 KVU_2460-2462 EIO_0120-0122, 0126 FumC TCA 4.2.1.2 KVC_1668 KvSKV_07885 KVH_07915 KVU_1117 EIO_1646 Mdh TCA 1.1.1.37 KVC_0106 KvSKV_01135 KVH_01130 KVU_2458 EIO_0118 Abbreviations: Glucokinase (Glk),...”
- “...KvSKV_08965 KVH_09010 KVU_1326 EIO_1866 SucA TCA 1.2.4.2 KVC_0103 KvSKV_01120 KVH_01115 KVU_2455 EIO_0115 SucDC TCA 6.2.1.5 KVC_0104 KvSKV_11895 KVH_01125 KVU_2456, 2457 EIO_0116, 0117 SdhA TCA 1.3.5.4 KVC_0109-0111, 0115 KvSKV_01155 KVH_01150 KVU_2460-2462 EIO_0120-0122, 0126 FumC TCA 4.2.1.2 KVC_1668 KvSKV_07885 KVH_07915 KVU_1117 EIO_1646 Mdh TCA 1.1.1.37 KVC_0106 KvSKV_01135 KVH_01130...”
- “...EIO_1866 SucA TCA 1.2.4.2 KVC_0103 KvSKV_01120 KVH_01115 KVU_2455 EIO_0115 SucDC TCA 6.2.1.5 KVC_0104 KvSKV_11895 KVH_01125 KVU_2456, 2457 EIO_0116, 0117 SdhA TCA 1.3.5.4 KVC_0109-0111, 0115 KvSKV_01155 KVH_01150 KVU_2460-2462 EIO_0120-0122, 0126 FumC TCA 4.2.1.2 KVC_1668 KvSKV_07885 KVH_07915 KVU_1117 EIO_1646 Mdh TCA 1.1.1.37 KVC_0106 KvSKV_01135 KVH_01130 KVU_2458 EIO_0118 Abbreviations:...”
Caur_0702 succinyl-CoA synthetase, alpha subunit from Chloroflexus aurantiacus J-10-fl
64% identity, 97% coverage
MXAN_3542 succinyl-CoA synthetase, alpha subunit from Myxococcus xanthus DK 1622
63% identity, 96% coverage
GRMZM2G039251 succinyl-CoA ligase alpha-chain 2 from Zea mays
65% identity, 86% coverage
FHQ18_05960 succinate--CoA ligase subunit alpha from Deferribacter autotrophicus
64% identity, 97% coverage
- Genomic Insights into the Carbon and Energy Metabolism of a Thermophilic Deep-Sea Bacterium Deferribacter autotrophicus Revealed New Metabolic Traits in the Phylum Deferribacteres
Slobodkin, Genes 2019 - “...ferredoxin oxidoreductase (FHQ18_01050, FHQ18_01055; FHQ18_05965, FHQ18_05970, FHQ18_05975, FHQ18_05980; FHQ18_06355, FHQ18_06360, FHQ18_06365, FHQ18_06370), succinyl-CoA ligase (FHQ18_05955, FHQ18_05960), succinate dehydrogenase (FHQ18_05990, FHQ18_05995), fumarate hydratase (FHQ18_05155), and malate dehydrogenase (FHQ18_05950). Acetate can enter TCA after activation to acetyl-CoA either in a single-step reaction, catalyzed by an acetyl-CoA synthetase (FHQ18_05360;...”
GSU1059 succinyl-CoA synthase, alpha subunit from Geobacter sulfurreducens PCA
65% identity, 98% coverage
- Proteomic Analysis of a Syntrophic Coculture of Syntrophobacter fumaroxidans MPOBT and Geobacter sulfurreducens PCAT
Mollaei, Frontiers in microbiology 2021 - “...et al., 2021 ). Succinyl-CoA synthetase subunits (SucA; GSU2449, SucB; GSU2448, SucC; GSU1058, and SucD; GSU1059) were mostly more abundant in the SF-GS coculture (2-, 2-, 31-, and 58-fold, respectively) compared to the GS pure culture ( Figure 5 ). In the previous studies, GS in...”
- Comparative proteomics of Geobacter sulfurreducens PCAT in response to acetate, formate and/or hydrogen as electron donor
Mollaei, Environmental microbiology 2021 - “...). Interestingly, the four subunits of this enzyme (SucA; GSU2449, SucB; GSU2448, SucC; GSU1058, SucD; GSU1059) were more abundant in the hydrogen (2.5, 3.8, 4.8, 6.8 fold, respectively), formate (2.3, 5.7, 1.2, 4.8 fold, respectively) compared to the acetate containing conditions (Fig. 3 ). In contrast,...”
- The hidden chemolithoautotrophic metabolism of Geobacter sulfurreducens uncovered by adaptation to formate
Zhang, The ISME journal 2020 - “...and sucCDfusDN/sucCDDN 582 bp downstream from sucD (GSU1059) with G. sulfurreducens T17-3 genomic DNA as template. The KmRXhoIUp/ KmRXbaIDn primer pair...”
- Laboratory evolution of Geobacter sulfurreducens for enhanced growth on lactate via a single-base-pair substitution in a transcriptional regulator
Summers, The ISME journal 2012 - “...AACATGGAT-30 and the succinyl CoA synthetase b-subunit, GSU1059 (sucD), 50 -GGTCTCTTCCATA CCCAGCA-30 and 50 -TTGAAGACCGGTATCCCTT C-30 . The relative abundance...”
- “...of the succinyl-CoA transferase enzymes, GSU1058 (sucC) and GSU1059 (sucD), was significantly higher than in wild-type cells in each of the adaptively evolved...”
- DNA microarray and proteomic analyses of the RpoS regulon in Geobacter sulfurreducens
Núñez, Journal of bacteriology 2006 - “...as succinyl coenzyme A synthase (GSU1058 and GSU1059), aconitate hydratase 2 (AcnB) (GSU1660), and NADP-dependent isocitrate dehydrogenase (GSU1465), was...”
TGME49_290600 succinyl-CoA-synthetase alpha SCSA from Toxoplasma gondii ME49
B9PTH6 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Toxoplasma gondii (strain ATCC 50861 / VEG)
63% identity, 86% coverage
SUCA_BLAHN / B3FHT4 Succinate--CoA ligase [ADP-forming] subunit alpha; Succinyl-CoA synthetase subunit alpha; SCS-alpha; EC 6.2.1.5 from Blastocystis sp. subtype 1 (strain ATCC 50177 / NandII) (see paper)
66% identity, 90% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
subunit: Heterodimer of an alpha and a beta subunit.
G3HQ05 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial from Cricetulus griseus
67% identity, 85% coverage
UH47_05215 succinate--CoA ligase subunit alpha from Staphylococcus pseudintermedius
63% identity, 95% coverage
EGR_08424 Succinyl-CoA ligase [GDP-forming] subunit alpha from Echinococcus granulosus
65% identity, 86% coverage
- Unraveling oxidative stress response in the cestode parasite Echinococcus granulosus
Cancela, Scientific reports 2019 - “...small nuclear RNA auxiliary factor 2) EgrG_000625400 0.014 0.0037978 0.00622035 1.63 Succinyl-CoA synthetase subunit alpha EGR_08424 0.03 0.015809 0.047168 2.98 Zinc phosphodiesterase elac protein 1 EgrG_000149350 0.0089 0.00665745 0.0261045 3.92 a Protein accession codes were retrieved from E. granulosus genome annotation available on WormBase ParaSite (...”
R4G324 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial from Rhodnius prolixus
64% identity, 87% coverage
SUCA_DICDI / P36967 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; Succinyl-CoA synthetase subunit alpha; SCS-alpha; p36; EC 6.2.1.4; EC 6.2.1.5 from Dictyostelium discoideum (Social amoeba) (see paper)
69% identity, 90% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and specificity for either ATP or GTP is provided by different beta subunits.
catalytic activity: GTP + succinate + CoA = succinyl-CoA + GDP + phosphate (RHEA:22120)
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
subunit: Heterodimer of an alpha and a beta subunit. Different beta subunits determine nucleotide specificity. Together with an ATP- specific beta subunit, forms an ADP-forming succinyl-CoA synthetase (A- SCS). Together with a GTP-specific beta subunit forms a GDP-forming succinyl-CoA synthetase (G-SCS).
UWK_01582 succinate--CoA ligase subunit alpha from Desulfocapsa sulfexigens DSM 10523
60% identity, 97% coverage
LOC115876190 succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial-like from Sitophilus oryzae
63% identity, 88% coverage
sucD / O84829 succinyl-CoA ligase, subunit alpha (EC 6.2.1.5) from Chlamydia trachomatis (strain D/UW-3/Cx) (see 2 papers)
CT822 Succinyl-CoA Synthetase, Alpha from Chlamydia trachomatis D/UW-3/CX
61% identity, 97% coverage
Mal48_48200 succinate--CoA ligase subunit alpha from Thalassoglobus polymorphus
61% identity, 95% coverage
B9RL91 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Ricinus communis
66% identity, 85% coverage
- Proteomic Analysis of Embryo Isolated From Mature Jatropha curcas L. Seeds
Ramzan, Frontiers in plant science 2022 - “...Jcr4S09697.10 Aconitate hydratase (Aconitase) B9SXB6 AT4G35830.1 Jcr4S00736.30 Aconitate hydratase (Aconitase) B9T2U5 AT2G05710.1 Jcr4S00125.80 Succinyl-CoA synthetase B9RL91 AT5G23250.1 Jcr4s06387.30 Succinyl-CoA synthetase B9RL91 AT5G23250.1 Jcr4S03295.10 Malate dehydrogenase B9SE47 AT1G53240.1 Jcr4S00279.20 Malate dehydrogenase B9T5E4 AT5G43330.1 Jcr4s00055.90 Cytochrome C oxidase, putative B9RV06 AT1G80230.1 Jcr4s01269.80 ATP synthase subunit beta B9T1V8 AT5G08680.1...”
WP_035454724 succinate--CoA ligase subunit alpha from Bartonella bacilliformis str. Heidi Mejia
60% identity, 96% coverage
NP_001119263 Succinyl-CoA ligase, alpha subunit from Arabidopsis thaliana
70% identity, 84% coverage
- Transcriptome analysis of Thapsia laciniata Rouy provides insights into terpenoid biosynthesis and diversity in Apiaceae
Drew, International journal of molecular sciences 2013 - “...162552 Dihydrolipoyllysine succinyltransferase NP_200318 Comp2028 (71%) 35422 Dihydrolipoyl dehydrogenase NP_567487 Comp12031 (84%) 7805 Succinyl-CoA synthetase NP_001119263 Comp3388 (90%) 28993 Succinate dehydrogenase flavoprotein subunit NP_201477 Comp2812 (94%) 29604 Succinate dehydrogenase iron-sulfur subnunit NP_001118718 Comp3447 (76%) 21231 Fumarase NP_001078075 Comp8438 (87%) 13149 Malate dehydrogenase NP_190336 Comp4342 (77%) 19283...”
A1UQW0 Succinate--CoA ligase [ADP-forming] subunit alpha from Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
WP_005765714 succinate--CoA ligase subunit alpha from Bartonella bacilliformis
60% identity, 96% coverage
AOV_00660 succinate--CoA ligase subunit alpha from Anaplasma ovis str. Haibei
66% identity, 98% coverage
- The Anaplasma ovis genome reveals a high proportion of pseudogenes
Liu, BMC genomics 2019 - “...msp34 438 X AOV_03915 2426 AOV_00115 omp14 573 X AOV_00035 1158 AOV_00515 sucD 223 X AOV_00660 885 AOV_01020 thiE 384 X AOV_01015 1026 AOV_01025 thiE 252 X AOV_01820 msp1a 1611 X AOV_01835 2175 AOV_01970 infB 387 X AOV_02590 2502 AOV_01975 infB 702 X AOV_02035 pccB 2035...”
U3J6J0 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial from Anas platyrhynchos platyrhynchos
67% identity, 86% coverage
LIC12574 succinyl-CoA synthetase alpha subunit from Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
58% identity, 98% coverage
- Global proteome analysis of Leptospira interrogans
Eshghi, Journal of proteome research 2009 - “...1.187 Thiosulfate sulfurtransferase LIC11115 0.7121.524 0.520.595 1.229 0.9231.332 0.5530.758 1.286 1.257 Succinyl-CoA synthetase, alpha subunit LIC12574 1.0271.095 0.6850.805 1.270 NS NS NS 1.270 Acyl dehydratase LIC12739 NS NS NS 0.7621.936 0.3620.634 1.310 1.310 NADH dehydrogenase (ubiquinone), E chain LIC12745 0.8381.36 0.4130.759 1.402 NS NS NS 1.402...”
- Response of Leptospira interrogans to physiologic osmolarity: relevance in signaling the environment-to-host transition
Matsunaga, Infection and immunity 2007 - “...LIC12404 LIC11363 LIC12765 LIC12217 LIC12573 LIC13421 LIC12574 LIC13430 LIC20149 LIC20079 LIC12233 LIC12331 LIC13353 LIC20085 LIC13321 LIC13194 LIC13202...”
- “...expression of the sucCD operon (LIC12573 and LIC12574), encoding the and subunits of succinyl-CoA synthetase. Hence, the transition to physiological osmolarity...”
NP_102940 succinyl-CoA synthetase alpha subunit from Mesorhizobium loti MAFF303099
59% identity, 99% coverage
P13086 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial from Rattus norvegicus
67% identity, 82% coverage
- Caffeine causes cell cycle arrest at G0/G1 and increases of ubiquitinated proteins, ATP and mitochondrial membrane potential in renal cells.
Kanlaya, Computational and structural biotechnology journal 2023 - “...Sf3b3 27.8 2.1 2/2 135.6 9.180.39 5.111.33 0.56 0.0097 Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial P13086 Suclg1 44.5 13.6 4/4 36.2 11.631.28 7.330.96 0.63 0.0159 Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial Q3MHX5 SUCLG2 46.3 5.8 2/2 46.7 0.500.50 2.860.76 5.73 0.0194 SUMO-activating enzyme subunit 1 A2VE14...”
- Transcriptome analysis of genes and pathways associated with metabolism in Scylla paramamosain under different light intensities during indoor overwintering.
Li, BMC genomics 2020 - “...2.6429 0.0005 Malate dehydrogenase Q5NVR2 0.5229 0.0204 0.4403 0.0009 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial P13086 0.5567 0.0452 0.4452 0.0016 Malate dehydrogenase Q3T145 0.3996 0.0010 0.4326 0.0006 Cytoplasmic aconitate hydratase Q0VCU1 0.4902 0.0109 0.5738 0.0262 Isocitrate dehydrogenase [NADP] Q04467 0.4560 0.0079 0.5210 0.0216 Dihydrolipoyllysine-residue succinyltransferase component...”
- Nitric Oxide Donor NOC-18-Induced Changes of Mitochondrial Phosphoproteome in Rat Cardiac Ischemia Model.
Umbrasas, Medicina (Kaunas, Lithuania) 2019 - “...mitochondrial (IVD) P12007 1.59 0.030 Succinyl CoA ligase ADP GDP forming subunit alpha mitochondrial (SUCLG1) P13086 1.62 0.030 Lon protease homolog mitochondrial (LONP1) Q924S5 1.75 0.032 Hexaprenyldihydroxybenzoatemethyltransferase mitochondrial (COQ3) Q63159 1.67 0.032 Citrate synthase mitochondrial (CS) Q8VHF5 1.57 0.034 3-ketoacyl CoA thiolase mitochondrial (ACAA2) P13437 1.57...”
- Oxidative cross-linking of proteins to DNA following ischemia-reperfusion injury.
Groehler, Free radical biology & medicine 2018 - “...7 36.59 7.38 P35434 ATP synthase subunit delta, mitochondrial 13.69 2 11 2 17.58 6.98 P13086 Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial 9.54 3 4 3 36.13 6.66 P04642 L-lactate dehydrogenase A chain 9.64 3 5 2 36.43 6.46 P14604 Enoyl-CoA hydratase, mitochondrial 32.41 9 22...”
- A threshold of endogenous stress is required to engage cellular response to protect against mutagenesis.
Saintigny, Scientific reports 2016 - “...factor 1-alpha 1 P10126 1 2,87 PAI1 RNA-binding protein 1 Q6AXS5 1 2,87 Succinyl-CoA ligase P13086 2 1,56 SUMO-conjugating enzyme UBC9 P63280 4 1,53 Peptidyl-prolyl cis-trans isomerase A P14851 4 1,53 Peptidyl-prolyl cis-trans isomerase A P14851 6 1,45 U2 small nuclear ribonucleoprotein A P57784 7 1,83...”
- “...Transketolase P40142 9 1,93 Fructose-bisphosphate aldolase A P05065 40 1,47 Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha P13086 40 1,47 3 Peptidyl-prolyl cis-trans isomerase B P24368 3 1,69 Protein NipSnap homolog 3B Q9CQE1 5 1,79 Protein disulfide-isomerase A5 Q921X9 15 1,67 TCP-1-zeta P80317 15 1,67 Proteasome subunit beta...”
- Quantitative characterization of changes in the cardiac mitochondrial proteome during anesthetic preconditioning and ischemia.
Bienengraeber, Physiological genomics 2013 - Mitochondrial proteomic analysis reveals deficiencies in oxygen utilization in medullary thick ascending limb of Henle in the Dahl salt-sensitive rat.
Zheleznova, Physiological genomics 2012 - A proteomic survey of rat cerebral cortical synaptosomes
Witzmann, Proteomics 2005 - “...VP3B VPP1 Q9QUH6 P07632 P07895 P16086 P51650 P32851 P13086 0O55170 Q62910 P09951 Q63537 P07825 P21707 P29101 P47861 P37377 Q63754 P19332 P04691 P46462 P17764...”
LMJF_25_2130 putative succinyl-CoA synthetase alpha subunit from Leishmania major strain Friedlin
Q4Q9M4 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Leishmania major
65% identity, 95% coverage
- Identification of protein profile in metacyclic and amastigote-like stages of Leishmania tropica: a proteomic approach
Ashrafmansouri, AMB Express 2022 - “...Putative 60S ribosomal protein L7 KILQLLR, AVEPYIAYGYPSLATVR 35.55 Q4Q9M4 SuccinateCoA ligase [ADP-forming] subunit alpha, mitochondrial LMJF_25_2130 VIVQGMTGK, VVGGVSPK, VIVQGMTGK, AGTFHTK 3.93 Q4Q9R2 Polyprenol reductase EnCR DLGPQIGYR, ELESMFVHK, FSHPTMPMR 2.22 Q4Q9V1 GTP-binding nuclear protein LMJF_25_1420 LILVGDGGTGK, SNYNFEKPFVWLAK, VCDNIPIVLVGNK 5.74 Q4Q9Y0 Putative cytochrome c oxidase VII LMJF_25_1130 IPNPFAYSFK,...”
- Identification of protein profile in metacyclic and amastigote-like stages of Leishmania tropica: a proteomic approach
Ashrafmansouri, AMB Express 2022 - “...translocating pyrophosphatase 1 LMJF_31_1220 QFQDPEVAEGR 3.81 Q4Q9H4 Putative 60S ribosomal protein L7 KILQLLR, AVEPYIAYGYPSLATVR 35.55 Q4Q9M4 SuccinateCoA ligase [ADP-forming] subunit alpha, mitochondrial LMJF_25_2130 VIVQGMTGK, VVGGVSPK, VIVQGMTGK, AGTFHTK 3.93 Q4Q9R2 Polyprenol reductase EnCR DLGPQIGYR, ELESMFVHK, FSHPTMPMR 2.22 Q4Q9V1 GTP-binding nuclear protein LMJF_25_1420 LILVGDGGTGK, SNYNFEKPFVWLAK, VCDNIPIVLVGNK 5.74 Q4Q9Y0...”
- Comparative Proteomic Profiling of Leishmania tropica: Investigation of a Case Infected with Simultaneous Cutaneous and Viscerotropic Leishmaniasis by 2-Dimentional Electrophoresis and Mass Spectrometry
Hajjaran, Iranian journal of parasitology 2015 - “...Q4QFN8 5.72/36 5.6/32 85 0.074 0.013 0.030 0.012 0.40 374 succinyl-CoA synthetase alpha subunit, putative Q4Q9M4 4.77/38 9.2/31 313 0.000 0.000 0.023 0.010 DS 377 dihydroorotate dehydrogenase Q4QEW7 4.93/39 5.7/35 83 0.030 0.007 0.006 0.003 0.21 381 hypothetical protein, conserved (Enkurin superfamily) * Q4QAX0 4.65/36 9.0/31...”
A4I1R2 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Leishmania infantum
65% identity, 95% coverage
- Potential selection of antimony and methotrexate cross-resistance in Leishmania infantum circulating strains
Bernardo, PLoS neglected tropical diseases 2024 - “...LINF 020009800 Voltage-dependent anion-selective channel-putative 48.47 48.12 0.35 A4ID05 LINF 360048000 Adenosylhomocysteinase 51.22 50.91 0.31 A4I1R2 LINF 250028300 Succinate-CoA ligase [ADP-forming] subunit alpha 45.44 45.16 0.28 A4I120 LINF 240027300 3-hydroxy-3-methylglutaryl-CoA synthase- putative 48.54 48.27 0.27 A4HUX3 LINF 110012000 Aminopeptidaseputative 49.4 49.15 0.25 E9AHM9 LINF 330009000 Heat...”
- “...A synthetase 48.69 46.87 1.82 A4HZF8 LINF 210024300 ATP-dependent RNA helicase SUB2putative 45.77 44.11 1.66 A4I1R2 LINF 250028300 Succinate CoA ligase [ADP-forming] subunit alpha 47.27 45.67 1.6 A4I1Z8 LINF 260011600 protein disulfide isomeraseputative 46.5 44.91 1.59 E9AG68 LINF 060011300 Putative 60S ribosomal protein L23a 44.57 43.04...”
WP_041849026 succinate--CoA ligase subunit alpha from Bartonella bacilliformis Ver097
59% identity, 96% coverage
- Immunogenic Peptides from Pap31 and SCS-α of Bartonella bacilliformis: One Step Closer to a Rapid Diagnostic Tool for Carrion's Disease
Gomes, Pathogens (Basel, Switzerland) 2021 - “...B. bacilliformis genomes present in GenBank, while in the remaining genome (strain Ver097, Reference Sequence: WP_041849026), 1 amino acid difference was observed. In contrast to Pap-31-8, both SCS--12 and SCS--15 peptides showed high identity with other members of the Bartonella genus, including all the human pathogenic...”
- “...IFASVAEGKEKTGANA 93.75 Bartonella bacilliformis 10 SCS- WP_005765714 IFASV T EGKEKTGANA 93.75 Bartonella bacilliformis 6 SCS- WP_041849026 IFASVAEGKEKT E ANA 93.75 Bartonella ancashesis 10 SCS- WP_053943861 IFASV M EGKEKTGANA 93.75 Bartonella alsatica SCS- WP_005866529 IFASVAEGKEKTGA D A 93.75 Bartonella clarridgeiae SCS- WP_013545653 IFASVVEGKEKTGANA 93.75 Bartonella henselae SCS-...”
WP_013545653 succinate--CoA ligase subunit alpha from Bartonella clarridgeiae ATCC 51734
61% identity, 95% coverage
BT_0787 succinyl-CoA synthetase alpha chain from Bacteroides thetaiotaomicron VPI-5482
57% identity, 96% coverage
WP_202320107 succinate--CoA ligase subunit alpha from Archaeoglobus neptunius
56% identity, 97% coverage
Q9WUM5 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial from Mus musculus
NP_063932 succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial precursor from Mus musculus
67% identity, 82% coverage
- Neuronal SIRT3 Deletion Predisposes to Female-Specific Alterations in Cellular Metabolism, Memory, and Network Excitability
Pearson-Smith, The Journal of neuroscience : the official journal of the Society for Neuroscience 2023 (secret) - Treatment of microglia with Anti-PrP monoclonal antibodies induces neuronal apoptosis in vitro
Adhikari, Heliyon 2021 - “...cassette sub-family A member 8-A Abca8a Plasma membrane 2 60 0.00447174 12.7 Antibody Treatment Control Q9WUM5 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha_ mitochondrial Suclg1 Mitochondrion 4 68.1 0.04593013 17.1 Antibody Treatment Control Q80XC6 Nuclear exosome regulator NRDE2 Nrde2 Nucleus 2 46.5 0.04874164 28.8 Antibody Treatment Control Q99JW2...”
- Identification of chronic brain protein changes and protein targets of serum auto-antibodies after blast-mediated traumatic brain injury
Harper, Heliyon 2020 - “...kDa 1 Q8C419 Gpr158 Succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial IPI00406442 (+1) 36 kDa 1 Q9WUM5 Suclg1 LYR motif-containing protein 4 IPI00169804 11 kDa 1 Q8K215 Lyrm4 Phosphorylase b kinase regulatory subunit beta IPI00380735 124 kDa 1 Q7TSH2 Phkb Dihydropyrimidinase-related protein 2 IPI00114375 62 kDa 1...”
- PAX2 promotes epithelial ovarian cancer progression involving fatty acid metabolic reprogramming.
Feng, International journal of oncology 2020 - “...7 1.25 Up 0.0396 Tricarboxylic acid cycle Q9CZU6 Cs Citrate synthase, mitochondrial 1.14 - 0.1691 Q9WUM5 Suclg1 Succinyl-CoA ligase [ADP/GDP-forming] subunit , mitochondrial 1.55 Up 0.0112 Q8K2B3 Sdha Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 1.23 Up 0.0374 P97807 Fh, Fh1 Fumarate hydratase, mitochondrial 1.21 - 0.0524...”
- Sirt3 regulates adipogenesis and adipokine secretion via its enzymatic activity.
Ma, Pharmacology research & perspectives 2020 - “...MICOS complex subunit Mic60 TSSVTLQTITAQNAAVQAVKAHSNILK 2.5 K256 Q05920 Pyruvate carboxylase LDNASAFQGAVISPHYDSLLVKVIAHGK 2.35 K428 TLHIKALAVSDLNR K1041 Q9WUM5 SuccinateCoA ligase [ADP/GDPforming] subunit alpha GGQKHLGLPVFNTVK 2.1 K94 Q60932 Voltagedependent anionselective channel protein 1 GYGFGLIKLDLK 2.1 K41 VNNSSLIGLGYTQTLKPGIK K265 Q03265 ATP synthase subunit alpha ITKFENAFLSHVISQHQSLLGNIR 1.85 K506 FNDGTDEKKK K241 HALIIYDDLSKQAVAYR...”
- The Effect of Neurotoxin MPTP and Neuroprotector Isatin on the Profile of Ubiquitinated Brain Mitochondrial Proteins
Buneeva, Cells 2018 - “...NACHT, LRR and PYD domains-containing protein 5 AT2A1_MOUSE Q8R429 Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 SUCA_MOUSE Q9WUM5 Succinate-CoA ligase (ADP/GDP-forming) subunit alpha, mitochondrial OAT_MOUSE P29758 Ornithine aminotransferase, mitochondrial MRP9_MOUSE Q80WJ6 Multidrug resistance-associated protein 9 DLDH_MOUSE O08749 Dihydrolipoyl dehydrogenase, mitochondrial CATB_MOUSE P10605 Cathepsin B CLH1_MOUSE Q68FD5 Clathrin heavy...”
- “...K DPQEPIMK K437 95.86 Q9CZU4 * GTPase Era, mitochondrial Eral1 LNPQVLQCLT K FSQVPSILVLN K225 93.35 Q9WUM5 Succinate-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial Suclg1 KA K PVVSFIAGITAPPGR K280 100.00 P05202 Aspartate aminotransferase, mitochondrial Got2 GINVCLCQSYA K NMGLYGER K279 93.83 P47791 Glutathione reductase, mitochondrial Gsr RDAYVSRLNTIYQNNLT K K141...”
- Integrating Cross-Linking Experiments with Ab Initio Protein-Protein Docking.
Vreven, Journal of molecular biology 2018 - “...Q51567 -subunit P53593 1SCU (89%/77%) 1OI7 (58%) none 2.72 (3.95/n/a) Homology/Bound 2E Succinyl-CoA ligase -subunit Q9WUM5 -subunit Q9Z2I8 1EUC (94%/93%) 1OI7 (55%) none 1.14 (1.71/n/a) Homology/Bound 2F Succinyl-CoA ligase -subunit Q9WUM5 -subunit Q9Z2I9 1EUC (94%/55%) 1OI7 (55%) none 1.12 (1.69/n/a) Homology/Bound 3A F1-ATP synthase -subunit P06576...”
- Success: evolutionary and structural properties of amino acids prove effective for succinylation site prediction.
López, BMC genomics 2018 - “...the succinylation sites of specific proteins. These proteins included succinate-CoA ligase subunit alpha (UniProtKB ID Q9WUM5) whose absence causes severe disorders with antenatal manifestations [ 70 ], serine hydroxymethyltransferase (UniProtKB ID B1XB26) which regulates the metabolic partitioning of methylenetetrahydrofolate [ 71 ], and glutamate dehydrogenase 1...”
- More
- SUCLG1 restricts POLRMT succinylation to enhance mitochondrial biogenesis and leukemia progression.
Yan, The EMBO journal 2024 - GeneRIF: SUCLG1 restricts POLRMT succinylation to enhance mitochondrial biogenesis and leukemia progression.
- Expression of two succinyl-CoA synthetases with different nucleotide specificities in mammalian tissues.
Lambeth, The Journal of biological chemistry 2004 (PubMed)- GeneRIF: ADP and GDP succinyl-CoA synthetases have different expression patterns and specificity
SUCA_COLLI / Q9YGD2 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; Succinyl-CoA synthetase subunit alpha; SCS-alpha; EC 6.2.1.4; EC 6.2.1.5 from Columba livia (Rock dove) (see paper)
66% identity, 92% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and specificity for either ATP or GTP is provided by different beta subunits.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
catalytic activity: GTP + succinate + CoA = succinyl-CoA + GDP + phosphate (RHEA:22120)
subunit: Heterodimer of an alpha and a beta subunit. Different beta subunits determine nucleotide specificity. Together with the ATP- specific beta subunit SUCLA2, forms an ADP-forming succinyl-CoA synthetase (A-SCS). Together with the GTP-specific beta subunit SUCLG2 forms a GDP-forming succinyl-CoA synthetase (G-SCS).
Smed_2942 succinyl-CoA synthetase subunit alpha from Sinorhizobium medicae WSM419
A6UDP1 Succinate--CoA ligase [ADP-forming] subunit alpha from Sinorhizobium medicae (strain WSM419)
61% identity, 96% coverage
B9JCF2 Succinate--CoA ligase [ADP-forming] subunit alpha from Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
61% identity, 96% coverage
SMc02481 PROBABLE SUCCINYL-COA SYNTHETASE ALPHA CHAIN PROTEIN from Sinorhizobium meliloti 1021
F7X0D4 Succinate--CoA ligase [ADP-forming] subunit alpha from Sinorhizobium meliloti (strain SM11)
61% identity, 96% coverage
PHATRDRAFT_42015 ligase succinate-coa ligase from Phaeodactylum tricornutum CCAP 1055/1
B7G0K7 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Phaeodactylum tricornutum (strain CCAP 1055/1)
66% identity, 94% coverage
- Examination of metabolic responses to phosphorus limitation via proteomic analyses in the marine diatom Phaeodactylum tricornutum
Feng, Scientific reports 2015 - “...reductase and related Zn-dependent oxidoreductase (PHATRDRAFT_18893) involved in photosynthetic phosphorylation pathway, and succinyl CoA synthetase (PHATRDRAFT_42015) involved in the pathway of substrate level phosphorylation. Succinyl CoA synthetase (SCS, also called succinate-CoA ligase or succinate thiokinase) is an enzyme catalyzing the reversible conversion of succinyl-CoA and succinate...”
- “...807 ATPase predicted ATPase activity and related to transmembrane transport 22416.78 5.39 100 33.33 -- PHATRDRAFT_42015 358 sucD succinate-CoA ligase 32783.49 5.03 61.8 13.27 ---- PHATRDRAFT_42434 116 ATPase putative ATPases of the AAA+ class 52465.2 6.44 84.3 12.19 --- PHATRDRAFT_43362 727 ESCO2 predicted ESCO2 (establishment of...”
- Proteomic and biochemical responses to different concentrations of CO2 suggest the existence of multiple carbon metabolism strategies in Phaeodactylum tricornutum
Wu, Biotechnology for biofuels 2021 - “...the TCA cycle, such as citrate synthase (B7G9P5, B7FYT1), two subunits of succinyl-CoA synthetase (B7FXA2, B7G0K7), succinate dehydrogenase-related proteins (B7FTX1, B5Y5N6), a predicted protein related to isocitrate dehydrogenase activity (B7FVA8) and another predicted protein (B7FUR4), were significantly upregulated under both HC and LC cultivation conditions (Fig....”
- Proteome response of Phaeodactylum tricornutum, during lipid accumulation induced by nitrogen depletion
Longworth, Algal research 2016 - “...Glutamine-fructose-6-phosphate transaminase 4 1.61 B7G518 Isocitrate lyase 3 1.90 B7FYD8 Kinase adenylate kinase 3 1.53 B7G0K7 Ligase succinate-coa ligase 3 1.58 B7G9G3 Lipoamide dehydrogenase 15 1.19 B7FYT9 Malate synthase 6 1.41 B7GCG9 PFP pyrophosphate dependent phosphofructokinase 11 1.58 B7GEI2 Phosphoglycerate mutase 4 1.87 B7G492 Phosphomannose mutase...”
An17g01670 uncharacterized protein from Aspergillus niger
64% identity, 85% coverage
- Identification of novel citramalate biosynthesis pathways in Aspergillus niger
Hossain, Fungal biology and biotechnology 2019 - “...103.38 107.27 88.87 8 ANI_1_1482094 An11g11280 Dihydrolipoyllysine-residue succinyltransferase Mito 168.01 172.17 158.22 198.85 9 ANI_1_230154 An17g01670 Succinyl-CoA ligase [GDP-forming] subunit alpha Mito 264.96 249.57 263.12 194.37 9 ANI_1_58124 An14g00310 Succinyl-CoA ligase [GDP-forming] subunit beta Mito 277.86 256.78 249.99 212.81 10 ANI_1_1750024 An02g12770 Succinate dehydrogenase [ubiquinone] flavoprotein...”
- Trancriptional landscape of Aspergillus niger at breaking of conidial dormancy revealed by RNA-sequencing
Novodvorska, BMC genomics 2013 - “...6.37 An18g06760 isocitrate dehydrogenase 3.17 55.23 354.46 6.41 An04g04750 oxoglutarate dehydrogenase 2.23 22.9 109.76 4.79 An17g01670 succinyl-CoA synthetase 5.36 24.29 128.98 5.31 Metabolism of internal carbohydrates An01g09290 neutral trehalase ( A. nidulans treB ) 5.01 719.2 58.5 12.29 An08g10510 tpsA , trehalose-6-phosphate synthase 48.49 124.99 2.69...”
- “...genes. Genes coding for putative isocitrate dehydrogenases (An08g05580, An18g06760), -ketoglutarate dehydrogenase An04g04750) and succinyl-CoA synthetase (An17g01670) exhibited increased transcript levels at the breaking of dormancy. After the onset of germination, we detected increased transcript levels of genes encoding putative subunits of the respiratory chain; cytochrome b...”
I3XDY7 Succinate--CoA ligase [ADP-forming] subunit alpha from Sinorhizobium fredii (strain USDA 257)
60% identity, 96% coverage
G9A287 Succinate--CoA ligase [ADP-forming] subunit alpha from Sinorhizobium fredii (strain HH103)
60% identity, 96% coverage
ZMO0567 succinyl-CoA synthetase, alpha subunit from Zymomonas mobilis subsp. mobilis ZM4
59% identity, 97% coverage
- Genome-Wide Analyses of Proteome and Acetylome in Zymomonas mobilis Under N2-Fixing Condition
Nisar, Frontiers in microbiology 2021 - “...the non-fixing condition, that is, aconitate hydratase (AcnA, ZMO0543) at K663, and succinateCoA ligase (SucD, ZMO0567) at K293. Also, CitC and GltA (ZMO1963) from TCA cycle were found acetylated at site K57 and K311 under the N 2 -fixing condition, respectively. In comparison, for phosphorylated-based PTM...”
- Genome Wide Phosphoproteome Analysis of Zymomonas mobilis Under Anaerobic, Aerobic, and N2-Fixing Conditions
Tatli, Frontiers in microbiology 2019 - “...carboxylase (PEPC, ZMO1496) was phosphorylated at Tyr 317 and Thr 323 ; succinate-CoA ligase (SucD, ZMO0567) was phosphorylated at Ser 257 and Ser 262 , and putative malate dehydrogenase (MDH, ZMO1955) was phosphorylated at Ser 2 and Thr 540 ( Figure 3C ). Unlike glycolytic enzymes,...”
- Proteomic and metabolomic analysis of the cellular biomarkers related to inhibitors tolerance in Zymomonas mobilis ZM4
Chang, Biotechnology for biofuels 2018 - “...be transformed from fumarate by succinate dehydrogenase ZMO0569 and transformed from succinyl-CoA by succinyl-CoA synthetase ZMO0567 and Succinyl-CoA ligase SucC ZMO1481, while it also can be transformed from succinate semialdehyde by aldehyde dehydrogenase ZMO1754. There were no significant differences in ZMO0569, ZMO0567, and ZMO1481; whereas, the...”
- Transcriptome analysis of Zymomonas mobilis ZM4 reveals mechanisms of tolerance and detoxification of phenolic aldehyde inhibitors from lignocellulose pretreatment
Yi, Biotechnology for biofuels 2015 - “...1-dehydrogenase), ZMO0368 (6-phosphogluconate dehydrogenase), ZMO0369 (glucokinase), ZMO0387 (hpcH/hpaI aldolase), ZMO0543 (aconitate hydratase), ZMO0544 (isocitrate dehydrogenase), ZMO0567 (succinyl-CoA synthetase), ZMO0569 (succinate dehydrogenase), ZMO0997 (KDPG aldolase), ZMO1237 ( d -isomer specific 2-hydroxyacid dehydrogenase), ZMO1307 (fumarase), ZMO1360 (pyruvate decarboxylase), ZMO1478 (6-phosphogluconolactonase), ZMO1496 (phosphoenolpyruvate carboxylase), ZMO1596 (Fe-containing alcohol dehydrogenase), ZMO1608...”
FFUJ_13760 probable atp-specific succinyl-coa synthetase alpha subunit from Fusarium fujikuroi IMI 58289
64% identity, 86% coverage
- Deciphering the cryptic genome: genome-wide analyses of the rice pathogen Fusarium fujikuroi reveal complex regulation of secondary metabolism and novel metabolites
Wiemann, PLoS pathogens 2013 - “...FFUJ_05032, FFUJ_05937, FFUJ_06185, FFUJ_07582, FFUJ_08292, FFUJ_08315, FFUJ_08319, FFUJ_08541, FFUJ_08584, FFUJ_09575, FFUJ_09776, FFUJ_09852, FFUJ_13056, FFUJ_13472, FFUJ_13565, FFUJ_13760, FFUJ_13774. For phylogenetic analysis of SM genes, predicted amino acid sequences were aligned with the ClustalW+ alignment tool using the BLOSUM scoring matrix. Aligned sequences were then subjected to maximum...”
RLV_6684 succinate--CoA ligase subunit alpha from Rhizobium leguminosarum bv. viciae
RL4436 putative succinyl-CoA synthetase alpha chain from Rhizobium leguminosarum bv. viciae 3841
58% identity, 96% coverage
Q7Z941 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Neocallimastix patriciarum
62% identity, 83% coverage
A1S_2719 succinyl-CoA synthetase alpha chain from Acinetobacter baumannii ATCC 17978
71% identity, 78% coverage
WP_005774305 succinate--CoA ligase subunit alpha from Bartonella elizabethae
59% identity, 95% coverage
CAB751 succinate--CoA ligase subunit alpha from Chlamydia abortus S26/3
61% identity, 97% coverage
- Profiling antibody responses to infections by Chlamydia abortus enables identification of potential virulence factors and candidates for serodiagnosis
Forsbach-Birk, PloS one 2013 - “...transport and metabolism: CAB062, CAB115, CAB703, CAB841, CAB932. Energy production and conversion: CAB407, CAB654, CAB656, CAB751, CAB752, CAB816, CAB937. Lipid transport and metabolism: CAB539. Cell wall / membrane biogenesis: CAB048, CAB467, CAB712. Nucleotide transport and metabolism: CAB840. Transcription: CAB113, CAB129, CAB452. Amino acid transport and metabolism:...”
Q4WTU5 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
64% identity, 85% coverage
WP_034458042 succinate--CoA ligase subunit alpha from Bartonella koehlerae C-29
60% identity, 95% coverage
E6YNR1 Succinate--CoA ligase [ADP-forming] subunit alpha from Bartonella rochalimae ATCC BAA-1498
WP_035006433 succinate--CoA ligase subunit alpha from Bartonella rochalimae ATCC BAA-1498
60% identity, 96% coverage
WP_004856238 succinate--CoA ligase subunit alpha from Bartonella doshiae NCTC 12862 = ATCC 700133
59% identity, 96% coverage
T5A666 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Ophiocordyceps sinensis (strain Co18 / CGMCC 3.14243)
62% identity, 86% coverage
WP_015857104 succinate--CoA ligase subunit alpha from Bartonella grahamii ATCC 700132
59% identity, 95% coverage
E6YXC2 Succinate--CoA ligase [ADP-forming] subunit alpha from Bartonella sp. 1-1C
60% identity, 95% coverage
F4S8X5 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7)
60% identity, 82% coverage
- Proteomic Analysis of UV-B-Induced Virulence-Mutant Strains of Puccinia striiformis f. sp. tritici Based on iTRAQ Technology.
Zhao, Frontiers in microbiology 2020 - “...PCR assays. Accession Forward primer (53) Reverse primer (53) TUBB AACAATGTCACAGTGGGCGGTTT GTGGAAGAGAACATGCTGTCCGT G9B235 GTCTTCGATTCCCCGGTCAG CAGTCAAGTATCGGCCGTGT F4S8X5 TAGCAGGCGAGTCACTAACG GTCGTCAGTTTCATCGCTGG V2XWY1 GAACTCTGCAGCTCGACTAT ATGACCGGACCTGTTACCTT Q9C1C1 AGGATGGTATGGGCGGTAAAC GGAGGGCTTCACGTTGTTCA F4S0Z3 CCGATCACCACCAAGACCAT AATCTTTCCACCACGAGCGT F4RWN9 GTTCTCAGAGCCGACGGAAA CTACTGCATCACCCACGGTT E3L0W8 GGATACATTGGAGCGGGTGA CTTCCGATCTGAACGCCCTT D4QFJ2 GGCCATTTCACAAACGAGGT ACTCCCACTCGAGCATCT J6EXB0 CAGAACCAGGGTGAGATGCT CACCCTCATCGGCGTAAGTA Results Overview of the Proteomic Data of...”
- “...CYR32-5 vs. CYR32 1.27 A8N2Q4 Inorganic diphosphatase CYR32-61 vs. CYR32 1.25 CYR32-61 vs. CYR32-5 1.22 F4S8X5 Putative uncharacterized protein CYR32-5 vs. CYR32 1.20 CYR32-61 vs. CYR32 1.27 CYR32-61 vs. CYR32-5 1.34 [E]Amino acid transport and metabolism E3KFZ5 Putative uncharacterized protein CYR32-5 vs. CYR32 1.40 S7RH13 Threonine...”
WP_010705938 succinate--CoA ligase subunit alpha from Bartonella vinsonii subsp. berkhoffii ATCC 51672
60% identity, 95% coverage
WP_008037783 succinate--CoA ligase subunit alpha from Bartonella tamiae Th307
60% identity, 96% coverage
WP_100129872 succinate--CoA ligase subunit alpha from Bartonella tribocorum
59% identity, 95% coverage
WP_007476332 succinate--CoA ligase subunit alpha from Bartonella melophagi K-2C
59% identity, 96% coverage
WP_010704443 succinate--CoA ligase subunit alpha from Bartonella chomelii
59% identity, 96% coverage
Tb927.3.2230 / Q582T6 succinyl-CoA synthetase α subunit (EC 6.2.1.5) from Trypanosoma brucei brucei (strain 927/4 GUTat10.1) (see 2 papers)
62% identity, 95% coverage
A9DG17 Succinate--CoA ligase [ADP-forming] subunit alpha from Hoeflea phototrophica (strain DSM 17068 / NCIMB 14078 / DFL-43)
61% identity, 96% coverage
SUCA_SCHPO / O13750 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial; Succinyl-CoA synthetase subunit alpha; SCS-alpha; EC 6.2.1.5 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
SPAC16E8.17c succinate-CoA ligase (alpha subunit) from Schizosaccharomyces pombe
61% identity, 86% coverage
PAAG_00417 succinyl-CoA ligase subunit alpha from Paracoccidioides lutzii Pb01
62% identity, 85% coverage
- The Response of Paracoccidioides lutzii to the Interaction with Human Neutrophils
Silva, Journal of fungi (Basel, Switzerland) 2023 - “...TCA pathway, increased after 4 h of neutrophil internalization. Both subunits of succinyl CoA ligase (PAAG_00417, PAAG_01463), which converts succinyl CoA into succinate, were increased upon neutrophil internalization. Our proteomic results also evidenced the increase in glutamate dehydrogenase (PAAG_01002). This enzyme catalyzes the conversion of L-glutamate...”
- “...# * PAAG_05150 ATP citrate synthase subunit 1 # 3.97 PAAG_08075 citrate synthase # 2.05 PAAG_00417 succinyl-CoA ligase subunit alpha # 1.65 PAAG_01463 succinyl CoA ligase subunit beta # 3.67 Glyoxylate cycle PAAG_04542 malate synthase 0.78 2.29 PAAG_06951 isocitrate lyase # 0.81 ** Intermediates formation PAAG_00468...”
- Interacting with Hemoglobin: Paracoccidioides spp. Recruits hsp30 on Its Cell Surface for Enhanced Ability to Use This Iron Source
de, Journal of fungi (Basel, Switzerland) 2021 - “...domain 364.5 * - 0.783 PAAG_02769 Pyruvate dehydrogenase protein X component 325.5 * - 0.685 PAAG_00417 Succinyl-CoA ligase subunit alpha 1400.3 1.88 - 0.624 PAAG_02921 Translation elongation factor Tu 990.0 1.70 - 0.773 PAAG_04901 Ubiquitin-conjugating enzyme 555.9 1.79 - 0.883 PAAG_12424 Voltage-dependent anion channel protein 1...”
- Interaction of Isocitrate Lyase with Proteins Involved in the Energetic Metabolism in Paracoccidioides lutzii
Freitas, Journal of fungi (Basel, Switzerland) 2020 - “...Tricarboxylic-acid pathway 18,022.91 PAAG_01534 pyruvate dehydrogenase E1 component subunit beta 54,603.02 PAAG_03330 dihydrolipoyl dehydrogenase 18,252.14 PAAG_00417 succinyl-CoA ligase subunit alpha 15,495.53 PAAG_01463 succinyl-CoA ligase subunit beta 45,050.75 PAAG_07729 isocitrate dehydrogenase subunit 2 29,021.65 PAAG_00053 malate dehydrogenase 64,147.15 PAAG_08449 malate dehydrogenase 40,336.05 PAAG_05048 3-isopropylmalate dehydratase large subunit...”
- “...flavoprotein subunit 9554.287 PAAG_04238 succinate dehydrogenase flavoprotein subunit 9647.347 PAAG_06103 succinate dehydrogenase iron-sulfur subunit 12,727.08 PAAG_00417 succinyl-CoA ligase subunit alpha 7841.01 PAAG_01463 succinyl-CoA ligase subunit beta 9100.539 PAAG_00856 isocitrate dehydrogenase subunit 1 11,681.96 PAAG_07729 isocitrate dehydrogenase subunit 2 10,708.71 PAAG_08351 mitochondrial NADP-specific isocitrate dehydrogenase 13,966.9 PAAG_00053...”
C1G294 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Paracoccidioides brasiliensis (strain Pb18)
PADG_02260 succinate--CoA ligase (GDP-forming) subunit alpha from Paracoccidioides brasiliensis Pb18
62% identity, 85% coverage
- Transcriptional profiling of a fungal granuloma reveals a low metabolic activity of Paracoccidioides brasiliensis yeasts and an actively regulated host immune response
Borges, Frontiers in cellular and infection microbiology 2023 - “...helicase BRR2 [EC:3.6.4.13] DOWN(D) -4,64777 2,39E-05 C1G0P0 molecular chaperone DnaK DOWN(12) -2,42964 0,026103 Energy metabolism C1G294 succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5] DOWN(D) -3,29572 0,003605 C1G2P3 enoyl-CoA hydratase [EC:4.2.1.17] DOWN(D) -4,37849 2,82E-05 C1G2W2 Pyruvate kinase (EC 2.7.1.40) DOWN(D) -5,32367 0,00092 C1GM03 Cytochrome b-c1 complex subunit 2...”
- “...to acetyl-CoA in mitochondria, to gluconeogenesis and to amino acid anabolism; succinyl-CoA synthetase alpha subunit (C1G294), which is part of an enzyme that regulates citric acid cycle by controlling the interconversion between succinyl CoA and succinate and the GTP/ATP production at substrate level, and to provide...”
- Effect of Nitrosative Stress on the S-Nitroso-Proteome of Paracoccidioides brasiliensis
Navarro, Frontiers in microbiology 2020 - “...subunit gamma 1314.40 PADG_02828 C1G6M3 Ribosomal protein 1285.74 PADG_07953 C1GKU6 Peptidyl-prolyl cis-trans isomerase 1270.76 PADG_02260 C1G294 Uncharacterized protein 1255.86 PADG_02555 C1G5V0 Uncharacterized protein 1177.62 PADG_04934 C1GBD3 Uncharacterized protein 1118.93 PADG_02249 C1G283 60S ribosomal protein L2 937.59 PADG_04099 C1GA13 Phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase 935.75 PADG_05402 C1GDR6 Uncharacterized protein...”
- Prediction of Conserved Peptides of Paracoccidioides for Interferon-γ Release Assay: The First Step in the Development of a Lab-Based Approach for Immunological Assessment during Antifungal Therapy
Rosa, Journal of fungi (Basel, Switzerland) 2020 - “...Succinate dehydrogenase PADG_06494 0.0 97% 100% Succinate dehydrogenase PADG_08013 0.0 100% 98% Succinyl CoA ligase PADG_02260 0.0 99% 100% Shock protein 90 PADG_02785 0.0 100% 98% Shock protein 98 PADG_00765 0.0 100% 99% Shock protein SSVB1 PAAG_07775 0.0 98% 100% Transferrin PADG_00686 0.0 100% 98% Transketolase...”
- Effect of Nitrosative Stress on the S-Nitroso-Proteome of Paracoccidioides brasiliensis
Navarro, Frontiers in microbiology 2020 - “...synthase subunit gamma 1314.40 PADG_02828 C1G6M3 Ribosomal protein 1285.74 PADG_07953 C1GKU6 Peptidyl-prolyl cis-trans isomerase 1270.76 PADG_02260 C1G294 Uncharacterized protein 1255.86 PADG_02555 C1G5V0 Uncharacterized protein 1177.62 PADG_04934 C1GBD3 Uncharacterized protein 1118.93 PADG_02249 C1G283 60S ribosomal protein L2 937.59 PADG_04099 C1GA13 Phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase 935.75 PADG_05402 C1GDR6 Uncharacterized...”
- Metabolic Peculiarities of Paracoccidioides brasiliensis Dimorphism as Demonstrated by iTRAQ Labeling Proteomics
Araújo, Frontiers in microbiology 2019 - “...related to the TCA cycle, such as pyruvate dehydrogenase (PADG_00246), ATP-citrate synthase (PADG_04993), succinyl-CoA ligase (PADG_02260 and PADG_00317), and aconitate hydratase (PADG_11845), were more abundant in yeast cells compared to transition phase and mycelium ( Figure 5 ). Also, proteins involved in the electron transport chain...”
sucD / BAE02672.1 succinyl-CoA synthetase small subunit, partial from Hydrogenobacter thermophilus (see paper)
62% identity, 90% coverage
Q6IAL5 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial from Homo sapiens
67% identity, 85% coverage
SUCLG1 / P53597 succinyl-CoA ligase alpha subunit (EC 6.2.1.5) from Homo sapiens (see 4 papers)
SUCA_HUMAN / P53597 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; Succinyl-CoA synthetase subunit alpha; SCS-alpha; EC 6.2.1.4; EC 6.2.1.5 from Homo sapiens (Human) (see 5 papers)
P53597 succinate-CoA ligase (GDP-forming) (EC 6.2.1.4); succinate-CoA ligase (ADP-forming) (EC 6.2.1.5) from Homo sapiens (see 2 papers)
NP_003840 succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial precursor from Homo sapiens
67% identity, 82% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and specificity for either ATP or GTP is provided by different beta subunits.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
catalytic activity: GTP + succinate + CoA = succinyl-CoA + GDP + phosphate (RHEA:22120)
subunit: Heterodimer of an alpha and a beta subunit. Different beta subunits determine nucleotide specificity. Together with the ATP- specific beta subunit SUCLA2, forms an ADP-forming succinyl-CoA synthetase (A-SCS). Together with the GTP-specific beta subunit SUCLG2 forms a GDP-forming succinyl-CoA synthetase (G-SCS). - SUCLG1 restricts POLRMT succinylation to enhance mitochondrial biogenesis and leukemia progression.
Yan, The EMBO journal 2024 - GeneRIF: SUCLG1 restricts POLRMT succinylation to enhance mitochondrial biogenesis and leukemia progression.
- Clinical, Molecular, and Computational Analysis in two cases with mitochondrial encephalomyopathy associated with SUCLG1 mutation in a consanguineous family.
Maalej, Biochemical and biophysical research communications 2018 (PubMed)- GeneRIF: We report two Tunisian patients belonging to a consanguineous family with mitochondrial encephalomyopathy. Mutational analysis of SUCLG1 gene showed the presence of c.41T > C in exon 1 in a homozygous state. This mutation substitutes a conserved methionine residue to a threonine at position 14 (p.M14T) located at the SUCLG1 protein mitochondrial targeting sequence.
- Five novel SUCLG1 mutations in three Chinese patients with succinate-CoA ligase deficiency noticed by mild methylmalonic aciduria.
Liu, Brain & development 2016 (PubMed)- GeneRIF: First Chinese report of succinyl-CoA ligase deficiency caused by novel SUCLG1 mutations; five novel pathogenic mutations in SUCLG1 were identified
- Succinate-CoA ligase deficiency due to mutations in SUCLA2 and SUCLG1: phenotype and genotype correlations in 71 patients.
Carrozzo, Journal of inherited metabolic disease 2016 (PubMed)- GeneRIF: Long survival, to age 20 years or older, was reported in 12% of SUCLA2 and in 10% of SUCLG1 patients.
- Expanding the phenotypic spectrum of Succinyl-CoA ligase deficiency through functional validation of a new SUCLG1 variant.
Donti, Molecular genetics and metabolism 2016 - GeneRIF: These abnormal phenotypes are rescued upon ectopic expression of wild-type SUCLG1 in the patient's fibroblasts, thus functionally confirming the pathogenic nature of the SUCLG1 VUS identified in this patient and expanding the phenotypic spectrum for SUCLG1 deficiency
- Mitochondrial DNA depletion syndrome: new descriptions and the use of citrate synthase as a helpful tool to better characterise the patients.
Navarro-Sastre, Molecular genetics and metabolism 2012 (PubMed)- GeneRIF: 3 novel mutations have been identified in patients with the mitochondrial DNA depletion syndrome (c.1048G>A and c.1049G>T in SUCLA2 and c.531+4A>T in SUCLG1).
- New SUCLG1 patients expanding the phenotypic spectrum of this rare cause of mild methylmalonic aciduria.
Valayannopoulos, Mitochondrion 2010 (PubMed)- GeneRIF: This report enlarges the phenotypic spectrum of SUCLG1 mutations and confirms that a characteristic metabolic profile (presence of MMA and C4-DC carnitine in urines) and basal ganglia MRI lesions are the hallmarks of SCS defects.
- Marked mitochondrial DNA depletion associated with a novel SUCLG1 gene mutation resulting in lethal neonatal acidosis, multi-organ failure, and interrupted aortic arch.
Rivera, Mitochondrion 2010 (PubMed)- GeneRIF: A novel mutation in the SUCLG1 gene was found in two newborns having lethal lactic acidosis, multi-organ failure and congenital malformations including interrupted aortic arch.
- More
- Prediction of potential drug targets and key inhibitors (ZINC67974679, ZINC67982856, and ZINC05668040) against <i>Rickettsia felis</i> using integrated computational approaches
Rahman, Frontiers in veterinary science 2024 - “...WP_011270995.1 Drugbank_target | P22102 Trifunctional purine biosynthetic protein adenosine-3 DB00642 Cytoplasmic 7 WP_039594975.1 Drugbank_target | P53597 Succinyl-CoA ligase DB00139 Cytoplasmic 8 WP_039595039.1 Drugbank_target | P13995 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase DB00116 Cytoplasmic 9 WP_039595177.1 Drugbank_target | P10902 L-aspartate oxidase DB03147 Cytoplasmic 10 WP_011271325.1 Drugbank_target | Q02768 Cytochrome b...”
- Novel Genetic and Biochemical Insights into the Spectrum of NEFL-Associated Phenotypes.
Della, Journal of neuromuscular diseases 2024 - “...14-3-3 protein beta/alpha (1433B_HUMAN) 1.39 0.006 P30042 6 ES1 protein homolog, mitochondrial (ES1_HUMAN) 1.38 0.022 P53597 2 SuccinateCoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial (SUCA_HUMAN) 1.37 0.006 P28331 6 NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (NDUS1_HUMAN) 1.36 0.001 Q00610 2 Clathrin heavy chain 1 (CLH1_HUMAN) 1.35 0.047...”
- Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
de, Frontiers in cellular and infection microbiology 2023 - “...1918.82 * O75874 Isocitrate dehydrogenase [NADP] cytoplasmic 975.87 * P09622 Dihydrolipoyl dehydrogenase_ mitochondrial 1686.78 * P53597 SuccinateCoA ligase [ADP/GDP-forming] subunit alpha_ mitochondrial 651.86 * A0A5K1VW95 Malate dehydrogenase 15614.68 * C9JRL4 Cytosolic malate dehydrogenase (Fragment) 13862.17 * P07954 Fumarate hydratase_ mitochondrial 2669.02 * Oxidative phosphorylation P13804 Electron...”
- Proteome architecture of human-induced pluripotent stem cell-derived three-dimensional organoids as a tool for early diagnosis of neuronal disorders
Negi, Indian journal of pharmacology 2023 - “...cDNA FLJ57738, highly similar to Translationally-controlled tumor protein TCTP 3 16.1 58 1.89 1.858E-03 51 P53597 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial SUCLG1 2 36.2 18 1.84 2.908E-02 52 A8K7T4 cDNA FLJ75774, highly similar to H. sapiens lectin, mannose-binding 2 (LMAN2), mRNA LMAN2 2 40.2 9...”
- “...38.1 3.07 18 Q8TAS0 ATP synthase subunit gamma (Fragment) ATP5F1C 15 2 32.2 3 19 P53597 Succinate-CoA ligase (ADP/GDP-forming) subunit alpha, mitochondrial SUCLG1 18 2 36.2 1.84 20 Q06210 Glutamine--fructose-6-phosphate aminotransferase (isomerizing) 1 GFPT1 10 4 78.8 2.05 21 B4DMB5 CTP synthase CTPS1 19 3 55.9...”
- Human amygdala involvement in Alzheimer's disease revealed by stereological and dia-PASEF analysis.
Gonzalez-Rodriguez, Brain pathology (Zurich, Switzerland) 2023 - “...MYP2_HUMAN PMP2 Myelin P2 protein 0.28 0.0170 Q96HU8 DIRA2_HUMAN DIRAS2 GTPbinding protein DiRas2 0.26 0.0396 P53597 SUCA_HUMAN SUCLG1 SuccinateCoA ligase [ADP/GDPforming] subunit alpha, mitochondrial 0.23 0.0307 Note : FC<1.5, p value <0.05, total identified proteins available via ProteomeXchange with identifier PXD038322. In order to relate the...”
- Mitochondria-derived vesicles and their potential roles in kidney stone disease.
Chaiyarit, Journal of translational medicine 2023 - “...dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (EC 1.3.5.1) (Iron-sulfur subunit of complex II) (Ip) 210 SUCLG1 P53597 SuccinateCoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial (EC 6.2.1.4) (EC 6.2.1.5) (Succinyl-CoA synthetase subunit alpha) (SCS-alpha) 211 SUCLG2 Q96I99 SuccinateCoA ligase [GDP-forming] subunit beta, mitochondrial (EC 6.2.1.4) (GTP-specific succinyl-CoA synthetase subunit...”
- Insight into the Molecular Signature of Skeletal Muscle Characterizing Lifelong Football Players
Orrù, International journal of environmental research and public health 2022 - “...light chain kinase, smooth muscle MYLK 1.64 P42704 Leucine-rich PPR motif-containing protein, mitochondrial LRPPRC 1.64 P53597 Succinyl-CoA ligase (ADP/GDP-forming) subunit alpha, mitochondrial SUCLG1 1.57 P62701 40S ribosomal protein S4, X isoform RPS4X 1.54 Q0VFZ6 Coiled-coil domain-containing protein 173 CCDC173 1.48 P46778 60S ribosomal protein L21 RPL21...”
- Secretory Carrier Membrane Protein 3 Interacts with 3A Viral Protein of Enterovirus and Participates in Viral Replication.
Lu, Microbiology spectrum 2021 - “...6.60 Q9P2R7 SUCLA2 Succinyl-CoA ligase (ADP-forming) subunit beta, mitochondrial 50.3 76.3 2 2 2 4.10 P53597 SUCLG1 Succinyl-CoA ligase (GDP-forming) subunit alpha, mitochondrial 36.2 223.8 4 4 8 15.03 Q86TM6 SYVN1 E3 ubiquitin-protein ligase synoviolin 67.6 55.6 2 2 3 2.59 P17987 TCP1 T-complex protein 1...”
- More
Cj0534 succinyl-coA synthetase alpha chain from Campylobacter jejuni subsp. jejuni NCTC 11168
58% identity, 98% coverage
E6YT34 Succinate--CoA ligase [ADP-forming] subunit alpha from Bartonella sp. AR 15-3
60% identity, 95% coverage
8z03A Lactate bound to human gtp-specific succinyl-coa synthetase (see paper)
67% identity, 91% coverage
- Ligands: coenzyme a; phosphate ion (8z03A)
B9JTS6 Succinate--CoA ligase [ADP-forming] subunit alpha from Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
59% identity, 96% coverage
NCU01227 succinyl-CoA ligase alpha-chain from Neurospora crassa OR74A
62% identity, 86% coverage
PF3D7_1108500 succinyl-CoA synthetase alpha subunit, putative from Plasmodium falciparum 3D7
59% identity, 86% coverage
- Machine learning methods for predicting essential metabolic genes from Plasmodium falciparum genome-scale metabolic network
Isewon, PloS one 2024 - “...NE E No Evidence DHORTS PF3D7_1472900 NE E No Evidence SUCOAS1m (PF3D7_1437700 or PF3D7_1431600) and PF3D7_1108500 NE E No Evidence We present a discussion of experimental evidence found in the literature regarding specific genes and their potential applications in malaria drug discovery: Gene PF3D7_1342100 encodes for...”
- “..., 50 ]. For the remaining genes (PF3D7_0614000, PF3D7_1108300, PF3D7_1223800, PF3D7_1472900, PF3D7_1437700 (or PF3D7_1431600), and PF3D7_1108500), there is no literature evidence suggesting their direct biological relevance in malaria drug discovery. Further research is required to gain insight into their potential roles in the malaria parasites metabolism...”
- Metabolic changes that allow <i>Plasmodium falciparum</i> artemisinin-resistant parasites to tolerate oxidative stress
Bonive-Boscan, Frontiers in parasitology 2024 - “...(PF3D7_1022500, PF3D7_0609200) is upregulated, and oxoglutarate dehydrogenase (PF3D7_1320800), succinate dehydrogenase (PF3D7_1010300), and succinate CoA ligase (PF3D7_1108500) are downregulated ( Figure1B ). These changes in the transcript levels may be related to changes in the metabolites influx and efflux from the mitochondrion; specifically, this can promote the...”
- Genetic investigation of tricarboxylic acid metabolism during the Plasmodium falciparum life cycle
Ke, Cell reports 2015 - “...encoding -ketoglutarate dehydrogenase E1 subunit ( KDH , PF3D7_0820700), succinyl-CoA synthetase subunit ( SCS , PF3D7_1108500), SDH flavoprotein subunit ( SDH , PF3D7_1034400), CS ( CS , PF3D7_1022500), aconitase ( Aco , PF3D7_1342100) and isocitrate dehydrogenase ( IDH , PF3D7_1345700) ( Figures S1, S2 ). In...”
BQ13430 Succinyl-CoA synthetase alpha chain from Bartonella quintana str. Toulouse
WP_011179955 succinate--CoA ligase subunit alpha from Bartonella quintana
60% identity, 96% coverage
aq_1622 succinyl-CoA ligase alpha subunit from Aquifex aeolicus VF5
O67547 Succinate--CoA ligase [ADP-forming] subunit alpha from Aquifex aeolicus (strain VF5)
61% identity, 94% coverage
NE0051 ATP-citrate lyase/succinyl-CoA ligases:DUF184 from Nitrosomonas europaea ATCC 19718
57% identity, 96% coverage
WP_005866529 succinate--CoA ligase subunit alpha from Bartonella alsatica
59% identity, 95% coverage
LOC111348703 succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial from Spodoptera litura
61% identity, 87% coverage
- Natural Coumarin Shows Toxicity to Spodoptera litura by Inhibiting Detoxification Enzymes and Glycometabolism
Xia, International journal of molecular sciences 2023 - “...10,257.99 3219.758 1.6718 5.30 10 5 LOC111357097 isocitrate dehydrogenase 2194.843 935.3239 1.2307 6.02 10 5 LOC111348703 succinate-CoA ligase 5418.423 2189.555 1.3073 8.66 10 5 LOC111357155 succinate dehydrogenase 3485.447 1600.493 1.1230 0.0003 LOC111350817 phosphoenolpyruvate carboxykinase 8196.958 2194.445 1.9013 0.0006 LOC111349733 2-oxoglutarate dehydrogenase 7347.055 2748.649 1.4185 0.0007 LOC111356570...”
mtkB / P53595 malate thiokinase α subunit (EC 6.2.1.9) from Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1) (see paper)
P53595 Malate--CoA ligase subunit alpha from Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
C7C8C9 Succinate--CoA ligase [ADP-forming] subunit alpha from Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)
YP_002962852 Malate thiokinase, small subunit from Methylobacterium extorquens AM1
55% identity, 97% coverage
- Degradation of glyoxylate and glycolate with ATP synthesis by a thermophilic anaerobic bacterium, Moorella sp. strain HUC22-1.
Sakai, Applied and environmental microbiology 2008 - Synthesis of 2'-Fluoro RNA by Syn5 RNA polymerase.
Zhu, Nucleic acids research 2015 - “...least 20-fold (Figure 2B , lanes 3 and 4 versus 1). Other sequences, such as C7C8C9 and G7C8G9, also reduce the yield of transcripts produced by Syn5 RNA polymerase, but in these cases the amount of product was still substantial (Figure 2A , lanes 10 and...”
- Design and construction of a non-natural malate to 1,2,4-butanetriol pathway creates possibility to produce 1,2,4-butanetriol from glucose
Li, Scientific reports 2014 - “...accession No. YP_001022444 and YP_001022445 MtkAB from Methylobacterium extorquens AM1, GenBank accession No. YP_002962851 and YP_002962852 MtkAB from Nitrosomonas europaea ATCC 19718, GenBank accession No. NP_841838 and NP_841839 MtkAB from Methylobacterium radiotolerans JCM 2831, GenBank accession No. YP_001756324 and YP_001756325 Nde I and EcoR V on...”
ING2E5A_0952 succinate--CoA ligase subunit alpha from Petrimonas mucosa
57% identity, 95% coverage
BAB1_1925 CoA Binding Domain:Succinyl-CoA ligase, alpha subunit:ATP-citrate lyase/succinyl-CoA ligase from Brucella melitensis biovar Abortus 2308
59% identity, 96% coverage
- Brucella abortus choloylglycine hydrolase affects cell envelope composition and host cell internalization
Marchesini, PloS one 2011 - “...82.8 67.2 6.0 BAB1_0045 OM 106 Succinyl-CoA synthetasealpha chain gi|17986423 5.49 5.81 34.3 31.2 3.2 BAB1_1925 C 109 Aspartyl/glutamyl-tRNA amidotransferase subunit A gi|39931612 5.41 5.57 60.3 52.5 2.1 BAB2_0646 C pH 5.56.7 3 Transcription termination factor Rho gi|17986287 5.76 5.87 57.3 47.0 5.1 BAB1_2065 C 4...”
- Intracellular adaptation of Brucella abortus
Lamontagne, Journal of proteome research 2009 - “...cycle components, such as aconitate hydratase (BAB1_0090), 2-oxoglutarate dehydrogenase (BAB1_1923), dihydrolipoamide acetyltransferase (BAB1_1922), succinyl-CoA synthetase (BAB1_1925) and malate dehydrogenase (BAB1_1927), were all reduced at similar rates 3 hours after infection. Similarly, transketolase (BAB1_1740) and enolase (BAB1_1155), enzymes committed to the pentose phosphate shunt and the subsequent...”
- “...coordinated expression changes occurred in proteins that form continuous genetic arrangements. For example BAB1_1922, BAB1_1923, BAB1_1925, as well as BAB1_1149, BAB1_1150, BAB1_1151, and BAB1_1645, BAB1_1646, BAB1_1648. These proteins may be transcribed as a single message and subsequently translated as has been observed in other systems 47...”
SUCA_DROME / Q94522 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; Succinyl-CoA synthetase subunit alpha; SCS-alpha; Succinyl-coenzyme A synthetase alpha subunit 1; EC 6.2.1.4; EC 6.2.1.5 from Drosophila melanogaster (Fruit fly) (see paper)
NP_523905 Succinyl-coenzyme A synthetase alpha subunit 1, isoform A from Drosophila melanogaster
61% identity, 86% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and specificity for either ATP or GTP is provided by different beta subunits.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
catalytic activity: GTP + succinate + CoA = succinyl-CoA + GDP + phosphate (RHEA:22120)
subunit: Heterodimer of an alpha and a beta subunit. Different beta subunits determine nucleotide specificity. Together with an ATP- specific beta subunit, forms an ADP-forming succinyl-CoA synthetase (A- SCS). Together with a GTP-specific beta subunit forms a GDP-forming succinyl-CoA synthetase (G-SCS).
disruption phenotype: Viable (PubMed:28017724). During development, results in delayed egg eclosion, reduced glycogen levels and extension of the third instar larval period but without change of the duration of the pupal period or final size of organ (PubMed:28017724). In the adult, results in defects in locomotor activity (PubMed:28017724). Results in disregulation of both glycolysis and the citric acid cycle (TCA) including accumulation of Succinyl-CoA and succinate, and reduction of GABA (PubMed:28017724). - Deficiency of succinyl-CoA synthetase α subunit delays development, impairs locomotor activity and reduces survival under starvation in Drosophila.
Quan, Biochemical and biophysical research communications 2017 (PubMed)- GeneRIF: Drosophila SCS deficiency, designated Scsalpha(KO), contained a high level of succinyl-CoA, a substrate for the enzyme, and altered levels of various metabolites in TCA cycle and glycolysis, indicating that the energy metabolism was impaired
B488_RS03590 succinate--CoA ligase subunit alpha from Liberibacter crescens BT-1
60% identity, 95% coverage
TASI_0746 succinate--CoA ligase subunit alpha from Taylorella asinigenitalis MCE3
57% identity, 97% coverage
- Genomic characterization of the Taylorella genus
Hébert, PloS one 2012 - “...(TASI_0659, TEQUI_1215); 4. isocitrate dehydrogenase (TASI_0396, TEQUI_1024); 5. -ketoglutarate dehydrogenase (TASI_0983, TEQUI_1309); 6. Succinyl-CoA synthetase (TASI_0746, TEQUI_1545); 7. succinate dehydrogenase (TASI_1020, TEQUI_1586); 8. fumarate hydratase (TASI_0400, TEQUI_1028); 9. malate dehydrogenase (TASI_1024, TEQUI_1590); 10. malic enzyme (TASI_0984, TEQUI_1308); 11. glutamate dehydrognase (TASI_1163, TEQUI_0187); 12. pyruvate phosphate dikinase...”
TA10625 Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursor from Theileria annulata
59% identity, 86% coverage
- Proteomic analysis of the Theileria annulata schizont
Witschi, International journal for parasitology 2013 - “...IDH, isocitrate dehyrogenase (TA10850); OGDH, oxoglutarate dehydrogenase (TA05275, TA08530); SCS, succinyl coenzyme A synthetase (TA02815, TA10625); SDH, succinate dehydrogenase (TA19430, TA03455); FH, fumarate hydratase; MDH, malate dehydrogenase (TA18100); CS, citrate synthase (TA14450); PEPC, phosphoenolpyruvate carboxylase; PEPCK, phosphoenolpyruvate carboxykinase (TA20590); GLUD, glutamate dehydrogenase (TA11105) ( Voet et...”
BMEI0139 SUCCINYL-COA SYNTHETASE ALPHA CHAIN from Brucella melitensis 16M
WP_004684457 succinate--CoA ligase subunit alpha from Brucella melitensis 66/59
58% identity, 96% coverage
- RNA-seq reveals the critical role of OtpR in regulating Brucella melitensis metabolism and virulence under acidic stress
Liu, Scientific reports 2015 - “...included twelve genes involved in the tricarboxylic acid (TCA) cycle ( mdh, BMEI0137; sucD, BMEI0138; BMEI0139; sucA, BMEI0140; BMEI0791; gltA, BMEI0836; BMEI0855; BMEI0856; class I fumarate hydratase, BMEI1016; acn, BMEI1855; fumC, BMEII1051; and citrate lyase beta chain, BMEII1074; Fig. 2 ). The TCA cycle is critical...”
- Immunogenic Peptides from Pap31 and SCS-α of Bartonella bacilliformis: One Step Closer to a Rapid Diagnostic Tool for Carrion's Disease
Gomes, Pathogens (Basel, Switzerland) 2021 - “...Bartonella doshiae SCS- WP_004856238 IFASVAE A KEKT D A D A 81.25 Brucella spp. SCS- WP_004684457 IFA T VAEGKE R TGA D A 68.75 Nocardia spp. SCS- WP_067485390 V FASVAE AM EKTGA DT 75.00 Human SCS- SJM31584 IF ST VAEGK AT TGANA Amino acid differences are...”
YP_001756324 succinyl-CoA synthetase, alpha subunit from Methylobacterium radiotolerans JCM 2831
54% identity, 97% coverage
YP_001022444 succinyl-CoA synthetase alpha chain from Methylibium petroleiphilum PM1
55% identity, 97% coverage
AYM39_08400 succinate--CoA ligase subunit alpha from Methylomonas sp. DH-1
56% identity, 97% coverage
- Improvement of succinate production from methane by combining rational engineering and laboratory evolution in Methylomonas sp. DH-1
Jo, Microbial cell factories 2024 - “...qPCR, is described as numbers (1, 2, 3, 4, 5). 1: AYM39_08385; 2: AYM39_08395; 3: AYM39_08400; 4: AYM39_08540; 5: AYM39_08690 Fig.4 Transcription level changes of duplicated genes and pMMO of CS40. a Transcription level change of pMMO in CS40. b , c , d , e...”
- “...genes in duplication region. b AYM39_08385; Malyl-CoA lyase, c AYM39_08395; Malate thiokinase subunit beta, d AYM39_08400; Malate thiokinase subunit alpha, e AYM39_08540; Methenyltetrahydromethanopterin cyclohydrolase, f AYM39_08690; Peroxiredoxin. Transcription level of each gene in CS was set at one for comparison. Transcription level of each gene was...”
WP_053943861 succinate--CoA ligase subunit alpha from Bartonella ancashensis
58% identity, 96% coverage
PVX_091100 succinyl-CoA synthetase alpha subunit, putative from Plasmodium vivax
58% identity, 86% coverage
- Revealing natural antisense transcripts from Plasmodium vivax isolates: evidence of genome regulation in complicated malaria
Boopathi, Infection, genetics and evolution : journal of molecular epidemiology and evolutionary genetics in infectious diseases 2013 (PubMed)- “...synthetase PVX_111455 glucosamine-fructose-6-phosphate aminotransferase PVX_091100 succinyl-CoA synthetase alpha subunit Keywords Natural antisense transcripts...”
- A systems-based analysis of Plasmodium vivax lifecycle transcription from human to mosquito
Westenberger, PLoS neglected tropical diseases 2010 - “...PF14_0295); 2-oxoglutarate dehydrogenase E1 component (PVX_089325, PF08_0045); dihydrolipoamide acyltransferase (PVX_119310, PFC0170c); succinyl-CoA synthetase alpha subunit (PVX_091100, PF11_0097); iron-sulfur subunit of succinate dehydrogenase (PVX_123345, PFL0630w); cytochrome C oxidase (PVX_099845, PFI1375w); cytochrome c oxidase copper chaperone (PVX_111430, PF10_0252); cytochrome c oxidase subunit II precursor (PVX_084995, PF14_0288); cytochrome c...”
AS87_RS02975 succinate--CoA ligase subunit alpha from Riemerella anatipestifer Yb2
60% identity, 98% coverage
- PaR1 secreted by the type IX secretion system is a protective antigen of Riemerella anatipestifer
Wang, Frontiers in microbiology 2022 - “...AS87_RS09845 104859.6/4.88 100 Extracellular 27 Hypothetical protein AKQ39770.1 AS87_RS05240 34176.2/5.65 100 Unknown 34 Succinate-CoAligase AKQ39333.1 AS87_RS02975 29662.3/5.34 100 Unknown 37 Alkyl hydroperoxide reductase AKQ38855.1 AS87_RS00505 23820.8/4.94 100 Unknown a The GenBank accession number of R. anatipestifer strain Yb2: NZ_CP007204 . b Most proteins that are secreted...”
WP_087141820 succinate--CoA ligase subunit alpha from Brevundimonas diminuta
57% identity, 96% coverage
BP2540 succinyl-CoA synthetase, alpha chain from Bordetella pertussis Tohama I
55% identity, 96% coverage
SUCA_PIG / O19069 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; Succinyl-CoA synthetase subunit alpha; SCS-alpha; EC 6.2.1.4; EC 6.2.1.5 from Sus scrofa (Pig) (see 5 papers)
66% identity, 82% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and specificity for either ATP or GTP is provided by different beta subunits.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
catalytic activity: GTP + succinate + CoA = succinyl-CoA + GDP + phosphate (RHEA:22120)
subunit: Heterodimer of an alpha and a beta subunit. Different beta subunits determine nucleotide specificity. Together with the ATP- specific beta subunit SUCLA2, forms an ADP-forming succinyl-CoA synthetase (A-SCS). Together with the GTP-specific beta subunit SUCLG2 forms a GDP-forming succinyl-CoA synthetase (G-SCS). - Quantitative Proteomics Reveals the Relationship between Protein Changes and Volatile Flavor Formation in Hunan Bacon during Low-Temperature Smoking.
Zou, Foods (Basel, Switzerland) 2024 - “...protein MAPK1 A0A8W4FG96 Mitogen-activated protein kinase PEPD A0A5G2QM19 Peptidase D CMPK1 Q29561 UMP-CMP kinase SUCLG1 O19069 SuccinateCoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial MPI A0A287BNZ5 Mannose-6-phosphate isomerase ELOC A0A8D0P6A0 Elongin-C TXNDC17 A0A286ZZM7 Thioredoxin domain-containing protein 17 PIR K7GKW6 Pirin LOC100157017 A0A287A5X0 Glyoxylate reductase/hydroxypyruvate reductase SGTA A0A287A1V6 Small...”
- iTRAQ-based quantitative proteomic analysis of longissimus muscle from growing pigs with dietary supplementation of non-starch polysaccharide enzymes.
Zhang, Journal of Zhejiang University. Science. B 2015
sucD / B3TZD9 3-sulfinopropionyl-CoA synthetase α subunit (EC 6.2.1.5) from Advenella kashmirensis (see paper)
B3TZD9 succinate-CoA ligase (GDP-forming) (EC 6.2.1.4); succinate-CoA ligase (ADP-forming) (EC 6.2.1.5) from Advenella mimigardefordensis (see paper)
W0PAN5 succinate-CoA ligase (ADP-forming) (EC 6.2.1.5) from Advenella mimigardefordensis (see paper)
55% identity, 96% coverage
XP_005655282 succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X2 from Sus scrofa
66% identity, 82% coverage
RSUY_RS13215 succinate--CoA ligase subunit alpha from Ralstonia solanacearum
55% identity, 97% coverage
F1MZ38 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial from Bos taurus
67% identity, 82% coverage
G1SKD9 Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial from Oryctolagus cuniculus
67% identity, 82% coverage
- Proteomic Analyses Reveals the Mechanism of Acupotomy Intervention on the Treatment of Knee Osteoarthritis in Rabbits.
Liu, Evidence-based complementary and alternative medicine : eCAM 2022 - “...ubiquinol-cytochrome c reductase core protein 1 (UQCRC1, accession: G1SGP1), succinate-CoA ligase subunit alpha (SUCLG1, accession: G1SKD9), acetyltransferase component of pyruvate dehydrogenase complex (DLAT, accession: G1T9S4), aconitate hydratase (ACO2, accession: G1TUX2), and succinate-CoA ligase subunit beta (SUCLA2, accession: G1U276). DAPs in cluster 2 were malate dehydrogenase (MDH2,...”
- “...19.80 5 0.73 0.0059 TCA cycle U3KMH9 Malate dehydrogenase MDH2 40.53 37.00 11 0.62 0.0322 G1SKD9 Succinate--CoA ligase subunit alpha, mitochondrial SUCLG1 36.22 13.30 4 0.63 0.0330 G1U276 Succinate--CoA ligase subunit beta, mitochondrial SUCLA2 58.44 24.60 12 0.64 0.0142 A0A5F9CIE2 Succinate dehydrogenase [ubiquinone] flavoprotein subunit SDH1...”
BTH_I0647 succinyl-CoA synthase, alpha subunit from Burkholderia thailandensis E264
Q2T0U6 Succinate--CoA ligase [ADP-forming] subunit alpha from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
55% identity, 96% coverage
BPSL0780 succinyl-CoA ligase alpha-chain from Burkholderia pseudomallei K96243
55% identity, 96% coverage
BCAL0957 succinyl-CoA ligase alpha-chain from Burkholderia cenocepacia J2315
55% identity, 96% coverage
- NtrC-dependent control of exopolysaccharide synthesis and motility in Burkholderia cenocepacia H111
Liu, PloS one 2017 - “...Fumarate hydratase class I 3.2 I35_2268 BCAL2344 NADH ubiquinone oxidoreductase chain A nuoA 2.4 I35_2713 BCAL0957 Succinyl-CoA ligase [ADP-forming] alpha chain sucD 2.4 I35_3124 BCAL0541 Aminobutyraldehyde dehydrogenase -2.7 I35_4890 BCAM0970 Succinate dehydrogenase iron-sulfur protein sdhB 2.3 I35_4892 BCAM0972 Citrate synthase gltA 3.1 I35_5545 BCAM1683 Assimilatory nitrate...”
- Biofilm-grown Burkholderia cepacia complex cells survive antibiotic treatment by avoiding production of reactive oxygen species
Van, PloS one 2013 - “...BCAL2735 Isocitrate dehydrogenase CGCTGAAGCCGGAAGCGAAC ACCGCGCTGCCCTTGATCTT BCAL2736 Isocitrate dehydrogenase ATCAAGGGGCCGCTCACGAC GGCGCAGGCACACGTAGAGA BCAL1517 Dihydrolipoamide dehydrogenase GAAGTGAGCGGCGAGGGTGA TCGGCACCGAGTCGAACGTC BCAL0957 Succinyl-CoA synthethase subunit alpha ACGCAGGGCATTACCGGCAA CGCGGCCGTTTGCGTATTCA BCAM0970 Succinate dehydrogenase iron-sulfur subunit CCTCCAGTCGCCGGAAGAGC CACCAGAAGCTCGGGCACGA BCAM0965 Malate dehydrogenase CCGGTCGCGTCGATCGAGAA GCGAAGCGGAAGTCCGGGTA Other genes BCAM2318 Putative ferredoxin oxidoreductase TGAAGCTGATCGCGCCGGAT GCGCACCGCCTTCATGTACG Reference genes BCAL0036 ATP...”
- “...BCAL2207 Putative dihydrolipoamide dehydrogenase 1.3* BCAL1215 Dihydrolipoamide dehydrogenase 1.4* BCAL0956 Succinyl-CoA synthetase beta chain 2.0* BCAL0957 Succinyl-CoA synthetase subunit alpha 3.3* 10.0* BCAM0967 Putative succinate dehydrogenase 1.7* BCAM0968 Putative succinate dehydrogenase 2.5* BCAM0969 Succinate dehydrogenase flavoprotein 2.5* BCAM0970 Succinate dehydrogenase iron-sulfur subunit 5.0* 25.0* BCAL2908 Fumarate...”
FE46_RS06595 succinate--CoA ligase subunit alpha from Flavobacterium psychrophilum
58% identity, 98% coverage
TpMuguga_04g00660 succinyl-CoA synthetase subunit alpha from Theileria parva strain Muguga
59% identity, 86% coverage
- Characterization of the Theileria parva sporozoite proteome
Nyagwange, International journal for parasitology 2018 - “...hydratase-1 (TpMuguga_01g01050); IDH, isocitrate dehydrogenase (TpMuguga_04g00620); OGDH, oxoglutarate dehydrogenase (TpMuguga_01g00262); SCL, succinyl coenzyme A ligase (TpMuguga_04g00660); SDH, succinate dehydrogenase (TpMuguga_01g00210); FH, fumarate hydratase-1 (TpMuguga_03g00078); MDH, malate dehydrogenase; MQOR, Malate: quinone oxidoreductase (TpMuguga_03g00758); CS, citrate synthase (TpMuguga_02g00666); PEPC, phosphoenolpyruvate carboxylase; PEPCK, phosphoenolpyruvate carboxykinase (TpMuguga_01g00495). (For interpretation of...”
DR1248 succinyl-CoA synthetase, alpha subunit from Deinococcus radiodurans R1
53% identity, 93% coverage
NP_841839 ATP-citrate lyase/succinyl-CoA ligases:DUF184 from Nitrosomonas europaea ATCC 19718
55% identity, 97% coverage
GL4_3373 succinate--CoA ligase subunit alpha from Methyloceanibacter caenitepidi
54% identity, 98% coverage
- Possible cross-feeding pathway of facultative methylotroph Methyloceanibacter caenitepidi Gela4 on methanotroph Methylocaldum marinum S8
Takeuchi, PloS one 2019 - “...( ppc ; GL4_3372), malate dehydrogenase ( mdh ; GL4_0105), malate-CoA ligase ( mtk ; GL4_3373 and 3374) and malyl-CoA lyase ( mcl ; GL4_3371) were identified. In contrast, genes for the RuMP pathway, i.e. 3-hexulose-6-P synthase ( hps ) and 6-phospho-3-hexuloisomerase ( phi ), were...”
- “...Phosphoenolpyruvate carboxylase ppc 248 153 -0.69 0.000 GL4_0105 Malate dehydrogenase mdh 272 417 0.61 0.000 GL4_3373 Malate-CoA ligase alpha chain mtkB 705 405 -0.80 0.000 GL4_3374 Malate-CoA ligase beta chain mtkA 684 435 -0.65 0.000 GL4_3371 Malyl-CoA lyase mcl1 971 638 -0.61 0.000 Acetyl-CoA synthetase and...”
PAS_chr3_0831 Alpha subunit of succinyl-CoA ligase from Komagataella phaffii GS115
58% identity, 89% coverage
- Improving Methanol Utilization by Reducing Alcohol Oxidase Activity and Adding Co-Substrate of Sodium Citrate in Pichia pastoris
Liu, Journal of fungi (Basel, Switzerland) 2023 - “...+ -dependent isocitrate dehydrogenase), PAS_chr4_0580 (encoding Idh3, subunit of mitochondrial NAD + -dependent isocitrate dehydrogenase), PAS_chr3_0831 (encoding LSC1, alpha subunit of succinyl-CoA ligase), PAS_chr4_0733 (encoding SdhA, flavoprotein subunit of succinate dehydrogenase), PAS_chr1-4_0487 (encoding SdhC, putative protein of unknown function), PAS_chr3_0647 (encoding FumC, fumarase), PAS_chr2-1_0238 (encoding Mdh2,...”
- Transcriptome Analysis Unveils the Effects of Proline on Gene Expression in the Yeast Komagataella phaffii
Rumyantsev, Microorganisms 2021 - “...(PAS_chr2-2_0048) encoding the lipoamide dehydrogenase component of the complex did not change significantly. The KpLSC1 (PAS_chr3_0831) gene encoding -subunit of succinyl-CoA ligase did not change its expression, while the KpLSC2 (PAS_chr2-2_0407) gene encoding -subunit was more active in proline-containing media. Expression of the mitochondrial malic enzyme...”
cauri_2062 succinyl-CoA synthetase alpha subunit from Corynebacterium aurimucosum ATCC 700975
55% identity, 92% coverage
SUCD_THETH / P09143 Succinate--CoA ligase [GDP-forming] subunit alpha; Succinyl-CoA synthetase subunit alpha; SCS-alpha; EC 6.2.1.4 from Thermus thermophilus (see paper)
59% identity, 94% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit (By similarity). Can use either ATP or GTP, but prefers GTP (PubMed:22751660).
catalytic activity: GTP + succinate + CoA = succinyl-CoA + GDP + phosphate (RHEA:22120)
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
subunit: Heterotetramer of two alpha and two beta subunits.
Tagg_1019 succinate--CoA ligase subunit alpha from Thermosphaera aggregans DSM 11486
51% identity, 95% coverage
- Complete genome sequence of Thermosphaera aggregans type strain (M11TL)
Spring, Standards in genomic sciences 2010 - “...coenzyme A, accompanied by the generation of ATP [ 44 ]. A succinyl-CoA synthetase (Tagg_1018, Tagg_1019) and two putative acetyl-CoA synthetases were annotated in the T. aggregans genome. Subunits of one acetyl-CoA synthetase are encoded on different sites of the genome (Tagg_0340, Tagg_0726), whereas both genes...”
TTHA0537 succinyl-CoA synthetase alpha chain from Thermus thermophilus HB8
58% identity, 94% coverage
Desfe_1155 succinate--CoA ligase subunit alpha from Desulfurococcus amylolyticus DSM 16532
50% identity, 97% coverage
- Metabolic reconstruction and experimental verification of glucose utilization in Desulfurococcus amylolyticus DSM 16532
Reischl, Folia microbiologica 2018 - “...dehydrogenase flavoprotein domain protein (Desfe_0481). Succinyl-CoA synthetase beta subunit (Desfe_1156) and succinyl-CoA synthetase alpha subunit (Desfe_1155) convert succinate to succinyl-CoA. The 2-oxoglutarate ferredoxin oxidoreductase complex including two alphas (Desfe_0475 and Desfe_0499), two betas (Desfe_0474 and Desfe_0498), one gamma (Desfe_0497), and one delta subunit (Desfe_0500) catalyze the...”
- “...the dicarboxylate-4-hydroxybutyrate cycle (Berg et al. 2010 ), only the conversion from succinate to succinyl-CoA (Desfe_1155 and Desfe_1156), the oxidation to succinate semialdehyde (Desfe_0067) and the transformation to 4-hydroxybutyrate by homologs of alcohol dehydrogenase (Desfe_1240 and Desfe_0019), and the subsequent transformation from acetoacetyl-CoA to two acetyl-CoA...”
WP_067485390 succinate--CoA ligase subunit alpha from Nocardia sp. NPDC023988
55% identity, 89% coverage
MAB_1057 Succinyl-CoA synthetase, alpha chain from Mycobacterium abscessus ATCC 19977
52% identity, 96% coverage
SUCA_YEAST / P53598 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial; Succinyl-CoA synthetase subunit alpha; SCS-alpha; EC 6.2.1.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 4 papers)
YOR142W Alpha subunit of succinyl-CoA ligase, which is a mitochondrial enzyme of the TCA cycle that catalyzes the nucleotide-dependent conversion of succinyl-CoA to succinate; phosphorylated from Saccharomyces cerevisiae
53% identity, 87% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA (PubMed:9874242). The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit (By similarity).
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
subunit: Heterodimer of an alpha and a beta subunit. - Improving Identification of In-organello Protein-Protein Interactions Using an Affinity-enrichable, Isotopically Coded, and Mass Spectrometry-cleavable Chemical Crosslinker
Makepeace, Molecular & cellular proteomics : MCP 2020 - “...1 59 P05626 ATP4 P30902 ATP7 64 No Yes 9 4 29 31 P53312 LSC2 P53598 LSC1 64 Yes Yes 4 28 16 20 P21801 SDH2 Q00711 SDH1 54 Yes Yes 7 7 20 27 P00830 ATP2 P07251 ATP1 51 Yes Yes 9 17 16 18...”
- Regulation of xylose metabolism in recombinant Saccharomyces cerevisiae
Salusjärvi, Microbial cell factories 2008 - “...0.7 0.2 1.7 0.7 P00817 Ipp1p YBR011C inorganic diphosphatase -1.7 -0.5 -1.5 -0.9 0.3 -0.5 P53598 Lsc1p YOR142W succinate-CoA ligase (ADP-forming) -0.5 -0.4 0.6 0.1 1.1 0.4 P36060 Mcr1p YKL150W cytochrome-b5 reductase 1.8 0.1 3.3 1.5 1.4 1.4 P05694 Met6p YER091C methionine synthase -2.5 -1.3 -2.9...”
- Data integration uncovers the metabolic bases of phenotypic variation in yeast
Petrizzelli, PLoS computational biology 2021 - “...F6p_Fdp (YBR221C AND YER178W AND YFL018C AND YGR193C AND YNL071W ) Pyr_Accoa_m ( YGR244C AND YOR142W ) Succoa_Succ_m ( YGL080W AND (YGR243W OR YHR162W)) Pyr_tm We checked that pairwise correlations between proteins involved in the same complex were either positive or null, suggesting the absence of...”
- Adjustment of trehalose metabolism in wine Saccharomyces cerevisiae strains to modify ethanol yields
Rossouw, Applied and environmental microbiology 2013 - “...YPR001w YLR304c YJL200C YNL037c YOR136w YIL125w YDR148c YOR142w YGR244c Y15376 Y13485 Y12828 Y15212 Y17022 Y15362 Y12392 Y12284 Y13506 Y12398 Y15897 Diploids...”
- Identification of coherent patterns in gene expression data using an efficient biclustering algorithm and parallel coordinate visualization
Cheng, BMC bioinformatics 2008 - “...9.00E-04 YBR145W, YML120C, YMR145C, YOL059W 35 transposition, RNA-mediated 3.41E-06 1.36E-04 YCL020W, YER160C, YJR026W, YJR028W, YML040W, YOR142W 36 glycine catabolic process 1.94E-05 9.31E-04 YAL044C, YDR019C, YMR189W one-carbon compound metabolic process 4.79E-05 2.30E-03 YAL044C, YDR019C, YMR189W 41 karyogamy during conjugation with cellular fusion 4.10E-04 3.86E-02 YCL055W, YNL313C, YPL192C...”
- “...YOL009C, YOL027C, YOL038W, YOL059W, YPR011C 35 retrotransposon nucleocapsid 3.41E-06 9.89E-05 YCL020W, YER160C, YJR026W, YJR028W, YML040W, YOR142W 36 glycine cleavage complex 1.94E-05 4.46E-04 YAL044C, YDR019C, YMR189W 41 nuclear exosome (RNase complex) 4.93E-05 2.02E-03 YNL251C, YOL021C, YOR001W 54 MCM complex 1.19E-04 4.65E-03 YBR202W, YGL201C, YLR274W pre-replicative complex 9.21E-04...”
- Regulation of xylose metabolism in recombinant Saccharomyces cerevisiae
Salusjärvi, Microbial cell factories 2008 - “...1.7 0.7 P00817 Ipp1p YBR011C inorganic diphosphatase -1.7 -0.5 -1.5 -0.9 0.3 -0.5 P53598 Lsc1p YOR142W succinate-CoA ligase (ADP-forming) -0.5 -0.4 0.6 0.1 1.1 0.4 P36060 Mcr1p YKL150W cytochrome-b5 reductase 1.8 0.1 3.3 1.5 1.4 1.4 P05694 Met6p YER091C methionine synthase -2.5 -1.3 -2.9 -1.0 -0.4...”
- Ascospore formation in the yeast Saccharomyces cerevisiae
Neiman, Microbiology and molecular biology reviews : MMBR 2005 - “...YNR041c YNR045w YOL023w YOL126c YOR065w YOR125c YOR136w YOR142w YOR150w YOR158w YOR196c YOR358w YPL013c YPL060w YPL104w YPL118w YPL172c YPL173w YPL215w ORF...”
- Knowledge-based analysis of microarray gene expression data by using support vector machines
Brown, Proceedings of the National Academy of Sciences of the United States of America 2000 - “...misclassified genes Class Gene Locus TCA YPR001W YOR142W YLR174W YIL125W YDR148C YBL015W YPR191W YPL271W YPL262W YML120C YKL085W YGR207C YDL067C YPL037C YLR406C...”
- Genetic and biochemical interactions involving tricarboxylic acid cycle (TCA) function using a collection of mutants defective in all TCA cycle genes
Przybyla-Zawislak, Genetics 1999 - “...and LPD1 (YFL018c); succinylCoA ligase (synthetase), LSC1 (YOR142w), and LSC2 (YGR244c); succinate dehydrogenase (SDH), SDH1 (YKL148c), SDH2 (YLL041c), SDH3...”
- Genes of succinyl-CoA ligase from Saccharomyces cerevisiae
Przybyla-Zawislak, European journal of biochemistry 1998 (PubMed)- “...are required for catalytic activity. Two genes, LSC1 (YOR142W) and LSC2 (YGR244C), with high similarity to succinylCoA ligase subunits from other species were...”
- “...The LSC1 gene corresponds to SGD locus YOR142W (EMBL locus SCYOR142W, accession Z7050), and the encoded protein is defined as the...”
SCO4809 succinyl-CoA synthetase alpha subunit from Streptomyces coelicolor A3(2)
53% identity, 96% coverage
- A Proteomic Analysis Indicates That Oxidative Stress Is the Common Feature Triggering Antibiotic Production in Streptomyces coelicolor and in the pptA Mutant of Streptomyces lividans
Lejeune, Frontiers in microbiology 2021 - “...six enzymes that have a complex abundance pattern. It includes sub-units of ATP-generating succinylCoA synthases SCO4809 and SCO5842, as well as the malate dehydrogenase SCO5261, the -ketoglutarate dehydrogenase SCO4595, and the dihydrolipoamide succinyltransferase SCO2181 that generates NADH. The malate synthase SCO6243 of the glyoxylate cycle also...”
- ArgR of Streptomyces coelicolor is a versatile regulator
Pérez-Redondo, PloS one 2012 - “...Down 6264 SCO4770 guaB inosine-5-monophosphate dehydrogenase 0.032 Down 6269 SCO4771 inositol-5-monophosphate dehydrogenase 0.040 Down 6400 SCO4809 sucD succinyl-CoA synthetase subunit alpha 0.045 Down 6125 SCO4814 purH formyltransferase/IMP cyclohydrolase 0.030 Down 6167 SCO4837 (b) glyA serine hydroxymethyltransferase 0.010 Down 6678 SCO4856 (a) sdhA succinate dehydrogenase flavoprotein subunit...”
- “...(SCO4958, spot IN 6257) a cystathionine -synthase that uses O-succinyl/acetyl homoserine as substrate and SucD (SCO4809, spot IN 6400) the subunit of succinyl-CoA synthetase. Although no significant changes in the expression of these genes were observed, other genes related to succinate metabolism showed a differential expression...”
- Metabolic switches and adaptations deduced from the proteomes of Streptomyces coelicolor wild type and phoP mutant grown in batch culture
Thomas, Molecular & cellular proteomics : MCP 2012 - “...SCO4091 SCO1480 SCO5077 SCO1947 SCO5624 SCO4711 SCO3906 SCO5625 SCO4809 SCO3909 SCO2736 SCO2180 SCO6279 98.03 90.81 88.81 87.87 85.6 85.28 74.36 60.02 58.93...”
- “...through succinyl CoA synthetase (SCO4808 and SCO4809). Electron Transport and Oxidative Phosphorylation--Streptomyces are obligate aerobes and therefore use...”
- Quantitative proteomics analysis of Streptomyces coelicolor development demonstrates that onset of secondary metabolism coincides with hypha differentiation
Manteca, Molecular & cellular proteomics : MCP 2010 - “...and tricarboxylic acid cycle enzymes (SCO5423, SCO2951, SCO4809, and SCO4855), enzymes involved in amino acid metabolism (SCO2504, SCO1773, and SCO3304), etc....”
- “...SCO6661 SCO6658 SCO6662 SCO6659 SCO3092 SCO4855 SCO2951 SCO4809 SCO5368 SCO2736 SCO3304 SCO2504 SCO3023 SCO5739 SCO1773 SCO1494 SCO5547 SCO4958 SCO0216 SCO5212...”
- New pleiotropic effects of eliminating a rare tRNA from Streptomyces coelicolor, revealed by combined proteomic and transcriptomic analysis of liquid cultures
Hesketh, BMC genomics 2007 - “...GTP-binding protein SCO3801 100 1 putative aminopeptidase SCO3907 100 1 single strand DNA-binding protein ssb SCO4809 100 1 succinyl CoA synthetase alpha chain SucD SCO4813 97.7 0.87 phosphoribosylglycinamide formyltransferase PurN SCO4824 98.4 0.89 bifunctional protein (methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase FolD SCO4921 100 1 putative acyl-CoA...”
SAV_1817 succinyl-CoA synthetase subunit alpha from Streptomyces avermitilis MA-4680
52% identity, 91% coverage
sucD / P9WGC7 Succinyl-CoA ligase [ADP-forming] α subunit (EC 6.2.1.5) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
Rv0952 succinyl-CoA synthetase alpha subunit from Mycobacterium tuberculosis H37Rv
54% identity, 90% coverage
- Evaluation of the cross-immunity between Mycobacterium tuberculosis and Mycobacterium abscessus in vitro
Xu, BMC microbiology 2025 - “...Rv2534c) and belonged to the cell composition cluster (GO:0044464). The second cluster contained 4 proteins (Rv0952, Rv2215, Rv2195, and Rv0951) and belonged to the growth gene ontology term cluster (GO: 0040007). The third cluster contained 3 proteins (Rv0440, Rv0350, and Rv0006) and belonged to the response...”
- A systematic evaluation of Mycobacterium tuberculosis Genome-Scale Metabolic Networks
López-Agudelo, PLoS computational biology 2020 - “...glp D2 (Rv3302c, Glycerol-3-phosphate dehydrogenase), pyk (Rv1617, Pyruvate Kinase), suc C and suc D (Rv0951, Rv0952, Succinyl-CoA ligase), among others ( S17A Table ). Some of these genes e.g. icl and glt A are considered conditionally essential genes in the Online GEne Essentiality (OGEE) database [...”
- Resuscitation of Dormant "Non-culturable" Mycobacterium tuberculosis Is Characterized by Immediate Transcriptional Burst
Salina, Frontiers in cellular and infection microbiology 2019 - “...tricarboxylic acid cycle: sdhAB (Rv3318, Rv3319, succinate dehydrogenase subunit), acn (Rv1475c, aconitase) , sucCD (Rv0951, Rv0952, succinyl-CoA synthetase subunits), gltA2 (Rv0896, citrate synthase I), ndkA (Rv2245c, nucleoside phosphate kinase participating in nucleoside biosynthesis), and pntAb and pntB (Rv0156, Rv0157, transhydrogenase subunits providing transhydrogenation between NADH and...”
- More than cholesterol catabolism: regulatory vulnerabilities in Mycobacterium tuberculosis
Bonds, Current opinion in chemical biology 2018 - “...(2-methylcitrate lyase) Rv0889c CitA TCA Cycle Citrate synthase Rv0951 SucC Succinyl-CoA Transformation Succinyl-CoA synthetase -subunit Rv0952 SucD Succinyl-CoA Transformation Succinyl-CoA synthetase -subunit Rv1143 Mcr Cholesterol Side Chain Degradation -methyl-acyl-CoA racemase Rv1240 Mdh TCA Cycle & Glyoxylate Cycle Malate dehydrogenase Rv1492 MutA Methylmalonyl-CoA Pathway Methylmalonyl-CoA mutase (small...”
- Molecular Targets Related Drug Resistance Mechanisms in MDR-, XDR-, and TDR-Mycobacterium tuberculosis Strains
Hameed, Frontiers in cellular and infection microbiology 2018 - “...et al., 2009 ). Proteomic comparative study enlightened the 11 proteins (Rv1080c, Rv1827, Rv2623, Rv1636, Rv0952, Rv1932, Rv0009, Rv0054, Rv2889c, Rv3418c, and Rv3914) that were overexpressed in the presence of OFX and MOX. Among them, Rv1636, Rv2623, and Rv1827 were reported with unidentified functions. Molecular docking...”
- Comparing isogenic strains of Beijing genotype Mycobacterium tuberculosis after acquisition of Isoniazid resistance: A proteomics approach
Nieto, Proteomics 2016 - “...V 0.5 SuccinylCoA synthetase beta chain sucC Rv0951 IMR 4.1 SuccinylCoA synthetase alpha chain sucD Rv0952 IMR 3.9 EnoylCoA hydratase EchA9 echA9 Rv1071c L 1.8 6phosphogluconate dehydrogenase, decarboxylating Gnd2 gnd2 Rv1122 IMR 2.9 Integration host factor MihF mihF Rv1388 IP 1.7 Transaldolase tal Rv1448c IMR 0.5...”
- Integration of Metabolic Modeling with Gene Co-expression Reveals Transcriptionally Programmed Reactions Explaining Robustness in Mycobacterium tuberculosis
Puniya, Scientific reports 2016 - “...with both Rv1336 and Rv2334 include Rv1436 (GAPD), Rv1437 (PGK) , Rv1438 (TPI), Rv0489 (PGM), Rv0952 (SUCOAS), Rv0694 (LDH_L) and Rv1304-Rv1311 (ATPS4r). The expression of these genes were negatively correlated with Rv0848 . Conversely, expression of genes coding for fumarate reductase ( Rv1552 AND Rv1554 AND...”
- Proteome analysis of ofloxacin and moxifloxacin induced mycobacterium tuberculosis isolates by proteomic approach
Lata, Protein and peptide letters 2015 (PubMed)- “...helpful in exploring new diagnostics and drug targets. Our study explored eleven proteins (Rv2889c, Rv2623, Rv0952, Rv1827, Rv1932, Rv0054, Rv1080c, Rv3418c, Rv3914, Rv1636 and Rv0009) that were overexpressed in the presence of drugs. Among them, Rv2623, Rv1827 and Rv1636 were identified as proteins with unknown function....”
- More
Mb0977 PROBABLE SUCCINYL-COA SYNTHETASE (ALPHA CHAIN) SUCD (SCS-ALPHA) from Mycobacterium bovis AF2122/97
54% identity, 90% coverage
SUCA3_TRIVA / P53401 Succinate--CoA ligase [ADP-forming] subunit alpha-3, mitochondrial; Succinyl-CoA synthetase subunit alpha-3; SCS-alpha-3; EC 6.2.1.5 from Trichomonas vaginalis (see paper)
XP_001328129 succinyl CoA synthetase-3 alpha subunit from Trichomonas vaginalis G3
57% identity, 92% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.
catalytic activity: GTP + succinate + CoA = succinyl-CoA + GDP + phosphate (RHEA:22120)
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
subunit: Heterodimer of an alpha and a beta subunit. - The draft genome of Kipferlia bialata reveals reductive genome evolution in fornicate parasites
Tanifuji, PloS one 2018 - “...- ASCT B * - - ASCT C XP_001330176 - ACS - EET01173 SCSa * XP_001328129 - SCSb XP_001303981 - Antioxidant defenses Trx * EAY13577 EES99386 TrxR XP_001316923 EET01934 TrxP EAY01083 ESU45818 SOD * EAY08252 - HCP * AAL66298 AAL66297 Rbr * XP_001320125 - The list...”
α-SCS2 / P53400 succinyl-CoA synthetase α-2 subunit (EC 6.2.1.5) from Trichomonas vaginalis (see 4 papers)
SUCA2_TRIVA / P53400 Succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial; Succinyl-CoA synthetase subunit alpha-2; SCS-alpha-2; EC 6.2.1.5 from Trichomonas vaginalis (see paper)
Q65ZG5 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial from Trichomonas vaginalis
56% identity, 92% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
subunit: Heterodimer of an alpha and a beta subunit. - Introduction of protein vaccine candidate based on AP65, AP33, and α-actinin proteins against Trichomonas vaginalis parasite: an immunoinformatics design
Ghasemi, Parasites & vectors 2024 - “...Results Genome extraction of AP33, AP65, and -actinin proteins The sequences of AP33 (accession number: Q65ZG5), AP65 (accession number: Q27093), and -actinin (accession number: O96524) proteins were extracted from the UniProtKB database. Prediction of B cell epitopes Prediction of B cell epitopes for all three proteins,...”
SUCA1_TRIVA / P53399 Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial; Succinyl-CoA synthetase subunit alpha-1; SCS-alpha-1; EC 6.2.1.5 from Trichomonas vaginalis (see paper)
57% identity, 92% coverage
- function: Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.
catalytic activity: succinate + ATP + CoA = succinyl-CoA + ADP + phosphate (RHEA:17661)
subunit: Heterodimer of an alpha and a beta subunit.
MSMEG_5524 succinyl-CoA synthetase, alpha subunit from Mycobacterium smegmatis str. MC2 155
52% identity, 96% coverage
Dret_0545 succinyl-CoA synthetase, alpha subunit from Desulfohalobium retbaense DSM 5692
49% identity, 41% coverage
- Complete genome sequence of Desulfohalobium retbaense type strain (HR(100))
Spring, Standards in genomic sciences 2010 - “...cycle, involving the enzymes fumarase (Dret_1068, Dret_1069), fumarate reductase (Dret_1065, Dret_1066, and Dret_1067), succinyl-CoA synthetase (Dret_0545) and 2-oxoglutarate ferredoxin oxidoreductase (Dret_1400/Dret_1403). The important five carbon precursor 2-oxoglutarate could also be synthesized from citrate by aconitase (Dret_1771) and isocitrate dehydrogenase (Dret_0439). Genes encoding the enzymes ATP-citrate lyase...”
Q47LR3 succinyl-CoA synthetase alpha subunit (EC 6.2.1.5) from Thermobifida fusca (strain YX) (see 2 papers)
Tfu_2576 succinyl-CoA ligase, alpha subunit from Thermobifida fusca YX
52% identity, 97% coverage
- Biosynthesis of adipic acid in metabolically engineered Saccharomyces cerevisiae
Zhang, Journal of microbiology (Seoul, Korea) 2020 (PubMed)- “...co-expressing genes of Tfu_ 0875, Tfu_2399, Tfu_0067, Tfu_1647, Tfu_2576, and Tfu_ 2576. The AA titer combined with biomass, cofactors and other by-products was...”
- “...Tfu_0067 and Tfu_1647, AmpR P3 T-vector with Tfu_2576 and Tfu_2577, AmpR P1-V1 pRS423 (His) with TTEF1-Tfu_0875-PTEF1-PGPD1-Tfu_2399-TTDH2, AmpR P2-V1 pHAC181...”
- Site-directed mutation to improve the enzymatic activity of 5-carboxy-2-pentenoyl-CoA reductase for enhancing adipic acid biosynthesis
Yang, Enzyme and microbial technology 2019 (PubMed)- “...genes: Tfu_0875, Tfu_2399, Tfu_0067, Tfu_1647, Tfu_2576 and Tfu_2577, which encodes -ketothiolase, 3-hydroxyacyl-CoA dehydrogenase, 3-hydroxyadipyl-CoA...”
- “...Tfu_2399 , Tfu_0067 , Tfu_1647 , Tfu_2576 and Tfu_2577 , which encodes -ketothiolase, 3-hydroxyacyl-CoA dehydrogenase, 3-hydroxyadipyl-CoA dehydrogenase,...”
- Production of adipic acid by the native-occurring pathway in Thermobifida fusca B6
Deng, Journal of applied microbiology 2015 (PubMed)- “...5-Carboxy-2pentenoyl-CoA reductase (Tfu_1647) and succinyl-CoA synthetase (Tfu_2576, Tfu_2577). The cell lysates of T. fusca wild-type strain with the...”
- “...E. coli (Burgard et al. 2011), Tfu_2577 and Tfu_2576 were identified with the capability of converting adipyl-CoA to adipate. Transcriptions of the genes...”
sucD / U1EX27 succinate-CoA ligase (ADP-forming) alpha sununit (EC 6.2.1.5) from Cutibacterium granulosum DSM 20700 (see paper)
50% identity, 96% coverage
Igni_0085 succinyl-CoA synthetase (ADP-forming) alpha subunit from Ignicoccus hospitalis KIN4/I
54% identity, 99% coverage
- Multi-omics analysis provides insight to the Ignicoccus hospitalis-Nanoarchaeum equitans association
Rawle, Biochimica et biophysica acta. General subjects 2017 - “...N2-acetyl-L-lysine aminotransferase t N2-Acetyl-L-Lysine m Igni_0945 Hypothetical protein t Igni_0445 Succinate dehydrogenase iron-sulfur subunit m Igni_0085 Succinyl-CoA synthetase (ADP-forming) alpha subunit t Igni_0086 Succinyl-CoA synthetase (ADP-forming) beta subunit t Succinate m Igni_0315 Acetylornithine deacetylase p L-Ornithine m Igni_0363 Hypothetical protein t Igni_1361 Glucokinase p Igni_0415 Glucose-6-phosphate...”
SAV_3451 succinyl-CoA synthetase subunit alpha from Streptomyces avermitilis MA-4680
52% identity, 98% coverage
R2XZF8 Succinate-CoA ligase, alpha subunit from Enterococcus gilvus ATCC BAA-350
49% identity, 90% coverage
- Study of sulfoglycolysis in <i>Enterococcus gilvus</i> reveals a widespread bifurcated pathway for dihydroxypropanesulfonate degradation
Chen, iScience 2024 - “...(Uniprot: R2XKG4 ), 3-HPS exporter; HpfX (Uniprot: R2XKF7 ), 3-sulfopropionaldehyde dehydrogenase; HpfYZ (Uniprot: R2XLL0 , R2XZF8 ), 3-sulfopropionate-CoA ligase; TauE (Uniprot: R2VCQ9 ), probable 3-sulfopropionate exporter; SQ, sulfoquinovose; SQGro, sulfoquinovosyl glycerol; SF, 6-deoxy-6-sulfofructose; SLA, sulfolactaldehyde; DHPS, dihydroxypropanesulfonate; 3-SPA, 3-sulfopropionaldehyde; 3-HPS, 3-hydroxypropanesulfonate; 3-SPC, 3-sulfopropionyl-CoA; 3-SP, 3-sulfopropionate. The...”
- “...6 -tagged HpfY ( Eg HpfY, Uniprot: R2XLL0) and untagged HpfZ ( Eg HpfZ, Uniprot: R2XZF8) were co-expressed followed by Ni 2+ affinity chromatography, leading to co-purification of the two subunits in a 1:1molar ratio as quantified by densitometric analysis of Coomassie Blue-stained SDS-PAGE bands (...”
DVU2137 succinyl-CoA synthetase, alpha/beta subunit (sucCD) from Desulfovibrio vulgaris Hildenborough
46% identity, 40% coverage
FRAAL1157 succinyl-CoA synthetase, alpha subunit, NAD(P)-binding from Frankia alni ACN14a
51% identity, 96% coverage
SSO2482 succinate--CoA ligase subunit alpha from Saccharolobus solfataricus P2
52% identity, 91% coverage
SACE_6668 succinyl-CoA synthetase subunit alpha from Saccharopolyspora erythraea NRRL 2338
51% identity, 98% coverage
- Transcriptome-guided target identification of the TetR-like regulator SACE_5754 and engineered overproduction of erythromycin in Saccharopolyspora erythraea
Wu, Journal of biological engineering 2019 - “...; methylmalonyl-CoA mutase subunit beta, SACE_5638 ; methylmalonyl-CoA mutase, SACE_5639 ; succinyl-CoA synthetase subunit alpha, SACE_6668 ; succinyl-CoA synthetase subunit beta, SACE_6669 ; phosphoenolpyruvate carboxykinase, SACE_7274 ) were analyzed by qRT-PCR. Compared to A226, SACE_1171 was transcriptionally down-regulated by 2.4- folds while the transcription of SACE_7274...”
- Integrated omics approaches provide strategies for rapid erythromycin yield increase in Saccharopolyspora erythraea
Karničar, Microbial cell factories 2016 - “...and amino acid biosynthesis. Notably, several proteins of the carbohydrate metabolism (e.g. succinyl-CoA synthetase subunit, SACE_6668; dihydrolipoamide succinyltransferase, SACE_1638; phosphogluconate dehydratase, SACE_1740; 6-phosphofructokinase, SACE_1704; ribose-phosphate pyrophosphokinase, SACE_0816) and nucleotide metabolism (inosine-5-monophosphate dehydrogenase, SACE_6708; phospho-2-dehydro-3-deoxyheptonate aldolase, SACE_1708; phosphoribosylaminoimidazolecarboxamide formyltransferase, SACE_6664) were observed in the WT strain, but...”
- “...one spot on the gel was found to belong to some of these proteins (SACE_1638, SACE_6668). Three glycolytic enzymes (glucose-6-phosphate isomerase, SACE_2158; 2-phosphoglycerate dehydratase, SACE_0838; phosphoglycerate mutase, SACE_6967) were detected only in the HP strain while glyceraldehyde 3-phosphate dehydrogenase (SACE_2143) was overexpressed in the HP strain....”
- Systems perspectives on erythromycin biosynthesis by comparative genomic and transcriptomic analyses of S. erythraea E3 and NRRL23338 strains
Li, BMC genomics 2013 - “...the variations affected three genes of the Krebs cycle, including SACE_0633 (citrate synthase), SACE_6636 and SACE_6668 (Additional file 2 : Table S2, Additional file 3 : Table S3, and Additional file 4 : Table S4). These results demonstrate that enhanced level of erythromycin biosynthesis in strain...”
- Comparative genomics and transcriptional profiles of Saccharopolyspora erythraea NRRL 2338 and a classically improved erythromycin over-producing strain
Peano, Microbial cell factories 2012 - “...1222) Pyruvate carboxylase SACE_6385 1206 kgd (sucA) Missense (1773 S) 2-oxoglutarate dehydrogenase complex El component SACE_6668 288 sucD In frame insertion (-2081, -209V, -210M, -2111, -212G, -213E) Succinyl-CoA synthetase, alpha subunit Nitrogen and amino acid metabolism SACE_0635 122 ureB Frameshift (-C 352) Urease beta subunit SACE_3800...”
cg2836 succinyl-CoA synthetase subunit alpha from Corynebacterium glutamicum ATCC 13032
C629_RS12805, NCgl2476 succinate--CoA ligase subunit alpha from Corynebacterium glutamicum SCgG2
52% identity, 97% coverage
- CRISPRi-Library-Guided Target Identification for Engineering Carotenoid Production by Corynebacterium glutamicum
Göttl, Microorganisms 2021 - “...plasmid carrying the sucC (cg2837) sgRNA This work pS_dCas9_ sucD pS_dCas9 plasmid carrying the sucD (cg2836) sgRNA This work pS_dCas9_ sugR pS_dCas9 plasmid carrying the sugR (cg2115) sgRNA This work pS_dCas9_ tal pS_dCas9 plasmid carrying the tal (cg1776) sgRNA This work pS_dCas9_ thiE pS_dCas9 plasmid carrying...”
- Physiological Response of Corynebacterium glutamicum to Indole
Walter, Microorganisms 2020 - “...cg2559 aceB malate synthase 1.79 cg2560 aceA isocitrate lyase 2.34 cg2719 putative enterochelin esterase 1.6 cg2836 sucD succinate-CoA ligase (ADP-forming), alpha subunit 2.06 cg2837 sucC succinate-CoA ligase (ADP-forming), beta subunit 2.23 cg2962 putative enzyme synthesing extracellular polysaccharides 2.12 cg2966 phe putative phenol 2-monooxygenase 2.08 cg3169 pck...”
- The copper-deprivation stimulon of Corynebacterium glutamicum comprises proteins for biogenesis of the actinobacterial cytochrome bc1-aa3 supercomplex
Morosov, The Journal of biological chemistry 2018 - “...cg0924 cg0952 cg0953 cg1293 cg1836 cg2403a cg2406a cg2546 cg2557 cg2836 cg2837 cg3022 cg3195 cg3335 a prpD2 prpB2 prpC2 mctB mctT qcrB ctaE sucD sucC mez mRNA...”
- Understanding the high L-valine production in Corynebacterium glutamicum VWB-1 using transcriptomics and proteomics
Zhang, Scientific reports 2018 - “...0.00 1770.94 8.9 21 NCgl0795 cg0949 gltA Titrate synthase 5.19/48929.41 2369.38 8992.08 4.4 23 NCgl2476 cg2836 sucD Succinyl-CoA synthetase subunit alpha 5.31/30259.75 1792.09 0.00 53.2 29 NCgl2167 cg2466 aceE Pyruvate dehydrogenase subunit E1 5.25/102826.2 6609.52 1984.81 NC 35 NCgl0355 cg0441 lpd Dihydrolipoamide dehydrogenase 5.41/50651.69 2076.01 0.00...”
- A New Strategy for Production of 5-Aminolevulinic Acid in Recombinant Corynebacterium glutamicum with High Yield
Yang, Applied and environmental microbiology 2016 - “...Gene deletion. The genes cg2837 (sucC) and cg2836 (sucD), encoding the two subunits of succinyl-CoA synthetase, were inactivated by in-frame deletion....”
- “...two neighboring genes, i.e., sucC (cg2837) and sucD (cg2836). As reported previously, inactivation of sucCD would redirect succinyl-CoA from the TCA cycle to...”
- Citrate utilization by Corynebacterium glutamicum is controlled by the CitAB two-component system through positive regulation of the citrate transport genes citH and tctCBA
Brocker, Journal of bacteriology 2009 - “...cg2184 cg3151 cg0759 cg0760 cg0762 cg2938 cg2940 cg2836 cg2837 cg3047 cg3048 cg0961 cg2426 cg1612 cg2610 cg3107 cg3195 NCgl0067 NCgl0068 NCgl2724 NCgl2725...”
- “...site and a promoter fragment of the arbitrarily chosen gene cg2836 (bp 557 to 226 with respect to the translational start site of cg2836) were tested. As shown...”
- Co-ordinated regulation of gluconate catabolism and glucose uptake in Corynebacterium glutamicum by two functionally equivalent transcriptional regulators, GntR1 and GntR2
Frunzke, Molecular microbiology 2008 - “...0.89 1.14 1.02 0.91 1.08 cg1774 Transketolase, tkt 2.87 1.13 0.83 1.07 1.09 1.03 1.12 cg2836 Succinyl-CoA synthetase chain, sucD 4.48 0.93 0.52 1.41 0.75 0.81 0.97 cg3399 Hypothetical protein 4.50 1.85 0.76 0.83 1.01 1.22 0.97 cg0143 Mannitol 2-dehydrogenase 4.52 1.19 2.11 1.27 0.98 1.13...”
- The IclR-type transcriptional repressor LtbR regulates the expression of leucine and tryptophan biosynthesis genes in the amino acid producer Corynebacterium glutamicum
Brune, Journal of bacteriology 2007 - “...cg3362 cg2565 cg3361 cg1419 cg2610 cg3360 cg2837 cg2137 cg2836 cg0303 cg3047 cg2138 cg2559 cg2136 cg0961 cg3096 cg3022 cg2636 cg2118 cg2630 cg1084 cg1615 cg1616...”
- Identification of key genes through the constructed CRISPR-dcas9 to facilitate the efficient production of O-acetylhomoserine in Corynebacterium glutamicum
Li, Frontiers in bioengineering and biotechnology 2022 - “...of the PPP; gltA , mdh , mqo , kgd , lpd , sucC , NCgl2476 , NCgl2480 of the TCA cycle; aceE , aceF , ldh , poxB of pyruvate catabolism; ackA , pta , NCgl1987 of acetate acylation; alaA , NCgl2247 , NCgl0670 ,...”
- Modular control of multiple pathways of Corynebacterium glutamicum for 5-aminolevulinic acid production
Ge, AMB Express 2021 - “...NAD(P)H-quinone dehydrogenase +0.48 +0.69 +0.15 C629_RS12810 sucC ADP-forming succinateCoA ligase subunit beta 0.85 0.92 0.13 C629_RS12805 sucD SuccinateCoA ligase subunit alpha 0.56 1.74 1.24 C629_RS02275 sdhB Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 2.04 0.77 +1.22 C629_RS02270 sdhA Fumarate reductase/succinate dehydrogenase flavoprotein subunit 2.21 0.95 +1.21 C629_RS02265 sdhCD...”
- Accelerated Growth of Corynebacterium glutamicum by Up-Regulating Stress- Responsive Genes Based on Transcriptome Analysis of a Fast-Doubling Evolved Strain
Park, Journal of microbiology and biotechnology 2020 - “...Malate: quinone oxidoreductase 5.18 NCgl2008 pyk Pyruvate kinase 0.90 Ncgl2126 sucB(aceF) OGDHC E2o subunit 1.47 NCgl2476 sucD OGDHC E2o subunit 5.57 NCgl2477 sucC Succinyl-CoA synthetase 3.00 NCgl2765 pck PEP carboxykinase 1.96 C. F 1 F 0 -ATP synthase Ncgl1159 atpB -Subunit of F 0 part 0.27...”
- Understanding the high L-valine production in Corynebacterium glutamicum VWB-1 using transcriptomics and proteomics
Zhang, Scientific reports 2018 - “...5.34/61950.39 0.00 1770.94 8.9 21 NCgl0795 cg0949 gltA Titrate synthase 5.19/48929.41 2369.38 8992.08 4.4 23 NCgl2476 cg2836 sucD Succinyl-CoA synthetase subunit alpha 5.31/30259.75 1792.09 0.00 53.2 29 NCgl2167 cg2466 aceE Pyruvate dehydrogenase subunit E1 5.25/102826.2 6609.52 1984.81 NC 35 NCgl0355 cg0441 lpd Dihydrolipoamide dehydrogenase 5.41/50651.69 2076.01...”
- Citrate utilization by Corynebacterium glutamicum is controlled by the CitAB two-component system through positive regulation of the citrate transport genes citH and tctCBA
Brocker, Journal of bacteriology 2009 - “...NCgl1917 NCgl1918 NCgl2131 NCgl0629 NCgl0630 NCgl2563 NCgl2565 NCgl2476 NCgl2477 NCgl2656 NCgl2657 NCgl0805 NCgl1368 NCgl2294 NCgl2709 NCgl2787 Gene name citA...”
Dhaf_2066 succinyl-CoA synthetase, alpha subunit from Desulfitobacterium hafniense DCB-2
50% identity, 99% coverage
BL0733 succinyl-CoA synthetase alpha subunit from Bifidobacterium longum NCC2705
51% identity, 89% coverage
SQWL_ACHSX / A0A3A6N9V6 ADP-forming sulfoacetate-CoA ligase subunit SqwL; ADP-forming sulfoacetate-CoA ligase subunit alpha; EC 6.2.1.- from Acholeplasma sp. (see paper)
43% identity, 97% coverage
- function: Part of a variant of the sulfo-TK pathway, a D-sulfoquinovose degradation pathway that produces sulfoacetate (PubMed:37404184). Hydrolyzes sulfoacetyl-coenzyme A (sulfoacetyl-CoA) to produce sulfoacetate and CoA coupled with the phosphorylation of ADP to generate ATP (PubMed:37404184). Cannot use succinate, acetate or 3- hydroxypropionate, and shows only residual activities with malonate and 3-sulfopropanoate (PubMed:37404184).
catalytic activity: sulfoacetate + ATP + CoA = sulfoacetyl-CoA + ADP + phosphate (RHEA:76683)
subunit: Forms a complex with SqwK.
MAV_1075 succinyl-CoA synthetase alpha chain from Mycobacterium avium 104
55% identity, 91% coverage
Dhaf_0192 CoA-binding domain protein from Desulfitobacterium hafniense DCB-2
44% identity, 97% coverage
SSO2482 Succinyl-CoA synthetase, alpha subunit (sucD) from Sulfolobus solfataricus P2
52% identity, 87% coverage
- Utilization of Phenol as Carbon Source by the Thermoacidophilic Archaeon Saccharolobus solfataricus P2 Is Limited by Oxygen Supply and the Cellular Stress Response
Wolf, Frontiers in microbiology 2020 - “...Sso2968 1.10.3.13 Caldariellaquinol oxidase (H+-transporting) (soxI) 0.10 0.06 1.05E-21 Sso1915 Transposase ISC1913 0.11 0.03 1.30E-16 Sso2482 6.2.1.5 Succinyl-CoA synthetase, alpha subunit (sucD) 0.12 0.02 2.21E-17 Sso3003 1.1.1.47 Glucose-1-dehydrogenase 0.14 0.02 4.15E-15 Sso1830 Transposase ISC1778 0.18 0.02 2.32E-12 Sso3194 1.2.1.9 Non-phosphorylating NAD(P)-dependent glyceraldehyde 3-phosphate dehydrogenase 0.23 0.06...”
- Global analysis of viral infection in an archaeal model system
Maaty, Frontiers in microbiology 2012 - “...FkbR2, putative, SSO1135 (48,72); Carbon monoxide dehydrogenase small chain, SSO2433 (12,24,36,48,72); Succinyl-CoA synthetase alpha subunit, SSO2482 (36); Succinyl-CoA synthetase beta subunit, SSO2483 (12, 24, 48, 72); Rubrerythrin, SSO2642 (12,24,36); Electron transfer flavoprotein, SSO2817 (48) Amino acid transport and metabolism X-pro aminopeptidase, SSO0010 (12,24); Prolidase, SSO0363 (48,72);...”
B1Y9G0 succinate-CoA ligase (ADP-forming) (subunit 1/2) (EC 6.2.1.5) from Pyrobaculum neutrophilum (see paper)
Tneu_1464 succinyl-CoA synthetase, alpha subunit from Thermoproteus neutrophilus V24Sta
50% identity, 97% coverage
SAUD_BILW3 / E5Y8P7 ADP-forming sulfoacetate-CoA ligase subunit SauD; EC 6.2.1.- from Bilophila wadsworthia (strain 3_1_6) (see paper)
41% identity, 98% coverage
- function: Involved in the degradation of sulfoacetate (PubMed:37414148). Catalyzes the CoA- and ATP-dependent conversion of sulfoacetate to sulfoacetyl-CoA and ADP (PubMed:37414148). Cannot use other sulfonic and carboxylic acids, and shows only residual activity with 3-sulfopropanoate and malonic acid (PubMed:37414148).
catalytic activity: sulfoacetate + ATP + CoA = sulfoacetyl-CoA + ADP + phosphate (RHEA:76683)
subunit: Forms a complex with SauC. - Isethionate is an intermediate in the degradation of sulfoacetate by the human gut pathobiont Bilophila wadsworthia
Liu, The Journal of biological chemistry 2023 - “...proposed B.wadsworthia pathway, sulfoacetate is activated by an ADP-forming sulfoacetate-CoA ligase (SauCD, UniProt E5Y8P8 and E5Y8P7 , distinct from the AMP-forming C.necator SauT), followed by reduction by the NAD(P)H-dependent sulfoacetaldehyde dehydrogenase SauS (E5Y8P9, 37% sequence identity to C.necator SauS) ( 24 ). Sulfoacetaldehyde is then reduced...”
- “...cloning, and plasmid construction Escherichia coli codon-optimized DNA fragments encoding B.wadsworthia SauCD ( Bw SauD, E5Y8P7; B w SauC, E5Y8P8) and SauS ( Bw SauS, E5Y8P9) were synthesized and inserted into the Ssp I site of the modified pET28 vector HT by Tsingke. The resulting plasmids...”
KKC1_RS08680 succinate--CoA ligase subunit alpha from Calderihabitans maritimus
40% identity, 97% coverage
PTH_1359 succinyl-CoA synthetase, alpha subunit from Pelotomaculum thermopropionicum SI
48% identity, 53% coverage
DSY0246 hypothetical protein from Desulfitobacterium hafniense Y51
43% identity, 62% coverage
sll1557 succinyl-CoA synthetase from Synechocystis sp. PCC 6803
31% identity, 95% coverage
- Biochemical elucidation of citrate accumulation in Synechocystis sp. PCC 6803 via kinetic analysis of aconitase
Nishii, Scientific reports 2021 - “...and citryl-CoA lyase. Query sequence CyanoBase ID Name K number Bits E-value A (ATP-citrate lyase) sll1557 sucD ; succinyl-CoA synthetase K01902 68.2 2e13 sll0401 gltA ; citrate synthase K01647 50.8 1e-07 slr1495 Unknown protein 30.4 0.38 sll0283 Unknown protein 28.1 1.7 sll1174 Unknown protein 27.3 2.4...”
- “...kinase K11527 25.4 8.4 slr0301 ppsA ; phosphoenolpyruvate synthase K01007 25.4 8.4 C (citryl-CoA synthetase) sll1557 sucD ; succinyl-CoA synthetase K01902 94.4 4e23 slr0058 Unknown protein 25.8 3.1 sll0816 Hypothetical protein 26.2 3.4 sll1687 PleD gene product homologue 25.8 4.5 slr2124 Short-chain alcohol dehydrogenase family 25.4...”
- Identification of the key functional genes in salt-stress tolerance of Cyanobacterium Phormidium tenue using in silico analysis
Shahbazi, 3 Biotech 2021 - “...sll0514 ggtB, slr0529 hypothetical protein, sll0800 sucD, sll1557 cph2, sll0821 hypothetical protein, ssr3188 mrgA, slr1894 cruE, sll0154 lspA, slr1366 pbpD,...”
- Diurnal Regulation of Cellular Processes in the Cyanobacterium Synechocystis sp. Strain PCC 6803: Insights from Transcriptomic, Fluxomic, and Physiological Analyses
Saha, mBio 2016 - “...genes encoding fumarase ( fumC / slr0018 ), succinyl coenzyme A synthetase ( sucD / sll1557 ), malic enzyme ( me / slr0721 ), and phosphoenolpyruvate carboxylase ( ppc / sll0920 ) were upregulated in the early light period (i.e., L1 and L3) (see Fig.S4B )....”
- rre37 Overexpression alters gene expression related to the tricarboxylic acid cycle and pyruvate metabolism in Synechocystis sp. PCC 6803
Iijima, TheScientificWorldJournal 2014 - “...kgd (sll1981, encoding a 2-OG decarboxylase), sucC (sll1023, encoding a succinyl-CoA synthetase beta chain), sucD (sll1557, encoding a succinyl-CoA synthetase alpha chain), sdhA (slr1233, encoding a succinate dehydrogenase flavoprotein subunit), sdhB (sll0823) (encoding a succinate dehydrogenase iron-sulfur subunit), sdhB (sll1625) (encoding a succinate dehydrogenase iron-sulfur subunit),...”
- A transcriptional regulator Sll0794 regulates tolerance to biofuel ethanol in photosynthetic Synechocystis sp. PCC 6803
Song, Molecular & cellular proteomics : MCP 2014 - “...synthase (Sll0401) and succinyl-CoA synthetase alpha chain (Sll1557) of TCA cycle, photosystem I assembly related protein (Sll0226) and carbon dioxide...”
- “...Sll0779 Sll0895 Sll0921 Sll1097 Sll1143 Sll1184 Sll1514 Sll1557 Sll1594 Sll1672 Sll1673 Sll1679 Sll1743 Sll1744 Sll1802 Sll1809 Sll1810 Sll1817 Sll1819 Sll1822...”
aq_1888 succinyl-CoA ligase alpha subunit from Aquifex aeolicus VF5
O67729 Succinyl-CoA ligase alpha subunit from Aquifex aeolicus (strain VF5)
34% identity, 77% coverage
ccsB / Q75VW6 citryl-CoA synthetase small subunit (EC 6.2.1.18) from Hydrogenobacter thermophilus (see paper)
Q75VW6 citrate-CoA ligase (EC 6.2.1.18) from Hydrogenobacter thermophilus (see paper)
HTH_0201 citryl-CoA synthetase small subunit from Hydrogenobacter thermophilus TK-6
33% identity, 83% coverage
6hxqA / Q75VW6 Structure of citryl-coa synthetase from hydrogenobacter thermophilus (see paper)
33% identity, 83% coverage
- Ligand: coenzyme a (6hxqA)
Clim_1231 ATP-citrate lyase/succinyl-CoA ligase from Chlorobium limicola DSM 245
32% identity, 44% coverage
SYNPCC7002_A0890 succinyl-CoA synthetase, alpha chain from Synechococcus sp. PCC 7002
32% identity, 80% coverage
- Natural and Synthetic Variants of the Tricarboxylic Acid Cycle in Cyanobacteria: Introduction of the GABA Shunt into Synechococcus sp. PCC 7002
Zhang, Frontiers in microbiology 2016 - “...coding sequences of ogdA (SynPCC7002_A2770), ssaD (SynPCC7002_A2771), sdhA (SynPCC7002_A2569), sdhB (SynPCC7002_A1094), or the sucCD operon (SynPCC7002_A0890 and SynPCC7002_A0891) were deleted and replaced by a DNA cassette that confers specific antibiotic resistance to produce the corresponding mutant strains of Synechococcus 7002 using the homologous recombination method (...”
- “...Although, it is well-known that 2-OGDH is absent in all cyanobacteria, succinyl-CoA synthase (encoded by SYNPCC7002_A0890 and SYNPCC7002_A0891) could still convert succinyl-CoA into succinate. Succinyl-CoA can potentially be produced from the degradation pathways for valine, leucine and isoleucine 1 , although not all of the genes...”
CT1088 citrate/2-methylcitrate synthase from Chlorobaculum tepidum TLS
30% identity, 47% coverage
- Differential RNA Sequencing Implicates Sulfide as the Master Regulator of S0 Metabolism in Chlorobaculum tepidum and Other Green Sulfur Bacteria
Hilzinger, Applied and environmental microbiology 2018 - “...an oTSS at position 503855 (Fig. 4B). CT1089 and CT1088 encode the two subunits of ATP:citrate lyase. CT1061 is a hypothetical protein with a predicted...”
- Both forward and reverse TCA cycles operate in green sulfur bacteria
Tang, The Journal of biological chemistry 2010 - “...3 HCO gltA (CT1834, citrate synthase) aclA (CT1088, ACL, subunit) aclB (CT1089, ACL, subunit) porA (CT1628, pyruvate: ferredoxin oxidoreductase) korB (CT0162,...”
- “...we examined the expression level of gltA versus aclAB (CT1088 -1089, encoding both subunits of ATP citrate lyase (ACL; EC 2.3.3.8)) and two sets of the sdhAB...”
aclA / Q9AJC4 ATP citrate synthase α subunit (EC 2.3.3.8) from Chlorobium limicola (see paper)
aclA / BAB21376.1 ATP-citrate lyase alpha-subunit from Chlorobium limicola (see paper)
34% identity, 44% coverage
B7FYT1 ATP-citrate synthase from Phaeodactylum tricornutum (strain CCAP 1055/1)
33% identity, 23% coverage
- Proteomic and biochemical responses to different concentrations of CO2 suggest the existence of multiple carbon metabolism strategies in Phaeodactylum tricornutum
Wu, Biotechnology for biofuels 2021 - “...under LC conditions. Moreover, proteins involved in the TCA cycle, such as citrate synthase (B7G9P5, B7FYT1), two subunits of succinyl-CoA synthetase (B7FXA2, B7G0K7), succinate dehydrogenase-related proteins (B7FTX1, B5Y5N6), a predicted protein related to isocitrate dehydrogenase activity (B7FVA8) and another predicted protein (B7FUR4), were significantly upregulated under...”
W7U8G3 ATP-citrate synthase from Nannochloropsis gaditana
33% identity, 23% coverage
An11g00510 uncharacterized protein from Aspergillus niger
33% identity, 38% coverage
- Evaluation of Aspergillus niger Six Constitutive Strong Promoters by Fluorescent-Auxotrophic Selection Coupled with Flow Cytometry: A Case for Citric Acid Production
Lu, Journal of fungi (Basel, Switzerland) 2022 - “...Meanwhile, with regards to citric acid degradation and by-product oxalate biosynthesis, cytoplasmic ATP-citrate lyase (AcsA, An11g00510 and AcsB, An11g00530), mitochondrial cis-aconitase AcoA (An08g10530), and cytoplasmic oxaloacetate acetylhydrolase OahA (An10g00820) were dramatically downregulated ( Table 2 ). 4. Discussion The filamentous fungus A. niger is an important...”
- “...1.24 An11g11230 ctpA Citrate/malate carrier protein 1.57 1.26 0.80 An08g10530 acoA cis-aconitase 0.66 0.52 0.79 An11g00510 acsA ATP-citrate lyase 0.45 0.46 1.02 An11g00530 acsB ATP-citrate lyase 0.51 0.50 0.98 An10g00820 oahA Oxaloacetate acetylhydrolase 0.19 0.62 3.23 An15g00070 mdhAc Cytoplasmic malate dehydrogenase 1.26 1.44 1.14 An11g04810 aox1...”
- Comprehensively dissecting the hub regulation of PkaC on high-productivity and pellet macromorphology in citric acid producing Aspergillus niger
Zheng, Microbial biotechnology 2022 - “...malate synthase masA (An15g01860), were also significantly downregulated. Moreover, cytoplasmic ATP citrate lyase genes, aclA (An11g00510) and aclB (An11g00530), were downregulated once the pkaC gene was expressed. These results demonstrated that pkaC played a vital role in the regulation of central metabolism. Finally, consistent with the...”
- Metabolic engineering with ATP-citrate lyase and nitrogen source supplementation improves itaconic acid production in Aspergillus niger
Hossain, Biotechnology for biofuels 2019 - “...WT AB1.13 CAD RPKM RPKM ATP-citrate lyase ANI_1_76094 ATP-citrate lyase subunit 1 ( aclA ) An11g00510 Cyto 325.61 325.45 506.32 505.54 ANI_1_78094 ATP-citrate lyase subunit 2 ( aclB ) An11g00530 Cyto 331.2 332.23 587.4 587.02 CAT system ANI_1_724074 Carnitine acetyl transferase ( facC ) An08g04990 Cyto/Nucleus...”
- Functional exploration of co-expression networks identifies a nexus for modulating protein and citric acid titres in Aspergillus niger submerged culture
Cairns, Fungal biology and biotechnology 2019 - “...aclA An11g00530 Cytoplasmic ATP-citrate lyase kgd2 An11g11280 Dihydrolipoamide S-succinyl transferase fumR An12g07850 Fumarate hydratase aclB An11g00510 ATP:citrate oxaloacetate lyase Predicted functions and gene names were taken from either AspDB [ 28 ] or SGD [ 31 ] Expression of A. niger ageB , secG , and...”
- The transcriptomic signature of RacA activation and inactivation provides new insights into the morphogenetic network of Aspergillus niger
Kwon, PloS one 2013 - “...synthesis An05g00130 Knh1 -1,2-mannosyltransferase An04g06730 Mnn2 Primary metabolism isocitrate lyase AcuD An01g09270 Icl1 citrate lyase An11g00510 citrate lyase An11g00530 succinate dehydrogenase An16g07150 Osm1 aspartate transaminase, synthesis of glutamate An16g05570 acetyl-CoA carboxylase, synthesis of fatty acids An12g04020 homo-isocitrate dehydrogenase, synthesis of lysine An15g02490 Lys12 arginosuccinate synthetase, synthesis...”
Q3V117 ATP-citrate synthase from Mus musculus
35% identity, 22% coverage
- The human intestinal bacterium Eggerthella lenta influences gut metabolomes in gnotobiotic mice
Viehof, Microbiome research reports 2024 - “...negative Log2(FC) (-4.23 to -4.84). Cytoplasmic aspartate aminotransferase (UniProtKB ID: P05201), ATP-citrate synthase (UniProtKB ID: Q3V117), and thyroid hormone-inducible hepatic protein (UniProtKB ID: Q62264) were consistently under the top-ten downregulated proteins in the HFD groups. Cholesteryl ester hydrolase (UniProtKB ID: Q9Z0M5) was consistently under the top-ten...”
- Rabbit Antidiethoxyphosphotyrosine Antibody, Made by Single B Cell Cloning, Detects Chlorpyrifos Oxon-Modified Proteins in Cultured Cells and Immunopurifies Modified Peptides for Mass Spectrometry
Onder, Journal of proteome research 2021 - “...647.6631 71.7 10 VLYNLFTK diethoxyphosphate [Y3] Q9EPC1 -parvin 1133.6021 567.3047 55.0 11 GGPNYQEGLR diethoxyphosphate [Y5] Q3V117 ATP-citrate synthase 1226.5565 613.7818 79.6 12 YTIVVSATASDAAPLQYLAPYSGCSMGEYFR diethoxyphosphate [Y1] Q03265 ATP synthase subunit, mitochondrial 3524.6132 1175.5426 68.3 13 YTIVVSATASDAAPLQYLAPYSGCSMGEYFR diethoxyphosphate [Y17] Q03265 ATP synthase subunit, mitochondrial 3524.6132 1175.5426 90.3 14...”
- Proteomic Analysis of Mucopolysaccharidosis IIIB Mouse Brain
De, Biomolecules 2020 - “...C, ER, En, GA, M, N, PM Q61361 Bcan Brevican core protein 1.3 0.01264 ERS Q3V117 Acly ATP-citrate synthase 1.3 0.0078 C, M, N, PM Q8R570 Snap47 Synaptosomal-associated protein 47 1.3 0.00248 C, PM Q9DCS9 Ndufb10 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 1.2 0.01688...”
- Proteomic Analysis of Secretomes of Oncolytic Herpes Simplex Virus-Infected Squamous Cell Carcinoma Cells.
Tada, Cancers 2018 - “...Thioredoxin 12 5.7 3.7 1.55 0.10 P14211 Calreticulin 48 3.7 3.3 1.12 0.90 DAMPs-related proteins Q3V117 ATP-citrate synthase 121 28.0 21.0 1.33 0.025 * P56480 ATP synthase subunit beta, mitochondrial 56 24.0 17.0 1.41 0.42 Q03265 ATP synthase subunit alpha, mitochondrial 60 19.3 10.3 1.87 0.17...”
- Quantitative analysis of the murine lipid droplet-associated proteome during diet-induced hepatic steatosis
Khan, Journal of lipid research 2015 - “...Q9Z2X1 Q921I1 Q3UVN5 Q9D6Y9 Q00897 Q543J5 Q91X72 Q8QZR3 Q3V117 Q3UEI4 Q9CQ60 Q541E2 Q3U630 Q3TW74 Q9CWJ9 Q543J4 Q9EQF5 Q3U4W8 Q3UGC0 G5E8T9 Q9D6Y7 Timm44...”
ACLY_RAT / P16638 ATP-citrate synthase; ATP-citrate (pro-S-)-lyase; Citrate cleavage enzyme; EC 2.3.3.8 from Rattus norvegicus (Rat) (see 6 papers)
35% identity, 22% coverage
- function: Catalyzes the cleavage of citrate into oxaloacetate and acetyl-CoA, the latter serving as common substrate for de novo cholesterol and fatty acid synthesis.
catalytic activity: oxaloacetate + acetyl-CoA + ADP + phosphate = citrate + ATP + CoA (RHEA:21160)
cofactor: Mg(2+)
subunit: Homotetramer. - Fermented food consumption modulates the oral microbiota
Ibarlucea-Jerez, NPJ science of food 2024 - “...Aspartate aminotransferase 46400.0 6.52E04 2.10E02 5.9 P42930 Heat shock protein beta-1 22892.6 7.55E03 4.52E02 5.0 P16638 ATP-citrate synthase 120635.9 6.07E03 4.12E02 2.5 Q9EQS0 Transaldolase 37436.0 8.72E03 4.83E02 3.0 P27605 Hypoxanthine-guanine phosphoribosyltransferase 24477.2 5.80E05 6.65E03 4.0 P85973 Purine nucleoside phosphorylase 32301.9 5.58E04 2.10E02 3.1 P22283 Cystatin-related protein...”
- Candidate proteins interacting with cytoskeleton in cells from the basal airway epithelium in vitro
Olatona, Frontiers in molecular biosciences 2024 - “...Aldo-keto reductase family 1 member A1 36.5 0.040 P15178 Dars1 Aspartate--tRNA ligase, cytoplasmic 57.1 0.129 P16638 Acly ATP-citrate synthase 120.6 0.723 P22734 Comt Catechol O-methyltransferase 29.6 0.025 P18395 Csde1 Cold shock domain-containing protein E1 88.8 0.000 O08651 Phgdh D-3-phosphoglycerate dehydrogenase 56.5 0.351 Met-loss + Acetyl [N-Term]...”
- Extracellular vesicles released by steatotic hepatocytes alter adipocyte metabolism
Mleczko, Journal of extracellular biology 2022 - “...P62832 2.73 5.23E03 60S ribosomal protein L23 ST2A2_RAT P22789 2.35 3.78E03 Alcohol sulfotransferase A ACLY_RAT P16638 1.96 6.18E04 ATPcitrate synthase AL1A1_RAT P51647 1.86 1.16E03 Retinal dehydrogenase 1 6PGD_RAT P85968 1.80 3.56E07 6phosphogluconate dehydrogenase, decarboxylating AL1A7_RAT P13601 1.76 1.89E02 Aldehyde dehydrogenase, cytosolic 1 MARE2_RAT Q3B8Q0 1.61 1.88E02...”
- Gephyrin Interacts with the K-Cl Cotransporter KCC2 to Regulate Its Surface Expression and Function in Cortical Neurons
Al, The Journal of neuroscience : the official journal of the Society for Neuroscience 2022 (secret) - Brown Adipose Tissue Sheds Extracellular Vesicles That Carry Potential Biomarkers of Metabolic and Thermogenesis Activity Which Are Affected by High Fat Diet Intervention.
Camino, International journal of molecular sciences 2022 - “...Q4V7C7 Actin-related protein 3 0.011 2.46 RS12_RAT P63324 40S ribosomal protein S12 0.053 2.44 ACLY_RAT P16638 ATP-citrate synthase 0.010 2.34 CPT2_RAT P18886 Carnitine O-palmitoyltransferase 2, mitochondrial 0.008 2.31 ACADM_RAT P08503 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial 0.047 2.13 THIL_RAT P17764 Acetyl-CoA acetyltransferase, mitochondrial 0.006 2.12 PYC_RAT P52873...”
- Investigation into potential mechanisms of metabolic syndrome by integrative analysis of metabolomics and proteomics.
Chen, PloS one 2022 - “...mitochondrial Neurotransmitter degradation 1.237 0.0029 Acat2 Q5XI22 Acetyl-CoA acetyltransferase, cytosolic Cholesterol biosynthesis 1.999 0.0041 Acly P16638 ATP-citrate synthase Lipid metabolism 1.338 0.0002 Acot12 Q99NB7 Acyl-coenzyme A thioesterase 12 Lipid metabolism 0.832 0.0019 Agxt P09139 Serinepyruvate aminotransferase, mitochondrial Gluconeogenesis 1.236 0.0061 Aldh1a1 P51647 Retinal dehydrogenase 1 Retinoic...”
- Maternal methylmercury exposure changes the proteomic profile of the offspring's salivary glands: Prospects on translational toxicology
Cunha, PloS one 2021 - “...protein 1), P50398 (Rab GDP dissociation inhibitor alpha), P07323 (Gamma-enolase), P10111 (Peptidyl-prolyl cis-trans isomerase A), P16638 (ATP-citrate synthase), P61206 (ADP-ribosylation factor 3), P06685 (Sodium/potassium-transporting ATPase subunit alpha-1), P05065 (Fructose-bisphosphate aldolase A), P07335 (Creatine kinase B-type), P16617 (Phosphoglycerate kinase 1), A9UMV8 (Histone H2A.J). Early exposure to methylmercury...”
- Protein Targets of Acetaminophen Covalent Binding in Rat and Mouse Liver Studied by LC-MS/MS.
Geib, Frontiers in chemistry 2021 - “...hits 600mg/kg ( n = 4) P23457 3--hydroxysteroid dehydrogenase C170 SIGVSNFNC * R 2 4 P16638 ATP-citrate synthase C20 YIC * TTSAIQNR 2 4 O09171 Betaine-homocysteine S -methyltransferase 1 C131 QVADEGDALVAGGVSQTPSYLSC * K 3 4 P05178 Cytochrome P450 2C6 C372 FIDLIPTNLPHAVTC * DIK 3 1 P05179...”
- More
ACLY_MOUSE / Q91V92 ATP-citrate synthase; ATP-citrate (pro-S-)-lyase; Citrate cleavage enzyme; EC 2.3.3.8 from Mus musculus (Mouse) (see 3 papers)
Q91V92 ATP citrate synthase (EC 2.3.3.8) from Mus musculus (see 5 papers)
NP_598798 ATP-citrate synthase isoform 2 from Mus musculus
35% identity, 22% coverage
- function: Catalyzes the cleavage of citrate into oxaloacetate and acetyl-CoA, the latter serving as common substrate for de novo cholesterol and fatty acid synthesis.
catalytic activity: oxaloacetate + acetyl-CoA + ADP + phosphate = citrate + ATP + CoA (RHEA:21160)
cofactor: Mg(2+)
subunit: Homotetramer. - Nuclear Acly protects the liver from ischemia-reperfusion injury.
Gao, Hepatology (Baltimore, Md.) 2024 - GeneRIF: Nuclear Acly protects the liver from ischemia-reperfusion injury.
- BCKDHA contributes to melanoma progression by promoting the expressions of lipogenic enzymes FASN and ACLY.
Tian, Experimental dermatology 2023 (PubMed)- GeneRIF: BCKDHA contributes to melanoma progression by promoting the expressions of lipogenic enzymes FASN and ACLY.
- Cytoplasmic Endonuclease G promotes nonalcoholic fatty liver disease via mTORC2-AKT-ACLY and endoplasmic reticulum stress.
Wang, Nature communications 2023 - GeneRIF: Cytoplasmic Endonuclease G promotes nonalcoholic fatty liver disease via mTORC2-AKT-ACLY and endoplasmic reticulum stress.
- Hrd1-mediated ACLY ubiquitination alleviate NAFLD in db/db mice.
Li, Metabolism: clinical and experimental 2021 (PubMed)- GeneRIF: Hrd1-mediated ACLY ubiquitination alleviate NAFLD in db/db mice.
- Myeloid ATP Citrate Lyase Regulates Macrophage Inflammatory Responses In Vitro Without Altering Inflammatory Disease Outcomes.
Verberk, Frontiers in immunology 2021 - GeneRIF: Myeloid ATP Citrate Lyase Regulates Macrophage Inflammatory Responses In Vitro Without Altering Inflammatory Disease Outcomes.
- PP2Cδ Controls the Differentiation and Function of Dendritic Cells Through Regulating the NSD2/mTORC2/ACLY Pathway.
Lv, Frontiers in immunology 2021 - GeneRIF: PP2Cdelta Controls the Differentiation and Function of Dendritic Cells Through Regulating the NSD2/mTORC2/ACLY Pathway.
- FABP7 Regulates Acetyl-CoA Metabolism Through the Interaction with ACLY in the Nucleus of Astrocytes.
Kagawa, Molecular neurobiology 2020 - GeneRIF: FABP7 Regulates Acetyl-CoA Metabolism Through the Interaction with ACLY in the Nucleus of Astrocytes.
- Enhanced acetylation of ATP-citrate lyase promotes the progression of nonalcoholic fatty liver disease.
Guo, The Journal of biological chemistry 2019 - GeneRIF: ACLY-3K acetylation also promotes ACLY protein stability in AML12 cells, a mouse hepatocyte cell line, and found that the deacetylase sirtuin 2 (SIRT2) deacetylates ACLY-3K and destabilizes ACLY in these cells. Mimicking ACLY-3K acetylation by replacing the three lysines with three glutamines (ACLY-3KQ variant) promoted lipid accumulation both in high glucose-treated AML12 cells and in the livers of high-fat diet.
- More
- Adipose-specific overexpression of human AGPAT2 in mice causes increased adiposity and mild hepatic dysfunction.
Agarwal, iScience 2024 - “...LLYGESPWGVTPIPFETPLSPPIAR [611635] 68 8 1.00 0.85 63 11 1.00 1.06 593 85 1.00 0.86 Acly Q91V92 GQELIYAGMPITEVFK [839854] 514 67 1.00 0.37 573 67 1.00 0.76 3103 81 1.00 0.57 Elovl6 Q920L5 QFNENEAIQWMQENWK [1631] ND ND ND ND ND ND ND ND 21.00 3.00 1.00 0.90...”
- A Murine Model of Maternal Micronutrient Deficiencies and Gut Inflammatory Host-microbe Interactions in the Offspring.
Holani, Cellular and molecular gastroenterology and hepatology 2024 - “...2.63240828100999E-11 4.28292827320326E-08 Up-regulated P99028 Uqcrh 1.4452349299947400 7.77795280650818E-07 0.0012460280396026100 Up-regulated Q3UQ44 Iqgap2 1.237715263384300 9.73624453263659E-07 0.0015548782518620600 Up-regulated Q91V92 Acly 1.1646027714965200 2.55782944481409E-05 0.039620778100170300 Up-regulated Q68FD5 Cltc 0.8273326749240670 2.53546579080991E-08 4.10999004690286E-05 Up-regulated Q62351 Tfrc 3.3549532892756100 4.49519458491449E-09 7.30918639507096E-06 Up-regulated Q80X90 Flnb 0.8841179150567020 8.74911304281274E-07 0.0013998580868500400 Up-regulated Q8BFR5 Tufm 0.4368504158444770 6.4626739489949E-06 0.010236875535207900 Down-regulated Q8BH59...”
- Regulated adipose tissue-specific expression of human AGPAT2 in lipodystrophic Agpat2-null mice results in regeneration of adipose tissue.
Agarwal, iScience 2023 - “...LLYGESPWGVTPIPFETPLSPPIAR [611635] 68 8 1.00 0.42 63 11 1.00 2.59 593 85 1.00 0.26 Acly Q91V92 GQELIYAGMPITEVFK [839854] 514 67 1.00 0.18 573 67 1.00 0.77 3103 81 1.00 0.18 Elovl6 Q920L5 QFNENEAIQWMQENWK [1631] ND ND ND ND ND ND ND ND 21.00 3.00 1.00 0.31...”
- Tandem mass tag-based proteomics analysis of type 2 diabetes mellitus with non-alcoholic fatty liver disease in mice treated with acupuncture
Wang, Bioscience reports 2022 - “...350 Cep350 0.708 0.0283 down Q9QYR9 Acyl-coenzyme A thioesterase 2, mitochondrial Acot2 0.708 0.0011 down Q91V92 ATP-citrate synthase Acly 0.705 0.00136 down P19096 Fatty acid synthase Fasn 0.698 0.00244 down P97311 DNA replication licensing factor MCM6 Mcm6 0.682 0.00278 down Q62452 UDP-glucuronosyltransferase 1-9 Ugt1a9 0.676 0.00134...”
- “...1.26E-03 3.47 0.54 1.21E-02 0.64 P19096 Fatty acid synthase 7.71 1.89E-03 3.62 0.59 3.06E-02 0.70 Q91V92 ATP-citrate synthase 3.84 8.18E-04 2.46 0.60 7.38E-03 0.71 P55050 Fatty acid-binding protein 2 1.44 2.11E-01 1.59 0.76 3.02E-01 0.73 Q8VCH0 3-ketoacyl-CoA thiolase B, 4.83 7.74E-04 4.08 0.62 1.32E-02 0.59 P27786...”
- Identification of Full-Length Wild-Type and Mutant Huntingtin Interacting Proteins by Crosslinking Immunoprecipitation in Mice Brain Cortex
Sap, Journal of Huntington's disease 2021 - “...P46097 Syt2 4.35 1.3E-05 3.53 2.0E-03 [ 43 ] Q9D6F9 Tubb4a 1.11 1.8E-02 1.22 1.1E-03 Q91V92 Acly 1.10 3.2E-02 [ 43 ] Q60875 Arhgef2 1.09 6.3E-04 [ 43 ] P56382 Atp5f1e 2.81 4.8E-02 Q78IK2 Atp5md 1.41 2.4E-02 Q9CXW3 Cacybp 1.17 3.5E-02 Q6PHZ2 Camk2d 1.53 2.3E-02 Q8BI72...”
- Palm Oil-Rich Diet Affects Murine Liver Proteome and S-Palmitoylome
Ziemlińska, International journal of molecular sciences 2021 - “...2.55 0.50 1.01 0.83 Q8K2C9 * Hacd3 Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 1.62 0.95 0.88 1.17 Q91V92 Acly ATP-citrate synthase 1.52 0.50 1.03 0.88 Amino acid synthesis Q9CQT1 Mir1 Methylthioribose-1-phosphate isomerase 0.01 0.93 1.13 1.09 Q8VBT2 Sds L-serine dehydratase/L-threonine deaminase 0.29 0.87 0.97 0.93 O35490 Bhmt Betaine-homocysteine...”
- Role of Transportome in the Gills of Chinese Mitten Crabs in Response to Salinity Change: A Meta-Analysis of RNA-Seq Datasets
Malik, Biology 2021 - “...Plasminogen activator inhibitor 1 RNA-binding protein 0.99 1.5922 10 5 P29844 Endoplasmic reticulum chaperone BiP Q91V92 ATP-citrate synthase 0.99 1.6280 10 5 biology-10-00039-t003_Table 3 Table 3 List of six transcripts and their annotations (based on BLASTp) that were commonly identified in the individual datasets and the...”
- Dynamic Interplay between Copper Toxicity and Mitochondrial Dysfunction in Alzheimer's Disease
Tassone, Life (Basel, Switzerland) 2021 - “...[ 34 ] Creatine kinase U-type (Mia-CK) P30275 CKMT1 [ 34 ] ATP-Citrate synthase (ATP-CS) Q91V92 ACLY [ 34 ] Malate dehydrogenase (MDH) P08249 MDH2 [ 34 ] Pyruvate dehydrogenase E1 component subunit (PDHE1-A1) P35486 PDHA1 [ 34 ] Pyruvate dehydrogenase (acetyl-transferring) kinase isozyme 2 (PDKII)...”
- More
G3V9G4 ATP-citrate synthase from Rattus norvegicus
NP_001104565 ATP-citrate synthase isoform 2 from Rattus norvegicus
35% identity, 22% coverage
- Integrative proteomics and metabolomics of Guizhou Miao Sour Soup affecting simple obese rats.
Yuan, Frontiers in nutrition 2022 - “...Pck1 Down 0.707 0.0001971 Up 1.49 0.0009863 A4F267 Tomm40l Down 0.591 0.0019055 Up 1.32 0.0075392 G3V9G4 Acly Down 0.633 0.0180745 Up 1.534 0.0444326 D4A605 Nnmt Down 0.606 0.0110026 Up 1.564 0.0141326 D4A904 Nags Down 0.711 0.0011298 Up 1.361 0.003964 A0A0G2JSK9 Bhmt Down 0.474 0.0013865 Up 1.855...”
- Proteomic Analysis of the Spatio-temporal Based Molecular Kinetics of Acute Spinal Cord Injury Identifies a Time- and Segment-specific Window for Effective Tissue Repair
Devaux, Molecular & cellular proteomics : MCP 2016 - “...P10860 P10959 P11030 P11980 P12346 P12785 P13233 P13668 G3V9G4 P17425 P24155 P24329 P28037 P30904 P32232-2 P37361 P37805 P50398 P50408 P51635 P84079 P62161...”
- High level of ATP citrate lyase expression in human and rat pancreatic islets.
MacDonald, Hormone and metabolic research = Hormon- und Stoffwechselforschung = Hormones et metabolisme 2013 - GeneRIF: ATP citrate lyase is important for the pyruvate citrate shuttle and lipid synthesis in insulin secretion.
- Differences between human and rodent pancreatic islets: low pyruvate carboxylase, atp citrate lyase, and pyruvate carboxylation and high glucose-stimulated acetoacetate in human pancreatic islets.
MacDonald, The Journal of biological chemistry 2011 - GeneRIF: Differences between human and rodent pancreatic islets: low pyruvate carboxylase, atp citrate lyase, and pyruvate carboxylation and high glucose-stimulated acetoacetate in human pancreatic islets.
- Lower succinyl-CoA:3-ketoacid-CoA transferase (SCOT) and ATP citrate lyase in pancreatic islets of a rat model of type 2 diabetes: knockdown of SCOT inhibits insulin release in rat insulinoma cells.
Hasan, Archives of biochemistry and biophysics 2010 - GeneRIF: mRNAs of SCOT and ATP citrate lyase were decreased 55% and 58% and enzyme activities were decreased >70% in pancreatic islets of the GK rat, a model of type 2 diabetes.
- Normal flux through ATP-citrate lyase or fatty acid synthase is not required for glucose-stimulated insulin secretion.
Joseph, The Journal of biological chemistry 2007 (PubMed)- GeneRIF: Normal flux through ATP-citrate lyase is not required for glucose-stimulated insulin secretion.
- Characterization of cis-acting elements in the rat ATP citrate-lyase gene promoter.
Moon, Experimental & molecular medicine 2002 (PubMed)- GeneRIF: Results suggest that Sp1 acts on the ATP citrate lyase promoter to produce basal and induced transcription by low fat/high carbohydrate diets.
- Critical role for cataplerosis via citrate in glucose-regulated insulin release.
Flamez, Diabetes 2002 (PubMed)- GeneRIF: expression in insulin-producing beta cells is linked to glucose-regulated insulin secretion
- The identification of ATP-citrate lyase as a protein kinase B (Akt) substrate in primary adipocytes.
Berwick, The Journal of biological chemistry 2002 (PubMed)- GeneRIF: ATP-citrate lyase is a protein kinase B substrate in adipocytes
Q4LE36 ATP-citrate synthase (Fragment) from Homo sapiens
35% identity, 21% coverage
Q3TED3 ATP-citrate synthase from Mus musculus
35% identity, 22% coverage
- Quantitative phosphoproteomic analysis of prion-infected neuronal cells.
Wagner, Cell communication and signaling : CCS 2010 - “...7.9 1.26E-03 redox homeostasis; apoptosis 71 P16858 Glyceraldehyde-3-phosphate dehydrogenase 0.96943 58 23.4 5.69E-66 glycolysis 72 Q3TED3 Putative uncharacterized protein; ATP-citrate synthase 0.97174 2 4.3 4.63E-03 acetyl-CoA biosynthesis 73 Q03265 ATP synthase subunit alpha, mitochondrial 0.98925 2 13.6 1.81E-22 proton transport; lipid metabolism 74 Q9ERD7 Tubulin beta-3...”
8g1eA / P53396 Structure of acly-d1026a-products-asym (see paper)
34% identity, 23% coverage
- Ligands: acetyl coenzyme *a; oxaloacetate ion; (3s)-citryl-coenzyme a (8g1eA)
ACLY / P53396 ATP-citrate synthase (EC 2.3.3.8) from Homo sapiens (see 5 papers)
ACLY_HUMAN / P53396 ATP-citrate synthase; ATP-citrate (pro-S-)-lyase; ACL; Citrate cleavage enzyme; EC 2.3.3.8 from Homo sapiens (Human) (see 11 papers)
P53396 ATP citrate synthase (EC 2.3.3.8) from Homo sapiens (see 19 papers)
35% identity, 22% coverage
- function: Catalyzes the cleavage of citrate into oxaloacetate and acetyl-CoA, the latter serving as common substrate for de novo cholesterol and fatty acid synthesis.
catalytic activity: oxaloacetate + acetyl-CoA + ADP + phosphate = citrate + ATP + CoA (RHEA:21160)
cofactor: Mg(2+)
subunit: Homotetramer. - Transcriptomic and Proteomic Analysis of Monkeypox Virus A5L-Expressing HEK293T Cells
Li, International journal of molecular sciences 2025 - “...9,620,050 41,076,561.6 4.269891 Q9UKD2 3.95 MRTO4 7,057,619 78,872,065.8 11.17545 Q14697 3.56 GANAB 9,795,123 61,834,988.6 6.312834 P53396 3.37 ACLY 6,139,189 28,311,705.6 4.611636 Q01780 2.86 EXOSC10 3,204,284 16,656,062.6 5.198061 Q86UE4 2.71 MTDH 8,321,409 35,187,694.4 4.228574 P63151 2.62 PPP2R2A 5,711,416 36,989,877.6 6.476481 Q9NZM5 2.61 NOP53 5,430,802 30,995,616 5.707374 O75369...”
- Tibial cortex transverse transport surgery improves wound healing in patients with severe type 2 DFUs by activating a systemic immune response: a cross-sectional study.
Yu, International journal of surgery (London, England) 2025 - “...HPRT1 2.17 0.03 hsa:3251 3251 P22314 Ubiquitin-like modifier-activating enzyme 1 UBA1 2.13 0.05 hsa:7317 7317 P53396 ATP-citrate synthase ACLY 1.85 0.03 hsa:47 47 P02730 Band 3 anion transport protein SLC4A1 1.71 0.01 hsa:6521 6521 P16452 Protein 4.2 EPB42 1.68 0.04 hsa:2038 2038 Q9H4B7 Tubulin beta-1 chain...”
- Proteomic Analysis Reveals Cadherin, Actin, and Focal Adhesion Molecule-Mediated Formation of Cervical Cancer Spheroids
Molika, Cells 2024 - “...P0DP25 1.241 0.026 34 OLA1 Q9NTK5 1.178 0.041 35 TPD52 P55327 1.160 0.044 36 ACLY P53396 1.139 0.035 cells-13-02004-t002_Table 2 Table 2 Upregulated proteins in 3D-SiHa spheroids (vs. 2D cell culture) with log 2 FC > 1 and p < 0.05. No. Protein_Name Protein_Id logFC p...”
- A systematic review and meta-analysis of proteomic and metabolomic alterations in anaphylaxis reactions
Gallizzi, Frontiers in immunology 2024 - “...P01023 A2M A2M Alpha-2-macroglobulin NA P61221 ABCE1 ABCE1 ATP-binding cassette sub-family E member 1 NA P53396 ACLY ACLY ATP-citrate synthase NA P43652 AFAM AFM Afamin NA Q8IZ83 ALDH16A1 ALDH16A1 Aldehyde dehydrogenase family 16 member A1 NA P54886 P5CS ALDH18A1 Delta-1-pyrroline-5-carboxylate synthase NA Q10567 AP1B1 AP1B1 AP-1...”
- Comparison of Microalgae <i>Nannochloropsis oceanica</i> and <i>Chlorococcum amblystomatis</i> Lipid Extracts Effects on UVA-Induced Changes in Human Skin Fibroblasts Proteome
Atalay, Marine drugs 2024 - “...elevated expression of CD44 induced by UVA. In addition, the UVA-enhanced level of ATP-citrate synthase (P53396), which is involved in the citrate pathway participating in the regulation of inflammation by modulating the synthesis of the inflammatory mediators [ 29 ], was slightly reduced through the treatment...”
- “...Q12905 Interleukin enhancer-binding factor 2 0.58 0.78 0.55 0.88 0.30 1.72 0.68 0.56 0.80 0.32 P53396 ATP-citrate synthase 4.75 2.25 6.69 2.74 5.02 2.33 0.85 0.23 0.84 0.26 P20591 Interferon-induced GTP-binding protein Mx1 2.65 1.41 1.09 0.12 0.32 1.63 0.89 0.16 0.96 0.05 P03956 Interstitial collagenase/matrix...”
- ARID3C Acts as a Regulator of Monocyte-to-Macrophage Differentiation Interacting with NPM1.
Kim, Journal of proteome research 2024 - “...14 27.206 27.1318 NaN NaN 16 56 P55072 15 27.1571 26.9163 NaN NaN 15 53 P53396 16 27.2145 27.115 NaN NaN 15 52 P11021 17 27.2572 27.2982 NaN NaN 11 51 Q9BQE3 18 27.2042 27.0744 NaN NaN 9 50 P06733 19 27.4809 27.3402 NaN NaN 11...”
- Glioblastoma biomarkers in urinary extracellular vesicles reveal the potential for a 'liquid gold' biopsy.
Hallal, British journal of cancer 2024 - “...Q16851 UGP2 UTP--glucose-1-phosphate uridylyltransferase X CUSA EV +In vitro marker [ 3 , 40 ] P53396 ACLY ATP-citrate synthase X in vitro EV marker [ 40 ] P52907 CAPZA1 F-actin-capping protein subunit alpha-1 X CUSA-EV [ 3 ] Q99832 CCT7 T-complex protein 1 subunit eta X...”
- A Proteomic Approach Identified TFEB as a Key Player in the Protective Action of Novel CB2R Bitopic Ligand FD22a against the Deleterious Effects Induced by β-Amyloid in Glial Cells.
Polini, Cells 2024 - “...Gene Protein Name Score Cov Pep pI MW p -Value Ratio A 2535 /Ctrl 669 P53396 ACLY ATP-citrate synthase 72 * 2 2 6.95 120,839 0.0151 0.76 669 P53992 SC24C Protein transport protein Sec24C 63 * 2 2 6.71 118,325 0.0151 0.76 1099 P13798 APEH Acylamino-acid-releasing...”
- More
XP_003425261 ATP-citrate synthase from Nasonia vitripennis
32% identity, 22% coverage
H9BYW4 ATP-citrate synthase from Sus scrofa
34% identity, 22% coverage
G1FJ20 ATP-citrate synthase from Sus scrofa
35% identity, 22% coverage
- The Effects of Maternal Obesity on Porcine Placental Efficiency and Proteome
Li, Animals : an open access journal from MDPI 2019 - “...involved in triglyceride biosynthetic process 1 A5YV76 6249 Fatty acid synthase FASN 1.49 <0.001 2 G1FJ20 4204 ATP-citrate synthase ACLY 1.48 <0.001 3 C0KEG5 98 1-acylglycerol-3-phosphate O -acyltransferase 7 LPCAT4 1.51 0.001 4 I3LLU0 495 Glycerol-3-phosphate dehydrogenase GPD1L 1.57 <0.001 5 F1RWN0 159 Uncharacterized protein AGPAT2...”
NP_001098772 ATP-citrate synthase isoform 2 from Sus scrofa
A7UIU7 ATP-citrate synthase from Sus scrofa
34% identity, 22% coverage
AFUA_6G10650, Afu6g10650 ATP citrate lyase, subunit 1, putative from Aspergillus fumigatus Af293
Q4WM99 ATP citrate synthase from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
32% identity, 35% coverage
- Distinct transcriptional responses to fludioxonil in Aspergillus fumigatus and its ΔtcsC and Δskn7 mutants reveal a crucial role for Skn7 in the cell wall reorganizations triggered by this antifungal
Schruefer, BMC genomics 2023 - “...their sensitivity to methylglyoxal, but observed no differences in drop dilution experiments (data not shown). Afu6g10650 and Afu6g10660 are two neighbouring genes that are strongly down-regulated, in a wild type-specific manner (log 2 FC values: -2.42 after 1h and -2.36 after 3h as well as -2.43...”
- Extensive proteomic remodeling is induced by eukaryotic translation elongation factor 1Bγ deletion in Aspergillus fumigatus
O'Keeffe, Protein science : a publication of the Protein Society 2013 - “...5.40 78,425 78,425 78,425 70,009 18 3 19 10 AFUA_6G10650 AFUA_2G10070 AFUA_4G07360 11.9 11.7 11.7 8.60 6.10 6.33 78,828 129,214 87,072 33 25 31 AFUA_5G12770...”
- “...91,041 76,899 30 25 31 AFUA_5G02370 AFUA_3G11070 AFUA_6G10650 AFUA_5G11230 AFUA_1G09020 AFUA_3G08940 AFUA_4G07710 AFUA_6G14460 11.5 11.5 11.5 22.2 22.1 21.8...”
- The proteomic signature of Aspergillus fumigatus during early development
Cagas, Molecular & cellular proteomics : MCP 2011 - “...AFUA_6G06370 AFUA_3G07640 AFUA_1G12170 AFUA_5G06130 AFUA_6G10650 AFUA_4G11050 AFUA_5G10560 AFUA_5G04160 AFUA_3G08770 AFUA_6G13550 AFUA_6G10660 AFUA_6G02470...”
- Integrative analysis of the heat shock response in Aspergillus fumigatus
Albrecht, BMC genomics 2010 - “...AciA/Fdh) 1.17 0.66 -0.67 0.05 Yes AFUA_6G08050 (6-phosphogluconate dehydrogenase Gnd1) 2.21 1.85 0.55 1.03 Yes AFUA_6G10650 (ATP citrate lyase, subunit 1) 1.38 0.92 -0.16 0.33 Yes Nitrogen metabolism AFUA_1G10130 (adenosylhomocysteinase) 1.88 1.46 0.05 0.60 Yes AFUA_1G12840 (nitrite reductase NiiA) 2.75 2.30 1.19 1.54 Yes AFUA_2G11260 (3-isopropylmalate...”
- “...dehydrogenase Idp1) -0.76/0.91 (90) -0.77/0.93 (90) AFUA_4G11080 (acetyl-coenzyme A synthetase FacA) -0.79/0.97 (90) -0.71/0.93 (90) AFUA_6G10650 (ATP citrate lyase, subunit 1) -0.450/0.94 (60) -0.54/0.97 (60) Nitrogen metabolism AFUA_1G12840 (nitrite reductase NiiA) -0.22/0.95 (30) -0.20/0.83 (30) AFUA_2G11260 (3-isopropylmalate dehydratase) -0.34/0.93 (105) -0.37/0.94 (105) AFUA_2G13530 (bifunctional tryptophan synthase...”
- Exploring temporal transcription regulation structure of Aspergillus fumigatus in heat shock by state space model
Do, BMC genomics 2009 - “...transcription factor AFU6G08760 Prolineoxidase PrnD 2(+) AFU4G08170 Succinate-semialde hydedehydrogenase Uga2, putative AFU2G02050 Peptidyl-prolylcis-transisomerase D 2(-) AFU6G10650 ATP citrate lyase, subunit1, putative AFU4G06890 14-alphasterol demethylase Cyp51A 2(-) AFU6G10660 ATP citrate lyase subunit AFU1G14930 hypothetical protein 2(-) AFU1G03150 C-14 sterol reductase AFU7G05060 MGtC/SapB family membrane protein 2(-) AFU1G17630...”
- “...1062 (AFU3G14590), 1172 (AFU4G08340), 1553 (AFU5G08750), 1554 (AFU5G08800), 1806 (AFU6G06430), 1289 (AFU4G12010), 1931 (AFU6G10610), 1933 (AFU6G10650), 1934 (AFU6G10660), 2038 (AFU7G00170), 2036 (AFU7G00120), 2039 (AFU7G00200), 2050 (AFU7G01000), 2077 (AFU7G01920), 2078 (AFU7G01930), 2311 (AFU8G06340), 2312 (AFU8G06350). (A) network of 37C, (B) network of 48C. Gene information corresponding to...”
- The proteomic signature of Aspergillus fumigatus during early development
Cagas, Molecular & cellular proteomics : MCP 2011 - “...kDa UniProt ID Q4WQ57 Q4WEG3 Q4WET8 Q4WTU5 Q4WDL9 Q4WM99 Q4WQ47 Q4WPX5 Q4WCU3 Q4WJ44 Molecular & Cellular Proteomics 10.11 Q4X1H5 Q4WLQ8 Q4WPN3 Q4WG92 Q4WV46...”
AO090023000206 No description from Aspergillus oryzae RIB40
33% identity, 38% coverage
BBA_08608 ATP-citrate synthase subunit 1 from Beauveria bassiana ARSEF 2860
32% identity, 38% coverage
- Unveiling a Novel Role of Cdc42 in Pyruvate Metabolism Pathway to Mediate Insecticidal Activity of Beauveria bassiana
Guan, Journal of fungi (Basel, Switzerland) 2022 - “...pyruvate accumulation in the cdc42 mutant. Moreover, several upregulated genes (BBA_00790, BBA_09252, BBA_01687, BBA_04309, and BBA_08608) were involved in the participation of pyruvate in tricarboxylic acid (TCA) cycle and/or valine, leucine, and isoleucine biosynthesis. Three other upregulated genes (BBA_ 08607, BBA_02336, and BBA_07304) were also involved...”
C1GBJ2 ATP citrate synthase from Paracoccidioides brasiliensis (strain Pb18)
PADG_04993 ATP-citrate synthase subunit 1 from Paracoccidioides brasiliensis Pb18
32% identity, 38% coverage
- Extracellular vesicles from virulent P. brasiliensis induce TLR4 and dectin-1 expression in innate cells and promote enhanced Th1/Th17 response
Montanari, Virulence 2024 - “...C9-methyltransferase A UP (8S) 3,572532 0,037729 C1G0P4 long-chain acyl-CoA synthetase [EC:6.2.1.3] UP (12S) 3,064416 0,032289 C1GBJ2 ATP citrate synthase UP(D) 2,453147 0,000166 Other metabolisms C1G421 acetyl-CoA C-acetyltransferase UP(D) 6,076812 4,39E05 C1G3Y2 Alpha-1,6-mannosyltransferase subunit UP (8S) 4,92358 0,038532 C1G7A4 Alpha-galactosidase UP(D) 3,633348 0,000115 Cell cycle C1FYS5 Microtubule-associated...”
- Prediction of Conserved Peptides of Paracoccidioides for Interferon-γ Release Assay: The First Step in the Development of a Lab-Based Approach for Immunological Assessment during Antifungal Therapy
Rosa, Journal of fungi (Basel, Switzerland) 2020 - “...99% 100% Aminotransferase PAAG_03045 0.0 100% 98% Aminotransferase PAAG_00053 0.0 98% 100% ATP citrate synthase PADG_04993 0.0 100% 98% ATP_dependent 26S on proteasome regulation PAAG_01926 0.0 99% 100% Calnexin PAAG_07037 0.0 95% 100% Carrier ADP/ATP PAAG_08620 0.0 100% 97% Carrier calcium PAAG_07762 0.0 100% 98% Carnitil...”
- Metabolic Peculiarities of Paracoccidioides brasiliensis Dimorphism as Demonstrated by iTRAQ Labeling Proteomics
Araújo, Frontiers in microbiology 2019 - “...metabolic physiology, proteins related to the TCA cycle, such as pyruvate dehydrogenase (PADG_00246), ATP-citrate synthase (PADG_04993), succinyl-CoA ligase (PADG_02260 and PADG_00317), and aconitate hydratase (PADG_11845), were more abundant in yeast cells compared to transition phase and mycelium ( Figure 5 ). Also, proteins involved in the...”
EHS24_004735 citrate synthase from Apiotrichum porosum
32% identity, 21% coverage
- Draft Genome Sequence of the Oleaginous Yeast Apiotrichum porosum (syn. Trichosporon porosum) DSM 27194
Gorte, Journal of genomics 2019 - “...AMP deaminase (EHS24_003651), isocitrate dehydrogenase (EHS24_007601, EHS24_002540 and EHS24_002733), malic enzyme (EHS24_008089), ATP citrate lyase (EHS24_004735), acetyl-CoA carboxylase (EHS24_004089) and fatty acid synthase (EHS24_002351, EHS24_002352). The genome also encodes multiple copies of glucose oxidase (EHS24_007400, EHS24_008706, EHS24_008979, EHS24_009251, EHS24_009561), which is mandatory for the first step...”
Q5BAJ4 ATP citrate synthase (subunit 2/2) (EC 2.3.3.8) from Aspergillus nidulans (see paper)
32% identity, 38% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory