PaperBLAST

PaperBLAST Hits for sp|Q9LCT3|SECA_PSEAE Protein translocase subunit SecA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=secA PE=3 SV=1 (916 a.a., MFAPLLKKLF...)

Show query sequence

>sp|Q9LCT3|SECA_PSEAE Protein translocase subunit SecA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=secA PE=3 SV=1
MFAPLLKKLFGSKNERDVKRMAKAVQAINALEPQMVALSDEQLKAKTAEFQQRYAKGETL
DQLLPEAFAVVREAGKRVMGMRHFDVQLIGGMTLHDGKIAEMRTGEGKTLVGTLPVYLNA
LSGKGVHVVTVNDYLARRDANWMRPLYEFLGLSVGVVTPFQPPEDKRAAYAADITYGTNN
EFGFDYLRDNMAFSLDDKFQRELNFAVVDEVDSILIDEARTPLIISGQAEDSSELYIKIN
KLIPRLKRQVEEVEGKPTEEGHYSIDEKTRQVELNEQGHQFIEDLLSQNGLLGEGESLYS
AHNLSLLTHVYAALRAHTLFHRNVEYIVQGDQILLIDEHTGRTMPGRRLSEGLHQAIEAK
EGLPIQAESQTLASTTFQNYFRLYNKLAGMTGTADTEAFEFRQIYGLDVVVIPTHRPIAR
KDFNDLVYLTQEEKYAAIITDIKQCQALGRPILVGTASIESSEYVSKLLQEAGIEHKVLN
AKYHEKEAEIIAQAGAPGSVTIATNMAGRGTDILLGGNWEVEVAALENPTEEQIAQIKAE
WQKRHQQVIEAGGLHVIASERHESRRIDNQLRGRAGRQGDPGSSRFYLSLEDNLMRIFAS
DRVKNFMKALGMQSGEAIEHRMVTNAIEKAQRKVEGRNFDIRKQLLEFDDVANEQRKVIY
HMRNTLLSAEDVGETIKEFREETLSATINQHIPPQSLPEQWDIEGLEAALYSDFAVRLPI
QQWLDEDDKLYEETLRSKILEQIVAAYYEKEELAGAEALRAFEKQMLLRVLDDLWKDHLS
TMDHLRHGIHLRGYAQKNPKQEYKRESFTLFQELLDSIKRDTIRVLSHVQVRREDPAEEE
ARLRREAEELAKRMQFQHAEAPSMEQAVAGEEEELPEGPAPVVPLEPVRNEQKIGRNEPC
PCGSGKKYKHCHGQLD

Running BLASTp...

Found 226 similar proteins in the literature:

Q9LCT3 bacterial ABC-type protein transporter (EC 7.4.2.5) from Pseudomonas aeruginosa (see paper)
PA4403 translocase from Pseudomonas aeruginosa PAO1
100% identity, 100% coverage

• The antimicrobial peptide Esc(1-21)-1c increases susceptibility of Pseudomonas aeruginosa to conventional antibiotics by decreasing the expression of the MexAB-OprM efflux pump
  Canè, Frontiers in chemistry 2023
  • “...P52477 Multidrug resistance protein MexA mexA - 0.78 Q9HU56 Protein-export protein SecB secB - 0.72 Q9LCT3 Protein translocase subunit SecA secA - 0.56 P13794 Outer membrane porin F oprF - 0.40 Q51487 Outer membrane protein OprM oprM - 0.53 P52002 Multidrug resistance protein MexB mexB -...”
• Proteomic Analysis of Resistance of Gram-Negative Bacteria to Chlorhexidine and Impacts on Susceptibility to Colistin, Antimicrobial Peptides, and Ceragenins
  Hashemi, Frontiers in microbiology 2019
  • “...them in a translocation-competent state. Binds receptor SecA. Protein tetramerization, protein transport. Large positive 15 Q9LCT3 Protein translocase subunit SecA (SecA) Sec protein translocase complex, couples hydrolysis of ATP to protein transfer, SecB receptor. Protein import, protein targeting, protein transport by the Sec complex. 0.84 16...”
• Pf4 Phage Variant Infection Reduces Virulence-Associated Traits in Pseudomonas aeruginosa
  Tortuel, Microbiology spectrum 2022
  • “...protein SecF 3.27 PA3821 secD Secretion protein SecD 3.52 PA3822 yajC Conserved hypothetical protein 2.66 PA4403 secA Secretion protein SecA 2.96 PA4747 secG Secretion protein SecG 3.28 PA5128 secB Secretion protein SecB 3.66 TAT secretion system PA5068 tatA Translocation protein TatA 2.23 PA5069 tatB Translocation protein...”
• The OxyR-regulated phnW gene encoding 2-aminoethylphosphonate:pyruvate aminotransferase helps protect Pseudomonas aeruginosa from tert-butyl hydroperoxide
  Panmanee, PloS one 2017
  • “...CGGTAAA GCAT PA1648 probable oxidoreductase 9 17959901796026 103 ATGA TTCGCCG CCAT CAGTCTT ATCA GCGGGCT GGAT PA4403 secretion protein (SecA) 9 49376804937644 1028 ATGG TGCCGGC TCAG AAAAATG ATGT GCATGAC TTAT PA3242 probable lauroyl acyltransferase 9 36308013630765 160 ATGA GCCAAGC CGAC CTCCTCG ATCA AGACCCC GTAT PA0594 peptidyl-prolyl cis-trans...”
  • “...mvfR , qscR , PA2957, PA0846, betX , PA0192, PA1097, PA1423, phnW , PA1648, PA3242, PA4403, PA2999, PA0594 and PA5095 ( Table 2 ). Among this group, the RT-PCR results of the phnW gene, encoding 2-aminoethylphosphonate:pyruvate aminotransferase, revealed lower gene expression levels in the oxyR mutant...”
• Protein complex formation during denitrification by Pseudomonas aeruginosa
  Borrero-de, Microbial biotechnology 2017
  • “...found in the complex. Finally, multiple proteins constituting the SecAYEG translocon, like YajC (PA3822), SecA (PA4403), SecD (PA3821), SecF (PA3820) and YidC (PA5568), were identified as interaction partners (Dalbey and Kuhn, 2012 ; Kudva etal ., 2013 ). This is consistent with the need to secrete...”
• Analysis of Pseudomonas aeruginosa cell envelope proteome by capture of surface-exposed proteins on activated magnetic nanoparticles
  Vecchietti, PloS one 2012
  • “...protease ClpX 2 C,3 gyrB PA0004 DNA gyrase subunit B 2 C,3 - P,1 secA PA4403 Protein translocase subunit SecA SecA 2 C,3 clpV1 PA0090 Protein ClpV1 2 C,3 pcnB PA4727 Poly(A) polymerase 2 C,3 atpG PA5555 ATP synthase gamma chain ATPase 2 C,3 atpC PA5553...”
• Cellular reporter screens for inhibitors of Burkholderia pseudomallei targets in Pseudomonas aeruginosa
  Moir, Transactions of the Royal Society of Tropical Medicine and Hygiene 2008
  • “...Inducer gyrA PA3168 BPSL2521 DNA gyrase subunit A (DNA replication) 0 yes MDM271 complete secA PA4403 BPSL3016 Secretion protein SecA (Protein secretion) 0 yes MDM410 complete ligA PA1529 BPSL2164 DNA ligase (DNA replication) 213 yes MDM504 no detectable dependence glmU PA5552 BPSL0313 Glucosamine-1-phosphate acetyltransferase/N-acetylglucosamine-1-phosphate uridyltransferasen (Cell...”
• Proteomic, microarray, and signature-tagged mutagenesis analyses of anaerobic Pseudomonas aeruginosa at pH 6.5, likely representing chronic, late-stage cystic fibrosis airway conditions
  Platt, Journal of bacteriology 2008
  • “...tufA rpoA narH narH ldh efp icd acnB tig PA4403 PA4266 PA4265 PA4238 PA3944 PA3874 PA3874 PA3814 PA3655 PA3515 PA3529 PA3418 PA2851 PA2623 PA1787 PA1800 PA1777...”
  • “...PA4265 (tufA) PA4266 (fusA1) PA4273 (rplA) PA4385 (groEL) PA4403 (secA) PA4481 (mreB) PA4495 PA4602 (glyA3) PA4761 (dnaK) PA4902 PA5015 (aceE) PA5034 (hemE)...”
• Antibiotics as intermicrobial signaling agents instead of weapons
  Linares, Proceedings of the National Academy of Sciences of the United States of America 2006
  • “...PA4386 PA2853 PA1912 PA5040 PA0831 PA3397 PA3529 PA3529 PA4403 PA0764 PA4761 PA5053 PA1351 PA0523 PA5242 PA0294 PA0857 PA0374 PA0518 Gene product Tobramycin...”

Psyr_4094 SecA protein from Pseudomonas syringae pv. syringae B728a
84% identity, 100% coverage

• Novel high-throughput detection method to assess bacterial surfactant production
  Burch, Applied and environmental microbiology 2010
  • “...in the suhB homolog Psyr_1233, the secA homolog Psyr_4094, and a PhoH-like protein, Psyr_4346. No mutations were observed to cause visible increases in the...”
  • “...California, Berkeley WT (no insertion) Psyr_1233 (suhB) Psyr_4094 (secA) Psyr_2576 (syfA) Psyr_2577 (syfB) Psyr_4346 Psyr_3619 Psyr_3958 (algT) Psyr_1407 (pmpR)...”

VAS14_19926 preprotein translocase subunit SecA from Photobacterium angustum S14
65% identity, 100% coverage

• Shotgun redox proteomics: identification and quantitation of carbonylated proteins in the UVB-resistant marine bacterium, Photobacterium angustum S14
  Matallana-Surget, PloS one 2013
  • “...E 1 TLAG P RGGLILSNEGEDLYKK VAS14_19626 putative MreB, Actin-like ATPase D 1 SIDLGTANTLIYV K GQGIVLDEPSVVAIR VAS14_19926 translocase U 1 VQ R E R FFAVVDEVDSILIDEAR VAS14_19986 putative Pyruvate dehydrogenase complex C 4 LMPEFWQF P TVSMGLGPISAIYQAR VAS14_20006 aconitate hydratase C 4 ALVELLKN P PAGEESVLLDLLENR FPLGISFPAGSGLVAFAAATGVM P LDMPESILVR FPLGISFPAGSGLVAFAAA...”

SO4211, SO_4211 preprotein translocase, SecA subunit from Shewanella oneidensis MR-1
65% identity, 100% coverage

• Survival of Anaerobic Fe²⁺ Stress Requires the ClpXP Protease
  Bennett, Journal of bacteriology 2018
  • “...DEAD, ATP, Mg2 TM, S26, Mg2, K SO_4749 SO_4211 SO_2299 SO_0014 SO_0933 SO_3743 SO_1429 ATP synthase subunit alpha Protein translocase subunit Threonine-tRNA...”
• Identification of protein-protein interactions and topologies in living cells with chemical cross-linking and mass spectrometry
  Zhang, Molecular & cellular proteomics : MCP 2009
  • “...c SO0404, hypothetical protein SOA0110, lipoprotein, putative SO4211, preprotein translocase (SecA) SO1295, major outer membrane lipoprotein OM OM IM C IM...”

KP13_01897 preprotein translocase subunit SecA from Klebsiella pneumoniae subsp. pneumoniae Kp13
65% identity, 100% coverage

• The polymyxin B-induced transcriptomic response of a clinical, multidrug-resistant Klebsiella pneumoniae involves multiple regulatory elements and intracellular targets
  Ramos, BMC genomics 2016
  • “...rplX, rplR, rplE, rplO, rplI, rplN, rplL, rpsA ) and a protein translocase ( secA, KP13_01897). That these ribosomal genes group into the same module is consistent with previous reports indicating their cotranscription in other bacteria [ 60 ], thus supporting the co-expression based analytical approach...”

SEET0819_07560 preprotein translocase subunit SecA from Salmonella enterica subsp. enterica serovar Tennessee str.
65% identity, 100% coverage

• Whole Genome DNA Sequence Analysis of Salmonella subspecies enterica serotype Tennessee obtained from related peanut butter foodborne outbreaks
  Wilson, PloS one 2016
  • “...regulator 1583841 CP007505 coding SEET0819_07400 275 TAT->TTT Y->F N + transcriptional regulator 1623141 CP007505 coding SEET0819_07560 2526 ATG->ATA M->I N + preprotein translocase subunit SecA 2002950 CP007505 intergenic T->G 2293435 CP007505 coding SEET0819_10755 774 GAG->GAA E->E S + LysR family transcriptional regulator 2402138 CP007505 coding SEET0819_11250...”

VP0467 SecA protein from Vibrio parahaemolyticus RIMD 2210633
64% identity, 100% coverage

• QseC Inhibition as a Novel Antivirulence Strategy for the Prevention of Acute Hepatopancreatic Necrosis Disease (AHPND)-Causing Vibrio parahaemolyticus
  Yang, Frontiers in cellular and infection microbiology 2020
  • “...VP0464 1.740744 8.28E-11 UDP-N-acetylmuramoyl VP0465 1.743484 6.24E-11 UDP-N-acetylmuramoylalanyl-D-glutamate2 VP0466 1.889101 2.15E-12 Cell division protein FtsI VP0467 2.073686 1.80E-14 Penicillin-binding protein activator VP0468 1.984658 8.80E-13 Predicted endonuclease 5 VP0091 3.804372 1.85E-36 UPF0118 membrane protein SMc00793 VP0092 3.821178 2.33E-32 FIG01201038: hypothetical protein VP0093 3.492542 8.14E-30 putative membrane protein...”

Q83SN2 Protein translocase subunit SecA from Shigella flexneri
S0097 preprotein translocase; secretion protein from Shigella flexneri 2a str. 2457T
64% identity, 100% coverage

• Genomic and proteomic characterization of two strains of Shigella flexneri 2 isolated from infants' stool samples in Argentina
  Torrez, BMC genomics 2022
  • “...Description Coverage (%) Number of matching peptides MW (kDa) Calculated IP COG b CI133 strain Q83SN2 secA Protein translocase subunit SecA OS= Shigella flexneri OX=623 GN= secA PE=3 SV=1 16.98 44 102 5.6 U Q821A7 pssA Phosphatidylserine synthase OS= Shigella flexneri OX=623 GN= pssA PE=4 SV=2...”
• Complete DNA sequence and analysis of the large virulence plasmid of Shigella flexneri
  Venkatesan, Infection and immunity 2001
  • “...donor organism. Four of these 28, virF (S0051), shet2 (S0097), virA (S0191), and sopA (S0292) are known virulence factors (68). Most of the remainder encode...”
  • “...toxin genes are present on pWR501. The ShET2 enterotoxin (S0097, 566 aa) is present on the virulence plasmids of all species of Shigella (38). S0012 (533 aa)...”

Pea / b0098 protein translocation ATPase from Escherichia coli K-12 substr. MG1655 (see 8 papers)
SECA_ECOLI / P10408 Protein translocase subunit SecA; EC 7.4.2.8 from Escherichia coli (strain K12) (see 8 papers)
P10408 bacterial ABC-type protein transporter (EC 7.4.2.5) from Escherichia coli (see 8 papers)
TC 3.A.5.1.1 / P10408 Preprotein translocase subunit SecA aka PRLD aka AZI aka PEA aka B0098, component of General secretory pathway (Sec-SRP) complex from Escherichia coli (see 16 papers)
secA / GB|AAZ86901.1 secA preprotein translocase; secretion protein of IISP family from Escherichia coli K12 (see 16 papers)
NP_414640 protein translocation ATPase from Escherichia coli str. K-12 substr. MG1655
C4ZRJ3 Protein translocase subunit SecA from Escherichia coli (strain K12 / MC4100 / BW2952)
64% identity, 100% coverage

• function: Required for protein export, interacts with the SecYEG preprotein conducting channel. SecA has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving both as a receptor for the preprotein-SecB complex and as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit. Zinc is required for binding of the SecB chaperone to the extreme C-terminus of SecA.)
  subunit: Monomer and homodimer; probably dimeric in the cytoplasm. It is not yet clear whether the form that functions in protein insertion is monomeric or dimeric. Part of the essential protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF- YajC and YidC. Makes direct contact with SecY
  disruption phenotype: Essential. Leads to loss of translocation of lipoproteins Lpp and BRP.
• substrates: proteins
  tcdb comment: A biphasic pulling force may act on TMSs during translocon-mediated membrane integration (Ismail et al. 2012). Intermediate structures for the insertion of integral membrane proteins have been visualized (Bischoff et al. 2014). Insertion of the Type II single span (N-terminus, in, C-terminus, out) protein, RodZ, requires only SecYEG, SecA and the pmf, but not SecB, SecDF, YidC or FtsY (Rawat et al. 2015). The combined effects of ribosome and peptide binding to SecYEG may allow for co-translational membrane insertion of successive transmembrane segments (Ge et al. 2014). SecA penetrates deeply into the SecYEG channel during insertion, contacting transmembrane helices and periplasmic loops (Banerjee et al. 2017)
• Unsaturated fatty acids augment protein transport via the SecA:SecYEG translocon.
  Kamel, The FEBS journal 2022 (PubMed)
  • GeneRIF: Unsaturated fatty acids augment protein transport via the SecA:SecYEG translocon.
• Topology of the SecA ATPase Bound to Large Unilamellar Vesicles.
  Roussel, Journal of molecular biology 2022
  • GeneRIF: Topology of the SecA ATPase Bound to Large Unilamellar Vesicles.
• Single-molecule analysis of dynamics and interactions of the SecYEG translocon.
  Koch, The FEBS journal 2021 (PubMed)
  • GeneRIF: Single-molecule analysis of dynamics and interactions of the SecYEG translocon.
• Cellular dynamics of the SecA ATPase at the single molecule level.
  Seinen, Scientific reports 2021
  • GeneRIF: Cellular dynamics of the SecA ATPase at the single molecule level.
• Membrane Insertion of the M13 Minor Coat Protein G3p Is Dependent on YidC and the SecAYEG Translocase.
  Kleinbeck, Viruses 2021
  • GeneRIF: Membrane Insertion of the M13 Minor Coat Protein G3p Is Dependent on YidC and the SecAYEG Translocase.
• Iron is a ligand of SecA-like metal-binding domains in vivo.
  Cranford-Smith, The Journal of biological chemistry 2020
  • GeneRIF: Iron is a ligand of SecA-like metal-binding domains in vivo.
• The SecA ATPase motor protein binds to Escherichia coli liposomes only as monomers.
  Roussel, Biochimica et biophysica acta. Biomembranes 2020
  • GeneRIF: The SecA ATPase motor protein binds to Escherichia coli liposomes only as monomers.
• Direct visualization of the E. coli Sec translocase engaging precursor proteins in lipid bilayers.
  Sanganna, Science advances 2019
  • GeneRIF: Starting from nearly identical initial states, SecA more readily dissociated from SecYEG when engaged with the precursor of outer membrane protein A as compared to the precursor of galactose-binding protein.
• More
• The T4 phage DNA mimic protein Arn inhibits the DNA binding activity of the bacterial histone-like protein H-NS
  Ho, The Journal of biological chemistry 2014
  • “...subunit SecA Aldehyde-alcohol dehydrogenase P25516 B1XCM5 P06612 P33602 C4ZRJ3 P0A9Q7 10,868/179 4,534/66 4,327/80 4,242/70 3,471/61 2,969/47 68 72 59 60 56 60...”
• Structural assembly of the bacterial essential interactome
  Gómez, eLife 2024
  • “...gate and it is bound to YidCs N-terminal helix. Uniprot codes used for AF2: secA: P10408, secD: P0AG90, secE: P0AG96, secF: P0AG93, secY: P0AGA2, YidC; P25714. To gain a more comprehensive understanding of the translocon assembly, we generated a model of the HTL assembly, which encompasses...”
• Biodistribution of ⁸⁹Zr-DFO-labeled avian pathogenic Escherichia coli outer membrane vesicles by PET imaging in chickens
  Li, Poultry science 2023
  • “...transport and metabolism Cell inner membrane 398 P30845 EPTA Function unknown Cell inner membrane 399 P10408 SECA Intracellular trafficking, secretion, and vesicular transport Cell inner membrane 400 Q46798 YGER Cell wall/membrane/envelope biogenesis Cell inner membrane 401 P26647 PLSC Lipid transport and metabolism Cell inner membrane 402...”
• A coordinated proteomic approach for identifying proteins that interact with the E. coli ribosomal protein S12
  Strader, Journal of proteome research 2013
  • “...* 6 35 64.7 Protein hfq P05055 PNP transferase * 15 58 29.8 Polyribonucleotide nucleotidyltransferase P10408 SecA 22 64 35.8 Protein translocase subunit secA P0A6Z3 HtpG 4 11 8.9 Chaperone protein htpG P08622 DnaJ 6 22 23.7 Chaperone protein dnaJ P0A850 Trigger factor * 16 99...”
• Protein secretion and outer membrane assembly in Alphaproteobacteria
  Gatsos, FEMS microbiology reviews 2008
  • “...Caulobacter Rickettsia Brucella Escherichia Neisseria SecB Q9A224 Q9ZE76 Q8YE23 P0AG86 Q9JY16 SecA P38380 Q9ZCX7 Q8YJG2 P10408 Q9JYK8 SecY Q9A8T3 Q9ZCS5 Q8YHM0 P0AGA2 Q7DDS8 SecE Q9A3J8 P50054 Q8YHQ3 P0AG96 Q9K1J4 SecG Q9A7K4 Q9ZE68 Q8YHF4 P0AG99 Q7DD68 SPase I Q9A806 Q9ZE32 Q8YG73 P00803 Q9K056 SPase II Q9AAA6 Q9ZDC4...”
• Identification of enzymes and regulatory proteins in Escherichia coli that are oxidized under nitrogen, carbon, or phosphate starvation
  Noda, Proceedings of the National Academy of Sciences of the United States of America 2007
  • “...Q8FL75 P05793 P0A956 P0AD97 Q59346 P0A953 Q8FCU4 Q8FB98 P10408 P0AFG8 P0A8L2 P0AGD4 P0A837 P0A9D8 P00934 P27302 P59587 Protein name Protein MW Protein PI...”
• iPDA: integrated protein disorder analyzer
  Su, Nucleic acids research 2007
  • “...for DNA binding (PDB structure used: 1YSA). Figure 4. ( A ) The result of P10408 (SECA_ECOLI). ( B ) The 10 residues predicted by both WildSpan and DisPSSMP2 are plotted as red sticks on the structure of a homologous protein, SECA_BACSU (P28366). Other 12 WildSpan...”
• Two nonredundant SecA homologues function in mycobacteria
  Braunstein, Journal of bacteriology 2001
  • “...D17428 U21192 Q55357 BAB41941 BAB43747 P47847 AE005672 AE005672 P10408 P28366 Q41062 P38380 AF116183 U32772 AAF41891 O25475 QO1570 OO7497 P47318 % Similarity to...”

VVMO6_02568 preprotein translocase subunit SecA from Vibrio vulnificus MO6-24/O
62% identity, 100% coverage

• MARTX Toxin-Stimulated Interplay between Human Cells and Vibrio vulnificus
  Kim, mSphere 2020
  • “...for the type I secretion system, and many sec and tat genes (VVMO6_00227, VVMO6_02445, VVMO6_02446, VVMO6_02568, VVMO6_02900, and VVMO6_02901), which encode Sec (secretion) and Tat (twin-arginine translocation) translocase system proteins, were also expressed at slightly but significantly higher levels in WT V. vulnificus ( TableS5 )....”

YPO0564 preprotein translocase SecA from Yersinia pestis CO92
YP_3620 preprotein translocase SecA from Yersinia pestis biovar Medievalis str. 91001
64% identity, 100% coverage

• Transcriptomic studies and assessment of Yersinia pestis reference genes in various conditions
  Koch, Scientific reports 2019
  • “...Fw AGGCTGTCACTAACCCTCA Rv CGCTGTGCTTCTTCGTCT ftsZ YPO0560 cell division protein FtsZ Fw GCCATCTCCAGTCCGTTG Rv ATAGTGTTACCCACGGTCTC secA YPO0564 protein translocase subunit SecA Fw ATCAACCGCATGGAACCTG Rv TTTCGCTAAACGCTCACGGAAC rpoD YPO0643 RNA polymerase sigma factor Fw AAGACGGTATCAATCAGGTTC Rv ATTCGCCCGCTTCAACAC proC YPO0942 pyrroline-5-carboxylate reductase Fw TAAAGCCCCAGTTAATGGCCGATG Rv ACCAACTTATCGCTAAAATCGACCTG tolB YPO1124 translocation protein...”
• Comparative Lysine Acetylome Analysis of Y. pestis YfiQ/CobB Mutants Reveals that Acetylation of SlyA Lys73 Significantly Promotes Biofilm Formation of Y. pestis
  Tan, Microbiology spectrum 2023
  • “...Urease accessory protein UreE Nitrogen compound transport (GO:0071705) YP_3271 tatA Sec-independent protein translocase protein TatA YP_3620 secA Protein translocase subunit SecA YP_pCD36 yscU Yop proteins translocation protein U YP_pCD32 yscB Chaperone protein YscB YP_1032 tolB Tol-Pal system protein TolB YP_2776 metN1 Methionine import ATP-binding protein MetN...”

lpg1463 preprotein translocase subunit SecA from Legionella pneumophila subsp. pneumophila str. Philadelphia 1
60% identity, 100% coverage

• The LetA/S two-component system regulates transcriptomic changes that are essential for the culturability of Legionella pneumophila in water
  Mendis, Scientific reports 2018
  • “...1.28 Lpg1362 type II protein secretion LspG (general secretion pathway protein G) gspG 1.60 1.81 Lpg1463 preprotein translocase; secretion protein SecA secA 2.70 2.49 Lpg1871 signal peptidase I (lepB-1) lepB-1 1.62 1.56 Lpg2002 transmembrane protein YajC, preprotein translocase subunit yajC 1.64 1.62 Lpg2791 preprotein translocase, SecG...”

CBU_0147 protein translocase subunit from Coxiella burnetii RSA 493
61% identity, 100% coverage

• Quantitative Proteome Profiling of Coxiella burnetii Reveals Major Metabolic and Stress Differences Under Axenic and Cell Culture Cultivation
  Dresler, Frontiers in microbiology 2019
  • “...to NMII NMI NMII ACCM-D ACCM-2 L-929 ACCM-D to ACCM-2 ACCM-D to ACCM-2 Sec translocon CBU_0147 SecA Protein translocase subunit 1.22 1.15 1.42 0.86 0.81 CBU_0258 SecY Protein translocase subunit 0.45 0.62 0.51 1.60 2.22 CBU_0450 Ffh Signal recognition particle (SRP) subunit FFH/SRP54 0.20 2.28 0.89...”

6s0kh / A0A037YQ84 Ribosome nascent chain in complex with seca (see paper)
67% identity, 91% coverage

• Ligand: rna (6s0kh)

ACIAD0648 preprotein translocase, secretion protein of IISP family from Acinetobacter sp. ADP1
61% identity, 100% coverage

• Characterization of Highly Ferulate-Tolerant Acinetobacter baylyi ADP1 Isolates by a Rapid Reverse Engineering Method
  Luo, Applied and environmental microbiology 2022 (secret)

IX87_RS10940 preprotein translocase subunit SecA from Acinetobacter baumannii
61% identity, 100% coverage

• Antimicrobial Peptide Cec4 Eradicates Multidrug-Resistant Acinetobacter baumannii in vitro and in vivo
  Peng, Drug design, development and therapy 2023
  • “...IX87_RS18005 MFS transporter 2.78 4.4110 9 IX87_RS16610 Twin-arginine translocase TatA/TatE family subunit 3.0194 1.989510 3 IX87_RS10940 Protein translocase subunit SecA 1.4743 2.137710 3 IX87_RS15635 Preprotein translocase subunit SecE 1.7013 9.473910 4 IX87_RS03860 Type VI secretion system tube protein Hcp 1.4399 7.840910 4 Efflux related protein IX87_RS07445...”

E5A72_RS03500 preprotein translocase subunit SecA from Acinetobacter baumannii ATCC 17978
A1S_2862 preprotein translocase subunit SecA from Acinetobacter baumannii ATCC 17978
61% identity, 100% coverage

• Effects of Sub-Minimum Inhibitory Concentrations of Imipenem and Colistin on Expression of Biofilm-Specific Antibiotic Resistance and Virulence Genes in Acinetobacter baumannii Sequence Type 1894
  Shenkutie, International journal of molecular sciences 2022
  • “...VI secretion system protein E5A72_RS15605 acb: A1S_1564 4.2 1.3587 1.1006 General secretion pathway protein J E5A72_RS03500 acb: A1S_2862 5.376 1.65783 2.349 Preprotein translocase subunit SecA Two-component regulatory system E5A72_RS09610 acb: A1S_0399 4.1397 0.346 * 1.8361 LysR family transcriptional regulator E5A72_RS12380 acb: A1S_0992 1.617 0.132 * 1.3517...”
  • “...A1S_1310 K11892 type VI secretion system protein ImpK + 2971603 2972409 807 Bacterial secretion system E5A72_RS03500 acb: A1S_2862 Preprotein translocase subunit SecA 756066 758789 2724 E5A72_RS09610 acb: A1S_0399 LysR family transcriptional regulator + 1993774 1994670 897 Two-component system E5A72_RS13515 acb: A1S_1182 CRP 4 transcriptional regulator 2818333...”
• Effects of Sub-Minimum Inhibitory Concentrations of Imipenem and Colistin on Expression of Biofilm-Specific Antibiotic Resistance and Virulence Genes in Acinetobacter baumannii Sequence Type 1894
  Shenkutie, International journal of molecular sciences 2022
  • “...system protein E5A72_RS15605 acb: A1S_1564 4.2 1.3587 1.1006 General secretion pathway protein J E5A72_RS03500 acb: A1S_2862 5.376 1.65783 2.349 Preprotein translocase subunit SecA Two-component regulatory system E5A72_RS09610 acb: A1S_0399 4.1397 0.346 * 1.8361 LysR family transcriptional regulator E5A72_RS12380 acb: A1S_0992 1.617 0.132 * 1.3517 E5A72_RS13515 acb:...”
  • “...type VI secretion system protein ImpK + 2971603 2972409 807 Bacterial secretion system E5A72_RS03500 acb: A1S_2862 Preprotein translocase subunit SecA 756066 758789 2724 E5A72_RS09610 acb: A1S_0399 LysR family transcriptional regulator + 1993774 1994670 897 Two-component system E5A72_RS13515 acb: A1S_1182 CRP 4 transcriptional regulator 2818333 2819040 708...”
• Global Dynamic Proteome Study of a Pellicle-forming Acinetobacter baumannii Strain
  Kentache, Molecular & cellular proteomics : MCP 2017
  • “...Proteomics 16.1 three proteins of the Sec system (SecA (A1S_2862), SecD (A1S_2914), and SecY (A1S_3061)), as well as the chaperonin Skp (A1S_1968), and all the...”

B2FPB2 Protein translocase subunit SecA from Stenotrophomonas maltophilia (strain K279a)
59% identity, 100% coverage

• Subtractive genomics and molecular docking approach to identify drug targets against Stenotrophomonas maltophilia
  Saleem, PloS one 2021
  • “...and CoA biosynthesis Sml01240 -Biosynthesis of cofactors Sml00410- beta-Alanine metabolism 23 Protein translocase subunit SecA (B2FPB2) Sml02024- Quorum sensing Sml03060- Protein export Sml03070- Bacterial secretion system 24 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (B2FNY8) sml01110-Biosynthesis of secondary metabolites sml01100-Metabolic pathways sml01120-Microbial metabolism in diverse environments...”

SECA_HAEIN / P43803 Protein translocase subunit SecA; EC 7.4.2.8 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
HI0909 preprotein translocase SecA subunit (secA) from Haemophilus influenzae Rd KW20
60% identity, 99% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving both as a receptor for the preprotein-SecB complex and as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  cofactor: Zn(2+) (Binds 1 zinc ion per subunit.)
  subunit: Monomer and homodimer (By similarity). Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF-YajC and YidC (By similarity). Forms a complex with SecB (PubMed:14517549).
• Evolution of competence and DNA uptake specificity in the Pasteurellaceae
  Redfield, BMC evolutionary biology 2006
  • “...ffh (HI0106), serS (HI0110), secD (HI0240), dapA (HI0255), ruvB (HI0312), xerC (HI0676), ispB (HI0881), secA (HI0909), crp (HI0957), and dnaJ (HI1238). Homologues were identified using the BLASTP program (E-val < 10 -50 ) in the BLAST package [ 49 ]. For each gene, the amino acid...”
• Systematic identification of essential genes by in vitro mariner mutagenesis
  Akerley, Proceedings of the National Academy of Sciences of the United States of America 1998
  • “...by our assay (HI0454, HI0456, HI0597, HI0600, HI0905, HI0909, and HI1654), three were essential for growth on rich medium (HI0456, HI0909, and HI1654). These...”

HD1788 preprotein translocase SecA subunit from Haemophilus ducreyi 35000HP
58% identity, 100% coverage

• Haemophilus ducreyi Seeks Alternative Carbon Sources and Adapts to Nutrient Stress and Anaerobiosis during Experimental Infection of Human Volunteers
  Gangaiah, Infection and immunity 2016
  • “...HD1308 HD1309 HD1310 HD1311 HD1312 HD1736 HD1788 HD_RS05300 HD_RS05305 HD_RS05315 HD_RS05320 HD_RS05325 HD_RS05330 HD_RS05335 HD_RS05340 HD_RS05345 HD_RS05350...”
• Characterization of the CpxRA regulon in Haemophilus ducreyi
  Labandeira-Rey, Infection and immunity 2010
  • “...probability score, 5 1093) to E. coli psd, and HD1788 had 67% identity (BLAST probability score, 0.0) to E. coli secA. H. ducreyi apparently lacks homologs of...”

D512_17625 preprotein translocase subunit SecA from Burkholderia pseudomallei MSHR1043
58% identity, 98% coverage

• Within-host evolution of Burkholderia pseudomallei over a twelve-year chronic carriage infection
  Price, mBio 2013
  • “...Molecular transport seq0007 422966 GA NA NA NA No NA Unknown seq0008 15374 GC I637M D512_17625 ( BPSL3016 ) NS; deleterious Yes Seca Membrane transport; secretion seq0017 181448 CT S97F (S72F) b D512_21859 ( BPSS0946 ) NS; neutral Yes Class A -lactamase PenA -Lactam resistance seq0020...”
  • “...NS SNPs were identified in poorly characterized genes ( D512_01885 , D512_11778 , D512_14441 , D512_17625 , and D512_26783 ). Although the functional role of these genes remains enigmatic, our study demonstrates that they are all dispensable in chronic infection and their loss may even be...”

Q5F807 Protein translocase subunit SecA from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
58% identity, 100% coverage

• Availability of iron ions impacts physicochemical properties and proteome of outer membrane vesicles released by Neisseria gonorrhoeae
  Płaczkiewicz, Scientific reports 2023
  • “...Inorganic ion transport and metabolism Hypothetical protein Q5F785 T: Signal transduction Protein translocase subunit SecA Q5F807 U: Intracellular trafficking and secretion All identified OMVs proteins (from OMVs secreted in iron starvation, iron repletion, and control conditions) have been classified into functional categories of the cluster of...”

XF0806 preprotein translocase SecA subunit from Xylella fastidiosa 9a5c
58% identity, 100% coverage

• Xylella fastidiosa gene expression analysis by DNA microarrays
  Travensolo, Genetics and molecular biology 2009
  • “...XF1550 odhA Oxoglutarate dehydrogenase -0.72 Transport XF1527 xpsD General secretory pathway protein D precursor 1.04 XF0806 secA Preprotein translocase SecA 0.98 XF1937 gltP Proton glutamate symport 0.94 XF1913 tatD Type V secretory pathway 0.80 XF1426 dr0830 Ion transporter 0.69 XF1728 f451 Transport protein -3.27 XF0785 sac...”
• Whole-genome analysis of transporters in the plant pathogen Xylella fastidiosa
  Meidanis, Microbiology and molecular biology reviews : MMBR 2002
  • “...3.A.5.1.1 IISP IISP IISP IISP IISP IISP IISP XF0806 XF1910 XF0304 XF0224 XF0073 XF2639 XF0226 XF0225 XF1172 XF1147 XF1146 XF1145 XF1144 XF1143 XF1142 XF1148...”

BPSL3016 preprotein translocase SecA subunit from Burkholderia pseudomallei K96243
58% identity, 98% coverage

• Within-host evolution of Burkholderia pseudomallei over a twelve-year chronic carriage infection
  Price, mBio 2013
  • “...seq0007 422966 GA NA NA NA No NA Unknown seq0008 15374 GC I637M D512_17625 ( BPSL3016 ) NS; deleterious Yes Seca Membrane transport; secretion seq0017 181448 CT S97F (S72F) b D512_21859 ( BPSS0946 ) NS; neutral Yes Class A -lactamase PenA -Lactam resistance seq0020 32593 CA...”
• Cellular reporter screens for inhibitors of Burkholderia pseudomallei targets in Pseudomonas aeruginosa
  Moir, Transactions of the Royal Society of Tropical Medicine and Hygiene 2008
  • “...gyrA PA3168 BPSL2521 DNA gyrase subunit A (DNA replication) 0 yes MDM271 complete secA PA4403 BPSL3016 Secretion protein SecA (Protein secretion) 0 yes MDM410 complete ligA PA1529 BPSL2164 DNA ligase (DNA replication) 213 yes MDM504 no detectable dependence glmU PA5552 BPSL0313 Glucosamine-1-phosphate acetyltransferase/N-acetylglucosamine-1-phosphate uridyltransferasen (Cell wall...”

NMB1536 translocase from Neisseria meningitidis MC58
Q9JYK8 Protein translocase subunit SecA from Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
58% identity, 100% coverage

• Classification of <i>Neisseria meningitidis</i> genomes with a bag-of-words approach and machine learning
  Podda, iScience 2024
  • “...siaB, synB CMP-N-acetylneuraminic acid synthase NMB0069 NMC0053 Yes 3 NEIS1464 secA preprotein translocase subunit SecA NMB1536 NMC1464 In Escherichia coli, secA is part of the secretory pathway to deliver virulence factors to the extracellular environment; 40 it is also the first gene of an operon with...”
• Protein secretion and outer membrane assembly in Alphaproteobacteria
  Gatsos, FEMS microbiology reviews 2008
  • “...Rickettsia Brucella Escherichia Neisseria SecB Q9A224 Q9ZE76 Q8YE23 P0AG86 Q9JY16 SecA P38380 Q9ZCX7 Q8YJG2 P10408 Q9JYK8 SecY Q9A8T3 Q9ZCS5 Q8YHM0 P0AGA2 Q7DDS8 SecE Q9A3J8 P50054 Q8YHQ3 P0AG96 Q9K1J4 SecG Q9A7K4 Q9ZE68 Q8YHF4 P0AG99 Q7DD68 SPase I Q9A806 Q9ZE32 Q8YG73 P00803 Q9K056 SPase II Q9AAA6 Q9ZDC4 Q8YES8...”

NMC1464 preprotein translocase SecA subunit from Neisseria meningitidis FAM18
58% identity, 100% coverage

• Classification of <i>Neisseria meningitidis</i> genomes with a bag-of-words approach and machine learning
  Podda, iScience 2024
  • “...synB CMP-N-acetylneuraminic acid synthase NMB0069 NMC0053 Yes 3 NEIS1464 secA preprotein translocase subunit SecA NMB1536 NMC1464 In Escherichia coli, secA is part of the secretory pathway to deliver virulence factors to the extracellular environment; 40 it is also the first gene of an operon with many...”

BP3014 preprotein translocase subunit SecA from Bordetella pertussis Tohama I
Q7VUR2 Protein translocase subunit SecA from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
NP_881589 preprotein translocase secA subunit from Bordetella pertussis Tohama I
59% identity, 99% coverage

• A gel-free proteomic-based method for the characterization of Bordetella pertussis clinical isolates
  Williamson, Journal of microbiological methods 2012
  • “...9 (3) 6 (2) 6 (2) 6 (2) Carbohydrate metabolism Preprotein translocase subunit SecA NP_881589 BP3014 secA 100 CM 10 (7) 6 (4) 2 (2) 2 (2) Membrane transport Preprotein translocase subunit SecD NP_879831 BP1046 secD 69 CM 28 (11) 23 (10) 29 (11) 26 (10)...”
• Antibody Specificity Following a Recent Bordetella pertussis Infection in Adolescence Is Correlated With the Pertussis Vaccine Received in Childhood
  Raeven, Frontiers in immunology 2019
  • “...** 60kD chaperonin GroEL P48210 57.4 5.2 53.2 28 III Protein translocase subunit SecA SecA Q7VUR2 103.2 5.7 52.5 36 Protein translocase subunit SecA SecA Q7VUR2 103.2 5.7 52.5 36 Protein translocase subunit SecA SecA Q7VUR2 103.2 5.7 52.5 36 U14 <70% confident Carbomoyl-phosphate synthase (35%),...”
• A gel-free proteomic-based method for the characterization of Bordetella pertussis clinical isolates
  Williamson, Journal of microbiological methods 2012
  • “...C 9 (3) 6 (2) 6 (2) 6 (2) Carbohydrate metabolism Preprotein translocase subunit SecA NP_881589 BP3014 secA 100 CM 10 (7) 6 (4) 2 (2) 2 (2) Membrane transport Preprotein translocase subunit SecD NP_879831 BP1046 secD 69 CM 28 (11) 23 (10) 29 (11) 26...”

BCAL3453 preprotein translocase SecA subunit from Burkholderia cenocepacia J2315
57% identity, 98% coverage

• Burkholderia cenocepacia transcriptome during the early contacts with giant plasma membrane vesicles derived from live bronchial epithelial cells
  Pimenta, Scientific reports 2021
  • “...secB ), BCAL3307 ( secF ) and BCAL3433 ( secA ). In the second one, BCAL3453 ( ffh ) that encodes for a signal recognition particle protein involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane (Table S2 ). B. cenocepacia K56-2...”
• Whole-Genome Sequencing of Three Clonal Clinical Isolates of B. cenocepacia from a Patient with Cystic Fibrosis
  Miller, PloS one 2015
  • “...BCAL3301 oxyR oxidative stress regulatory protein T T C T Q84R NS Neutral -1.29 3782820 BCAL3453 secA preprotein translocase subunit SecA A A G A V207A NS Deleterious -3.80 3934083 BCAM0059 pcaJ 3-oxoadipate CoA-transferase subunit B C C T C R6C NS Deleterious -6.62 5445821 BCAM1417...”

Reut_A2970 SecA protein from Ralstonia eutropha JMP134
57% identity, 99% coverage

• The complete multipartite genome sequence of Cupriavidus necator JMP134, a versatile pollutant degrader
  Lykidis, PloS one 2010
  • “...several genes related to type IV transport systems (Reut_A0401-0404, Reut_A0784-0788, Reut_A0779, Reut_A1436, Reut_A2960-2962, and Reut_A3131-3135). Reut_A2970 encodes a protein translocase with 72% amino acid identity to the SecA of Burkholderia multivorans ATCC 17616. Chromosome 2 also harbors a number of genes encoding putative components of a...”
  • “...C. necator JMP134 has a complete sec general protein secretion system, including homologs of secA (Reut_A2970), secY (Reut_A3159), secE (Reut_A3195), secG (Reut_A0960), secD (Reut_A2810), secF (Reut_A2811) and yajC (Reut_A2809), as well as a signal peptidase (Reut_A2254). It also has all the components of the sec -independent...”

Rmet_3118 preprotein translocase, SecA subunit from Ralstonia metallidurans CH34
Rmet_3118 preprotein translocase subunit SecA from Cupriavidus metallidurans CH34
56% identity, 98% coverage

• The complete genome sequence of Cupriavidus metallidurans strain CH34, a master survivalist in harsh and anthropogenic environments
  Janssen, PloS one 2010
  • “...Rmet_3340, and Rmet_0926) and SecDFYajC (encoded by Rmet_2945-47). The SecA and SecB proteins (encoded by Rmet_3118 and Rmet_0254, respectively) cooperatively bind with the signal sequence of secretory proteins that, after translocation, is cleaved off by signal peptidases SPaseI (Rmet_2420) or SPaseII (of which there are three...”

FTN_0672 preprotein translocase, subunit A (ATPase, RNA helicase) from Francisella tularensis subsp. novicida U112
56% identity, 100% coverage

• Francisella-arthropod vector interaction and its role in patho-adaptation to infect mammals
  Akimana, Frontiers in microbiology 2011
  • “...protein FTN_0666 Excinuclease ABC, subunit A uvrA FTN_0667 Major facilitator superfamily (MFS) transport protein yieO FTN_0672 Preprotein translocase, subunit A secA FTN_0673 DNA-3-methyladenine glycosylase I (pseudogene) tag FTN_0692 Quinolinate sythetase A nadA FTN_0696 Hypothetical membrane protein FTN_0728 Predicted Co/Zn/Cd cation transporter FTN_0732 Hypothetical protein FTN_0741 Proton-dependent...”
• Directed screen of Francisella novicida virulence determinants using Drosophila melanogaster
  Ahlund, Infection and immunity 2010
  • “...candidates were true "hits." In the case of FTN_0672, the second allele produced a different, nonattenuated phenotype. Sequencing confirmed that both alleles...”
  • “...FTN_0113 FTN_0330 FTN_0331 FTN_0496 FTN_0513 FTN_0549 FTN_0672 FTN_0772 FTN_0806 FTN_0848 FTN_1058 FTN_1240 FTN_1309 FTN_1310 FTN_1311 FTN_1312 FTN_1313...”
• Contributions of Francisella tularensis subsp. novicida chitinases and Sec secretion system to biofilm formation on chitin
  Margolis, Applied and environmental microbiology 2010
  • “...conserved Cell wall, LPS, capsule Secreted Secreted FTN_0672 12G03 secA Motility, attachment and secretion, structure Translocon FTN_0713 FTN_0713 FTN_0713...”
• Molecular complexity orchestrates modulation of phagosome biogenesis and escape to the cytosol of macrophages by Francisella tularensis
  Asare, Environmental microbiology 2010
  • “...superfamily protein 2 tnfn1_pw060323p08q110 FTN_0286 transposase 3 tnfn1_pw060420p01q168 FTN_0646 cscK ROK family protein 5 tnfn1_pw060328p04q123 FTN_0672 secA preprotein translocase, subunit A (ATPase, RNA helicase) 2 tnfn1_pw060328p04q112 FTN_1002 blaA beta-lactamase class A 2 # tnfn1_pw060419p02q192 FTN_1002 blaA beta-lactamase class A 2 # tnfn1_pw060420p02q177 FTN_1145 era GTP-binding protein...”
  • “...family protein tnfn1_pw060419p01q168 FTN_0651 cdd cytidine deaminase tnfn1_pw060510p04q168 FTN_0666 uvrA excinuclease ABC, subunit A tnfn1_pw060328p04q123 FTN_0672 secA preprotein translocase, subunit A (ATPase, RNA helicase) tnfn1_pw060420p03q134 FTN_0710 type I restriction-modification system, subunit R (restriction) tnfn1_pw060328p06q127 FTN_0713 ostA2 organic solvent tolerance protein OstA tnfn1_pw060328p06q132 FTN_0728 predicted Co/Zn/Cd cation...”
• Exploitation of host cell biology and evasion of immunity by francisella tularensis
  Asare, Frontiers in microbiology 2010
  • “...FTN_0286 Transposase FTN_0338 MutT/nudix family protein FTN_0465 Sua5/YciO/YrdC family protein FTN_0646 cscK ROK family protein FTN_0672 secA Preprotein translocase, subunit A (ATPase, RNA helicase) FTN_0768 tspO Tryptophan-rich sensory protein FTN_0985 DJ-1/PfpI family protein FTN_1002 blaA Beta-lactamase class A FTN_1031 ftnA Ferric iron binding protein, ferritin-like FTN_1034...”
• Molecular bases of proliferation of Francisella tularensis in arthropod vectors
  Asare, Environmental microbiology 2010
  • “...superfamily protein 2 tnfn1_pw060323p08q110 FTN_0286 transposase 3 tnfn1_pw060420p01q168 FTN_0646 cscK ROK family protein 5 tnfn1_pw060328p04q123 FTN_0672 secA preprotein translocase, subunit A (ATPase, RNA helicase) 2 tnfn1_pw060328p04q112 FTN_1002 blaA beta-lactamase class A 2 # tnfn1_pw060419p02q192 FTN_1002 blaA beta-lactamase class A 2 # tnfn1_pw060420p02q177 FTN_1145 era GTP-binding protein...”
  • “...family protein tnfn1_pw060419p01q168 FTN_0651 cdd cytidine deaminase tnfn1_pw060510p04q168 FTN_0666 uvrA excinuclease ABC, subunit A tnfn1_pw060328p04q123 FTN_0672 secA preprotein translocase, subunit A (ATPase, RNA helicase) tnfn1_pw060420p03q134 FTN_0710 type I restriction-modification system, subunit R (restriction) tnfn1_pw060328p06q127 FTN_0713 ostA2 organic solvent tolerance protein OstA tnfn1_pw060328p06q132 FTN_0728 predicted Co/Zn/Cd cation...”

BU201 preprotein translocase SecA subunit from Buchnera aphidicola str. APS (Acyrthosiphon pisum)
55% identity, 100% coverage

• Omnipresent Maxwell's demons orchestrate information management in living cells
  Boël, Microbial biotechnology 2019
  • “...MMSYN1_0522 SecA ATP Protein targeting to the SecYEG and YidC machinery; possibly mechanical action SecA BU201 SecA MMSYN1_0095 Chaperones DnaK ATP Molecular chaperone Hsp70, ATPase DnaK BU153 DnaK MMSYN1_0542 DnaJ Cochaperone Hsp40 DnaJ BU152 DnaJ MMSYN1_0541 GrpE Nucleotide exchange factor for the DnaKJ chaperone GrpE BU184...”

FTH_1418 Sec family Type II general secretory pathway preprotein translocase SecA subunit from Francisella tularensis subsp. holarctica OSU18
56% identity, 100% coverage

• Use of magnetic hydrazide-modified polymer microspheres for enrichment of Francisella tularensis glycoproteins
  Horák, Soft matter 2012
  • “...FTH_1379 Probable capsule biosynthesis protein 44.90/7.41 CM TMH FTH_1415 Ribosomal protein L21 11.56/10.04 cyt cyt FTH_1418 Sec family Type II general secretory pathway preprotein translocase SecA subunit 103.56/5.29 cyt, MLS cyt FTH_1424 M41 family endopeptidase FtsH/HflB 70.74/5.42 CM TMH FTH_1443 Bifunctional FAD/FMN dehydrogenase/FeS oxidoreductase 114.57/8.64 cyt...”

Q2A2E3 Protein translocase subunit SecA from Francisella tularensis subsp. holarctica (strain LVS)
55% identity, 100% coverage

• Possible links between stress defense and the tricarboxylic acid (TCA) cycle in Francisella pathogenesis
  Dieppedale, Molecular & cellular proteomics : MCP 2013
  • “...Q2A263 Q2A2T8 Q2A502 Q2A5X6 Q2A269 Q2A3I6 Q2A4M0 Q2A1M7 Q2A2E3 Q2A303 Q2A5S1 Q2A259 Q2A2K5 Q2A3E5 Q2A358 Q2A346 Q2A1F6 Q2A4R4 Q2A3U7 Q2A356 Q2A4B2 Q2A5H2 Q2A329...”

2fsiB / P10408 Complex seca:adp from escherichia coli (see paper)
62% identity, 90% coverage

• Ligand: adenosine-5'-diphosphate (2fsiB)

2fshB / P10408 Complex seca:amp-pnp from escherichia coli (see paper)
60% identity, 90% coverage

• Ligand: phosphoaminophosphonic acid-adenylate ester (2fshB)

PVU19_RS02080 preprotein translocase subunit SecA from Roseovarius tolerans
54% identity, 99% coverage

• Chemical quantification of N-acyl alanine methyl ester (NAME) production and impact on temporal gene expression patterns in Roseovarius tolerans EL-164
  Leinberger, BMC microbiology 2024
  • “...cluster biosynthesis (PVU19_RS07615, PVU19_RS08920, PVU19_RS08925), taurine catabolism (PVU19_RS04020) and a type II secretion system (PVU19_RS00780, PVU19_RS02080, PVU19_RS05935, PVU19_RS05940) were found in cluster 2 (Supplement F3 ). Cluster 3 had the least GO terms assigned. COG categories were mostly associated with metabolism (44.9%) and predominantly represented by...”

Q3IYN1 Protein translocase subunit SecA from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
RSP_1169 preprotein translocase, SecA subunit, ATPase from Rhodobacter sphaeroides 2.4.1
54% identity, 100% coverage

• A previously uncharacterized divisome-associated lipoprotein, DalA, is needed for normal cell division in Rhodobacterales.
  Alberge, mBio 2023
  • “...transglycosylase (PG polymerization terminase) P/OM RSP_2402 Q3J3S1 TonB-dependent Vitamin B12 OM receptor OM RSP_1169 SecA Q3IYN1 Protein translocase subunit SecA IM RSP_0243 Q3J1B9 Putative lipoprotein (predicted LDT) P/OM RSP_1183 Q3IYL7 Uncharacterized protein IM RSP_0357 Q3J103 Protein HflK IM RSP_1882 PotA Q3J5A4 Spermidine/putrescine import ATP-binding protein PotA...”
• A previously uncharacterized divisome-associated lipoprotein, DalA, is needed for normal cell division in Rhodobacterales
  Alberge, mBio 2023
  • “...Endolytic murein transglycosylase (PG polymerization terminase) P/OM RSP_2402 Q3J3S1 TonB-dependent Vitamin B12 OM receptor OM RSP_1169 SecA Q3IYN1 Protein translocase subunit SecA IM RSP_0243 Q3J1B9 Putative lipoprotein (predicted LDT) P/OM RSP_1183 Q3IYL7 Uncharacterized protein IM RSP_0357 Q3J103 Protein HflK IM RSP_1882 PotA Q3J5A4 Spermidine/putrescine import ATP-binding...”
• The essential Rhodobacter sphaeroides CenKR two-component system regulates cell division and envelope biosynthesis
  Lakey, PLoS genetics 2022
  • “...2.8E-06 -1.48 9.1E-04 -0.74 1.1E-02 + N 2933000 * 1.8 * 1.4 * -- -- RSP_1169 secA protein translocase subunit secA N N TCG CGCGACGT TGA C 1.80 3.0E-06 -0.94 1.7E-03 n.s. n.s. + Y 435330 2.0 -- -- -- RSP_1844 RSP_1844 putative periplasmic protein N...”
• Convergence of the transcriptional responses to heat shock and singlet oxygen stresses
  Dufour, PLoS genetics 2012
  • “...and glycopeptides RSP_0357, RSP_0554, RSP_1408, RSP_1531, RSP_1742, RSP_2412, RSP_2649 Protein and peptide secretion and trafficking RSP_1169, RSP_1797, RSP_1798, RSP_1799, RSP_1843, RSP_2540, RSP_2541 Protein folding and stabilization RSP_1016, RSP_1173, RSP_1532, RSP_1572, RSP_1805, RSP_4043 Protein modification and repair RSP_0559, RSP_0872, RSP_0873, RSP_0874, RSP_0923 tRNA aminoacylation RSP_0875 Energy metabolism...”

SECA_RHOCA / P52966 Protein translocase subunit SecA; EC 7.4.2.8 from Rhodobacter capsulatus (Rhodopseudomonas capsulata) (see paper)
53% identity, 99% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving both as a receptor for the preprotein-SecB complex and as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  cofactor: Zn(2+) (May bind 1 zinc ion per subunit.)
  subunit: Part of the essential protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF-YajC and YidC (By similarity). Homodimer.

A1G_04855 translocase from Rickettsia rickettsii str. 'Sheila Smith'
52% identity, 99% coverage

• Isolate-Dependent Differences in Clinical, Pathological, and Transcriptional Profiles following In Vitro and In Vivo Infections with Rickettsia rickettsii
  Galletti, Infection and immunity 2021
  • “...This work A1G_06030 Outer membrane protein B (cell surface antigen sca5) AGTAGTACCGCCGCCTAAAA TGGTGCAGGATTACAAGGAA 60 51 A1G_04855 Preprotein translocase subunit SecA TACCCCGTCCTGCCATATTA AAACGCCAAATTTCATGAGC 61 51 A1G_01005 Preprotein translocase subunit SecE TGTTGCTTCAACGTTAGTAGTGG GCCGATATTAAGCAAAAGCTG 61 51 A1G_02210 VirB8 protein GGCATATCAGGTGATGTATTGG ACTTTTGAATCACTGGCAAAAA 60 51 A1G_02230 VirB10 protein CGCCGGTCTTACCTCCTACT TGCATCGCTCTCAACTAACG 61...”
• Virulence genes of Rickettsia rickettsii are differentially modulated by either temperature upshift or blood-feeding in tick midgut and salivary glands
  Galletti, Parasites & vectors 2016
  • “...SecE 1.54 94 (0.0050) 1.79 100 (0.0009) ns ns 1.55 90 (0.0002) 1.73 90 (0.0002) A1G_04855 Preprotein translocase subunit SecA ns -1.54 13 (0.0290) ns ns ns -1.56 4 (0.0013) A1G_05455 Preprotein translocase subunit SecY 2.94 94 (0.0050) ns -1.64 5 (0.0012) ns 1.79 75 (0.0242)...”
• Natural blood feeding and temperature shift modulate the global transcriptional profile of Rickettsia rickettsii infecting its tick vector
  Galletti, PloS one 2013
  • “...0.0400 -1.52 0.0003 -1.25 0.0343 A1G_04750 cell division protein FtsL NS -1.43 0.0003 -1.41 0.0009 A1G_04855 preprotein translocase subunit SecA -1.41 0.0000 NS -1.25 0.0039 A1G_04935 preprotein translocase subunit YajC 1.17 0.0145 1.28 0.0001 1.50 0.0000 A1G_04940 preprotein translocase subunit SecD -1.35 0.0001 NS -1.27 0.0001...”

RC0879 preprotein translocase secA subunit from Rickettsia conorii str. Malish 7
52% identity, 99% coverage

• Deciphering <i>Rickettsia conorii</i> metabolic pathways: A treasure map to therapeutic targets
  Prajapat, Biotechnology notes (Amsterdam, Netherlands) 2025
  • “...SecG Protein secretion Transport Inner membrane No RC0175 Translocase_SecE Protein secretion Transport Inner membrane No RC0879 SecA Protein secretion Transport Cytoplasm No RC0986 SecY Protein secretion Transport Inner membrane No RC0154 SecD Protein secretion Transport Inner membrane No RC0390 VirB11 Involved in the type IV secretion...”

RLV_6542 preprotein translocase subunit SecA from Rhizobium leguminosarum bv. viciae
52% identity, 100% coverage

• Genomic Diversity in the Endosymbiotic Bacterium Rhizobium leguminosarum
  Sánchez-Cañizares, Genes 2018
  • “...peptide and in an unfolded state. The translocase comprises seven proteins, including an ATPase, SecA (RLV_6542); a chaperone, SecB (RLV_7013); a translocation channel, complex SecYEG (RLV_4274, RLV_4240, and RLV_4771); and two additional membrane proteins, SecDF, that promote the release of the mature protein into the periplasm...”

EKH55_2587 preprotein translocase subunit SecA from Sinorhizobium alkalisoli
54% identity, 99% coverage

• The genome of Ensifer alkalisoli YIC4027 provides insights for host specificity and environmental adaptations
  Dang, BMC genomics 2019
  • “...EKH55_0177 Chromosome secE EKH55_1104 Chromosome secY EKH55_1142 Chromosome secG EKH55_1213 Chromosome secD/secF EKH55_1317 Chromosome secA EKH55_2587 Chromosome yajC EKH55_1316 Chromosome yidC EKH55_0075 Chromosome lebB EKH55_0711 Chromosome SRP (signal recognition particle) components ftsY EKH55_3169 Chromosome ffh EKH55_3175 Chromosome The type II protein secretion system (T2SS) is encoded...”

NGR_c26720 preprotein translocase subunit SecA from Sinorhizobium fredii NGR234
NGR_c26720 protein translocase subunit SecA from Rhizobium sp. NGR234
54% identity, 99% coverage

• High-resolution transcriptomic analyses of Sinorhizobium sp. NGR234 bacteroids in determinate nodules of Vigna unguiculata and indeterminate nodules of Leucaena leucocephala
  Li, PloS one 2013
  • “...(SecB and Ffh), and signal peptidase I. The expression levels of related coding genes ( NGR_c26720 secA, NGR_c33550 secB, NGR_c02010 secD1, NGR_c13810 secD2, NGR_c11760 secE, NGR_c12100 secY, NGR_c13800 yajC, NGR_c00820 yidC, NGR_c32250 ffh , NGR_c08280 coding signal peptidase I) in the free-living condition were 2- to...”
• Rhizobium sp. strain NGR234 possesses a remarkable number of secretion systems
  Schmeisser, Applied and environmental microbiology 2009
  • “...are encoded by the NGR234 chromosome: secA (NGR_c26720), secB (NGR_c33550), secD (NGR_c02010 and NGR_c13810), secE (NGR_c11760), secD/F (NGR_c13810), and secY...”

RL4298 putative preprotein translocase subunit from Rhizobium leguminosarum bv. viciae 3841
51% identity, 100% coverage

• Identification of protein secretion systems and novel secreted proteins in Rhizobium leguminosarum bv. viciae
  Krehenbrink, BMC genomics 2008
  • “...R. l . bv. viciae 3841 was found to carry single genes coding for SecA (RL4298), SecB (RL0006), SecD (RL0680), SecE (RL1759), SecF (RL2055), SecG (RL2512) and SecY (RL1794), which suffice to constitute a functioning GEP machinery (Table 1 ). These chromosomal genes were not located...”
  • “...RL0453 SecD RL0680 SPase I RL1510 SecE RL1759 SecY RL1794 SecF RL2055 SecG RL2512 SecA RL4298 FtsY RL4543 Ffh RL4547 b) Twin arginine pathway TatA RL2046 TatB RL2047 TatC RL2048 c) Type I pathway AprE RL3657 RL0071 RL0622 pRL90165 AprD RL3658 RL0072 RL0623 pRL90164 TolC none...”

SMc04458 PROBABLE PREPROTEIN TRANSLOCASE SECA SUBUNIT from Sinorhizobium meliloti 1021
53% identity, 99% coverage

• Genome prediction of PhoB regulated promoters in Sinorhizobium meliloti and twelve proteobacteria
  Yuan, Nucleic acids research 2006
  • “...0.36 SMc04317 ( afuA )* 3284.3 299 50.6 23.7 76.8 9.3 59.7 15.7 51 0.58 SMc04458 26.4 9.1 26.7 1.4 52.4 6.7 54.3 7.9 230 0.37 SMc04478 1498.2 100.6 3333.8 118.6 1632 62.7 3952.4 312.8 52 0.57 a GusA transcriptional gene fusion and expression demonstrating altered...”
• Transcriptome analysis of Sinorhizobium meliloti during symbiosis
  Ampe, Genome biology 2003
  • “...bfr Bacterioferritin 1 0.7 1.7 1.3 0.8 0.4 (-) 0.3 (-) 0.6 0.5 0.2 (-) SMc04458 secA Preprotein translocase 1 0.9 1.1 0.7 0.4 (-) 0.4 (-) 0.4 (-) 0.1 (-) 0.3 (-) SMc00947 glnB Nitrogen regulatory protein PII 1 0.9 2 (+) 2 (+) 0.7...”

BAB1_1946 SecA protein:ATP/GTP-binding site motif A (P-loop):SEC-C motif from Brucella melitensis biovar Abortus 2308
53% identity, 100% coverage

• Proteomics-based confirmation of protein expression and correction of annotation errors in the Brucella abortus genome
  Lamontagne, BMC genomics 2010
  • “...Unknown BAB1_0641 Alanine aminopep- BAB1_1223 AlaS BAB1_1936 GloB BAB2_0572 IlvE tidase: Neutral zinc BAB1_1224 RecA BAB1_1946 SecA BAB2_0620 Unknown metallopeptidase, BAB1_1233 RpsM; S13 BAB1_1970 FadB BAB2_0642 Acyl-CoA zinc-binding region BAB1_1234 Adk BAB1_1971 EtfA dehydrogenase BAB1_0666 DapA BAB1_1241 RpsH; S8 BAB1_1988 HisC BAB2_0644 Metal-dependent BAB1_0671 RpoZ BAB1_1242...”

BMEI0121 PROTEIN TRANSLOCASE, SUBUNIT SECA from Brucella melitensis 16M
Q8YJG2 Protein translocase subunit SecA from Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
53% identity, 100% coverage

• Immuno-profiling of Brucella proteins for developing improved vaccines and DIVA capable serodiagnostic assays for brucellosis
  Nandini, Frontiers in microbiology 2023
  • “...BMEI0810 Protease Do BMEI0613 Type I restriction-modification enzyme S subunit BMEII0452 Preprotein translocase subunit SecA BMEI0121 HlyD family secretion protein BR_1060 Periplasmic oligopeptide-binding protein precursor BMEII0735 Nucleoside triphosphate pyrophosphohydrolase BMEI0920 Hypothetical protein BMEI1847 Hypothetical protein BMEII0073 Flagellin BMEII0150 Hypothetical protein BMEI0699 Cell surface protein BMEI1872 Riboflavin...”
• Comparative proteomics analyses reveal the virB of B. melitensis affects expression of intracellular survival related proteins
  Wang, PloS one 2009
  • “...fabG short-chain dehydrogenase 25/29 6.15/6.79 0.61 QR C 3.4 Intracellular trafficking and secretion Q25 gi|17986405 BMEI0121 secA protein translocase, chain secA 103/31 5.15/5.66 0.20 U C 5.3 Function unknown Q59 gi|17986596 BMEI0313 zapA Hypothetical Cytosolic Protein 13/15 4.78/4.81 0.84 S C 2.5 Q42 gi|17987476 BMEI1193 -...”
• Classification of a Hypervirulent Aeromonas hydrophila Pathotype Responsible for Epidemic Outbreaks in Warm-Water Fishes
  Rasmussen-Ivey, Frontiers in microbiology 2016
  • “...pathway protein PulF pulF P15745 149305 Klebsiella pneuoniae oxytoca UNF5023 Protein translocase subunit SecA secA Q8YJG2 672757090 Brucella melitensis biotype 1 Rod shape-determining protein MreB mreB P0A9X4 557273544 Escherichia coli K12 Sodium/proline symporter proline permease putP P07117 131658 Escherichia coli K12 Transcriptional activator NtrC ntrC O86057...”
• Protein secretion and outer membrane assembly in Alphaproteobacteria
  Gatsos, FEMS microbiology reviews 2008
  • “...species Caulobacter Rickettsia Brucella Escherichia Neisseria SecB Q9A224 Q9ZE76 Q8YE23 P0AG86 Q9JY16 SecA P38380 Q9ZCX7 Q8YJG2 P10408 Q9JYK8 SecY Q9A8T3 Q9ZCS5 Q8YHM0 P0AGA2 Q7DDS8 SecE Q9A3J8 P50054 Q8YHQ3 P0AG96 Q9K1J4 SecG Q9A7K4 Q9ZE68 Q8YHF4 P0AG99 Q7DD68 SPase I Q9A806 Q9ZE32 Q8YG73 P00803 Q9K056 SPase II Q9AAA6...”

ZMO0924 preprotein translocase subunit SecA from Zymomonas mobilis subsp. mobilis ZM4
51% identity, 99% coverage

• Multiple Small RNAs Interact to Co-regulate Ethanol Tolerance in Zymomonas mobilis
  Han, Frontiers in bioengineering and biotechnology 2020
  • “...-fructofuranosyl transferase) (sucrose 6-fructosyl transferase) ZMO0447 Uncharacterized protein ZMO0614 Flagellar basal body rod protein FlgB ZMO0924 Protein translocase subunit SecA ZMO1045 Phosphate-selective porin O and P ZMO1055 Diguanylate cyclase/phosphodiesterase ZMO1065 Phage shock protein C, PspC ZMO1262 Binding-protein-dependent transport systems inner membrane component ZMO1285 Glucose-methanol-choline oxidoreductase ZMO1426...”

BR1945 translocase from Brucella suis 1330
52% identity, 100% coverage

• Quantitative analysis of the Brucella suis proteome reveals metabolic adaptation to long-term nutrient starvation
  Al, BMC microbiology 2013
  • “...protein S6 17.1/8.0 1.69 0.0069 1980 BR0452 ribosomal protein L9 21.0/4.8 1.59 0.00041 Secretion 313 BR1945 preprotein translocase, SecA subunit 103.0/5.1 1.34 0.005 DNA / RNA metabolism Biosynthesis 221 BR1488 carbamoyl-phosphate synthase, large subunit 126.9/5.0 1.34 0.0098 454 BR0837 phosphoribosylformylglycinamidine synthase II 80.0/4.8 1.31 0.01 456...”

DVU0825 preprotein translocase, SecA subunit from Desulfovibrio vulgaris Hildenborough
53% identity, 100% coverage

• High-throughput isolation and characterization of untagged membrane protein complexes: outer membrane complexes of Desulfovibrio vulgaris
  Walian, Journal of proteome research 2012
  • “...hypothetical protein DVU2317 methyl-accepting chemotaxis protein, putative DVU0799 conserved hypothetical protein DVU2405 alcohol dehydrogenase, iron-containing DVU0825 secA, preprotein translocase, SecA subunit DVU2420 conserved hypothetical protein DVU0848 QmoA, Quinone-interacting membrane-bound oxidoreductase DVU2428 lipoprotein, putative DVU0849 QmoB, Quinone-interacting membrane-bound oxidoreductase DVU2481 fdoH, formate dehydrogenase, beta subunit, putative DVU0851...”
  • “...One of the more interesting of these involves the interaction of protein translocase subunit SecA (DVU0825) (Figure 6 F) with a hemolysin-type calcium-binding repeat protein (DVU1012), a 316 kDa extracellular protein likely observed in a stage of the secretion process. Surprisingly, this interaction cluster also involves...”

TKV_c05070 preprotein translocase subunit SecA from Thermoanaerobacter kivui
50% identity, 99% coverage

• A purified energy-converting hydrogenase from Thermoanaerobacter kivui demonstrates coupled H⁺-translocation and reduction in vitro
  Katsyv, The Journal of biological chemistry 2022
  • “...fingerprinting also revealed a high abundance of a 58-kDa chaperon (TKV_c05620), 103-kDa protein translocase secA (TKV_c05070), and a 25-kDa purine nucleoside phosphorylase (deoD; TKV_c16190) in the preparation sample, which are not expected to influence the Ech-catalyzed reaction. Figure1 Purification of Ech2. A , to purify a...”

Cthe_1385 preprotein translocase subunit SecA from Clostridium thermocellum ATCC 27405
50% identity, 99% coverage

• Specialized activities and expression differences for Clostridium thermocellum biofilm and planktonic cells
  Dumitrache, Scientific reports 2017
  • “...interacts with its membrane receptor (Cthe_0926) to bring the protein to the translocase motor SecA (Cthe_1385) and the protein conducting channel SecYEG (Cthe_2923, Cthe_2718 and Cthe_0144) with its accessory proteins Cthe_0904, Cthe_0903 and Cthe_0957 for translocation outside the cell. Insertion in the cytoplasmic membrane is mediated...”
• Mutant alcohol dehydrogenase leads to improved ethanol tolerance in Clostridium thermocellum
  Brown, Proceedings of the National Academy of Sciences of the United States of America 2011
  • “...(protein of unknown function DUF1432), Cthe_1385 (protein translocase subunit SecA), Cthe_1285 (metal-dependent phosphohydrolase), Cthe_3171 (S-layer...”

Q9ZCX7 Protein translocase subunit SecA from Rickettsia prowazekii (strain Madrid E)
51% identity, 99% coverage

• Protein secretion and outer membrane assembly in Alphaproteobacteria
  Gatsos, FEMS microbiology reviews 2008
  • “...Bacterial species Caulobacter Rickettsia Brucella Escherichia Neisseria SecB Q9A224 Q9ZE76 Q8YE23 P0AG86 Q9JY16 SecA P38380 Q9ZCX7 Q8YJG2 P10408 Q9JYK8 SecY Q9A8T3 Q9ZCS5 Q8YHM0 P0AGA2 Q7DDS8 SecE Q9A3J8 P50054 Q8YHQ3 P0AG96 Q9K1J4 SecG Q9A7K4 Q9ZE68 Q8YHF4 P0AG99 Q7DD68 SPase I Q9A806 Q9ZE32 Q8YG73 P00803 Q9K056 SPase II...”

Q6G0Q8 Protein translocase subunit SecA from Bartonella quintana (strain Toulouse)
BQ01870 Preprotein translocase secA subunit from Bartonella quintana str. Toulouse
51% identity, 99% coverage

• Proteomic and immunoblot analyses of Bartonella quintana total membrane proteins identify antigens recognized by sera from infected patients
  Boonjakuakul, Infection and immunity 2007
  • “...Q8KP11 Q6FZC0 033964 Q8KP11 Q8KP11 Q6FZC0 Q64HS9 Q6FZ64 Q6G0Q8 Q6FYH8 Q6FYB7 Q64HS7 Q6FZ11 Q6FZA9 vompC omp43 NA BQ09890 BQ08370 BQ10750 BQ11170 BQ01410 mopA...”
• Proteomic and immunoblot analyses of Bartonella quintana total membrane proteins identify antigens recognized by sera from infected patients
  Boonjakuakul, Infection and immunity 2007
  • “...ftsZ JB46 JB47 JB48 VOL. 75, 2007 2553 BQ07130 BQ01870 BQ09240 BQ06950 BQ08430 BQ08250 BQ10750 BQ08430 BQ08430 BQ08250 BQ01400 rpoB secA carB omp89 hbpE tuf1...”

BJS_05614 preprotein translocase subunit SecA from Bradyrhizobium japonicum SEMIA 5079
50% identity, 97% coverage

• Genetic variation in symbiotic islands of natural variant strains of soybean Bradyrhizobium japonicum and Bradyrhizobium diazoefficiens differing in competitiveness and in the efficiency of nitrogen fixation
  Bender, Microbial genomics 2022
  • “...C A BJS_05501 GAG GGG E/G 752 251 SNP 8 457 225 C T A BJS_05614 GCG GTG A/V 11 4 SNP 8 605 053 A G A BJS_05753 GAG GGG E/G 125 42 SNP 8 606 552 G A A BJS_05753 GAC AAC D/N 1624...”
  • “...GNAT family N-acetyltransferase Yes RimL COG1670 BJS_05501 Aminotransferase class V-fold PLP-dependent enzyme Yes PucG COG0075 BJS_05614 Preprotein translocase subunit SecA Yes PRK12904 PRK12904 BJS_05753 ParB/RepB/Spo0J family partition protein Yes Spo0J COG1475 BJS_05753 ParB/RepB/Spo0J family partition protein No putative conserved domains have been detected B. diazoefficiens SEMIA...”

CKC_RS02450 preprotein translocase subunit SecA from Candidatus Liberibacter solanacearum CLso-ZC1
49% identity, 100% coverage

• Interactions "Candidatus Liberibacter solanacearum"-Bactericera cockerelli: Haplotype Effect on Vector Fitness and Gene Expression Analyses
  Yao, Frontiers in cellular and infection microbiology 2016
  • “...cis-trans isomerase protein 6 CKC_RS01950 Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase: purH 6 CKC_RS03915 Hypothetical protein 6 CKC_RS02450 Preprotein translocase subunit SecA 6 CKC_RS00880 Hypothetical protein 5 CKC_RS00225 Excinuclease ABC subunit C 5 CKC_RS00885 Hypothetical protein 5 CKC_RS05560 Hypothetical protein 5 CKC_RS01855 Type I restriction-modification system, M subunit...”
  • “...Based on dissociation analyses, seven primer pairs were excluded from further use ( CKC_RS00980 , CKC_RS02450 , CKC_RS05560 , CKC_RS01855 , CKC_RS00790 , CKC_RS00820 , and CKC_RS00375 ). To evaluate if recA could be used as a reference gene for RT-qPCR analyses, Lso density and recA...”

Q8F4S9 Protein translocase subunit SecA from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
LA_1960 preprotein translocase subunit SecA from Leptospira interrogans serovar lai str. 56601
50% identity, 92% coverage

• Use of an Integrated Multi-Omics Approach To Identify Molecular Mechanisms and Critical Factors Involved in the Pathogenesis of Leptospira
  Kavela, Microbiology spectrum 2023
  • “...6.96 3.88 + Q8F4N3 Flagellar motor switch protein FliG fliG , LA_2007 5.22 5.27 + Q8F4S9 Protein translocase subunit SecA (EC 7.4.2.8) secA , LA_1960 3.59 3.04 Q8F527 Histidine kinase sensor protein LA_1860 1.08 1.53 Q8F539 ISLbp1 transposase LA_1848 3.27 2.29 Q8F585 PINc domain-containing protein LA_1799...”
• Use of an Integrated Multi-Omics Approach To Identify Molecular Mechanisms and Critical Factors Involved in the Pathogenesis of Leptospira
  Kavela, Microbiology spectrum 2023
  • “...fliG , LA_2007 5.22 5.27 + Q8F4S9 Protein translocase subunit SecA (EC 7.4.2.8) secA , LA_1960 3.59 3.04 Q8F527 Histidine kinase sensor protein LA_1860 1.08 1.53 Q8F539 ISLbp1 transposase LA_1848 3.27 2.29 Q8F585 PINc domain-containing protein LA_1799 2.79 1.62 + Q8F5D8 Putative protein-glutamate methylesterase/protein-glutamine glutaminase (EC...”

LIC11944 SecA from Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
50% identity, 92% coverage

• Global proteome analysis of Leptospira interrogans
  Eshghi, Journal of proteome research 2009
  • “...ATP-dependent proteolytic subunit LIC12017 0.9051.136 0.3790.393 2.313 NS NS NS 2.313 Preprotein translocase, SecA subunit LIC11944 0.9311.127 0.3280.408 2.485 NS NS NS 2.485 Transcription (4) Transcription termination factor Rho LIC12636 NS NS NS 0.8451.254 0.7570.809 1.049 1.049 Transcription elongation factor LIC12706 NS NS NS 0.9061.157 0.4980.591...”

CD16_00990 preprotein translocase subunit SecA from Candidatus Liberibacter asiaticus
50% identity, 100% coverage

• Biological Features and In Planta Transcriptomic Analyses of a Microviridae Phage (CLasMV1) in "Candidatus Liberibacter asiaticus"
  Wang, International journal of molecular sciences 2022
  • “...3 ). It was found that four CLas genes involved in Sec pathway, i.e., SecA (CD16_00990), SecB (CD16_01910), SecD (CD16_04035) and SecY (CD16_00550), were up-regulated in fruit pith compared to leaf midribs. Noteworthy, a restriction endonuclease subunit S gene (CD16_03585) from Type I restrictionmodification system was...”
  • “...Figure 4 ). In addition to CLas cell surface components, four Sec-pathway-related genes, including SecA (CD16_00990, 3.6-fold), SecB (CD16_01910, 9.3-fold), SecD (CD16_04035, 2.8-fold) and SecY (CD16_00550, 2.7-fold), were up-regulated in fruit pith compared to leaf midribs ( Figure 4 ). The bacterial Sec pathway was an...”

Dhaf_4747 preprotein translocase, SecA subunit from Desulfitobacterium hafniense DCB-2
51% identity, 99% coverage

• Genome sequence of Desulfitobacterium hafniense DCB-2, a Gram-positive anaerobe capable of dehalogenation and metal reduction
  Kim, BMC microbiology 2012
  • “...chaperone which guides the secreted proteins to the translocase by binding to an ATP-hydrolyzing SecA (Dhaf_4747) was identified. However, a possible alternative route for guiding the secreted proteins to the translocase, which is mediated by a signal recognition protein (Dhaf_3761) and its receptor (FtsY, encoded by...”

DSY4870 hypothetical protein from Desulfitobacterium hafniense Y51
51% identity, 99% coverage

• Physiological adaptation of Desulfitobacterium hafniense strain TCE1 to tetrachloroethene respiration
  Prat, Applied and environmental microbiology 2011
  • “...DSY0246 DSY1627 DSY2668 DSY0469 DSY0742 DSY3475 DSY1764 DSY4870 DSY3323 DSY2498 DSY4851 DSY2426 DSY4393 DSY2114 Flotillin-like protein Phage shock protein A...”

Hore_16440 preprotein translocase, SecA subunit from Halothermothrix orenii H 168
48% identity, 99% coverage

• Genome analysis of the anaerobic thermohalophilic bacterium Halothermothrix orenii
  Mavromatis, PloS one 2009
  • “...more than one copy in a sequenced genome. Protein secretion and motility The Sec AYEG (Hore_16440, Hore_01360, Hore_01030, Hore_15770) system is present. H.orenii also possesses genes of a signal-recognition particle (SRP)-like pathway (Hore_07270- Hore_07290) which plays essential role in protein translocation and membrane protein insertion. Two...”

Cj0942c preprotein translocase SECA subunit from Campylobacter jejuni subsp. jejuni NCTC 11168
51% identity, 100% coverage

• Active Packaging of Immobilized Zinc Oxide Nanoparticles Controls Campylobacter jejuni in Raw Chicken Meat
  Hakeem, Applied and environmental microbiology 2020 (secret)
• The Novel Protein Cj0371 Inhibits Chemotaxis of Campylobacter jejuni
  Du, Frontiers in microbiology 2018
  • “...Two-component system cj1487c ATP Binding 31162 1 cj0694 Isomerase activity 57507 1 Bacterial secretion system cj0942c ( secA ) Protein transport, translocation 97976 3 cj0958c ( yidc ) Membrane protein insertase 60828 1 ABC transporters cj0773c Amino acid-transporting ATPase activity 33504 1 cj0175c Periplasmic iron-binding protein...”

Q9K6W8 Protein translocase subunit SecA from Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
48% identity, 99% coverage

• Microwave supported hydrolysis prepares Bacillus spores for proteomic analysis.
  Chen, International journal of mass spectrometry 2019
  • “...A7GSJ8 Exodeoxyribonuclease 7 large subunit 2062.3 2062.8 DAAQALAAIEETMKNEGLGE Q9F166 Phosphocarrier protein HPr 4980.6 4981.1 NAGHRGAVTIATNMAGRGTDIKLGEGVRELGGLHVLGTERHESRRID Q9K6W8 Protein translocase subunit SecA 2507.8 2507.8 NAQAYVTDVKVSEPTKLTLTGTGL P94217 S-layer protein EA1 1542.7 1542.5 GVVNYGSKLSGKDFA P94217 S-layer protein EA1 1863.1 1863.5 PENLEGYEVESKNLAVA P94217 S-layer protein EA1 1693.9 1693.8 VVTTDSGSIGTKTIGVTG P94217 S-layer...”

WMELPLUS_00566 preprotein translocase subunit SecA from Wolbachia endosymbiont of Drosophila melanogaster
48% identity, 99% coverage

• New Wolbachia pipientis Genotype Increasing Heat Stress Resistance of Drosophila melanogaster Host Is Characterized by a Large Chromosomal Inversion
  Korenskaia, International journal of molecular sciences 2022
  • “..., 40 ]. As for genes located near the inversion, the position of gene SecA (WMELPLUS_00566) is less than two Kbases from the distal (right) edge of inversion. The SecA gene is part of the SEC system, which translocates proteins across or into the inner membrane,...”

NP_466033 preprotein translocase subunit SecA from Listeria monocytogenes EGD-e
P47847 Protein translocase subunit SecA 1 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
lmo2510 translocase binding subunit (ATPase) from Listeria monocytogenes EGD-e
49% identity, 100% coverage

• A prl mutation in SecY suppresses secretion and virulence defects of Listeria monocytogenes secA2 mutants.
  Durack, Journal of bacteriology 2015
  • GeneRIF: Mutation in SecY suppresses secretion and virulence defects of secA2 mutants.
• Investigating the therapeutic potential of herbal leads against drug resistant Listeria monocytogenes by computational virtual screening and in vitro assays.
  Skariyachan, Journal of biomolecular structure & dynamics 2015 (PubMed)
  • GeneRIF: The 3D structure of SecA proteins with good stereochemical validity was generated by comparative modeling; considering SecA proteins as probable drug targets
• Exoproteomic analysis of the SecA2-dependent secretion in Listeria monocytogenes EGD-e.
  Renier, Journal of proteomics 2013 (PubMed)
  • GeneRIF: proteomic analysis of SecA2-dependent secretion in Listeria monocytogenes EGD-e
• Two nonredundant SecA homologues function in mycobacteria
  Braunstein, Journal of bacteriology 2001
  • “...AF287049 O32922 D17428 U21192 Q55357 BAB41941 BAB43747 P47847 AE005672 AE005672 P10408 P28366 Q41062 P38380 AF116183 U32772 AAF41891 O25475 QO1570 OO7497 P47318...”
• Virulence Potential and Antimicrobial Resistance of Listeria monocytogenes Isolates Obtained from Beef and Beef-Based Products Deciphered Using Whole-Genome Sequencing
  Manqele, Microorganisms 2024
  • “...Genes The Sec system SecY lmo2612 SecE lmo0245 SecG lmo2451 SecDF lmo152 YajC lmo1529 SecA lmo2510 SecA2 lmo0583 FtsY lmo1803 YlxM lmo1802 Ffh lmo1801 SpolllJ lmo2854 YqjG lmo1379 The Tat system TatA lmo0362 TatC lmo0361 Flagella Exporter FlhBA lmo0679-0680 FliO lmo0682 FliPQR lmo0676-0678 FliH lmo0715 Flil...”
• SecA2 Associates with Translating Ribosomes and Contributes to the Secretion of Potent IFN-β Inducing RNAs
  Teubner, International journal of molecular sciences 2022
  • “...ion transport and metabolism 0.13 0.20 lmo2597 rplM 50S ribosomal protein L13 Translation 0.17 0.20 lmo2510 secA Protein translocase subunit SecA 1 Intracellular trafficking and secretion 0.21 0.19 lmo2618 rpsH 30S ribosomal protein S8 Translation 0.16 0.19 lmo0539 Tagatose 1.6-diphosphate aldolase Carbohydrate transport and metabolism 0.13...”
• Different Shades of Listeria monocytogenes: Strain, Serotype, and Lineage-Based Variability in Virulence and Stress Tolerance Profiles
  Muchaamba, Frontiers in microbiology 2021
  • “...lmo1529 Preprotein translocase subunit YajC 7 YidC lmo1379 YidC/Oxa1 family membrane protein insertase 1 SecA lmo2510 Preprotein translocase subunit SecA 3 SecA2 lmo0583 Protein-secreting ATPase 16 PrsA2 lmo2219 Secreted bacterial lipoprotein chaperone 7 Lsp lmo1844 Lipoprotein signal peptidase 3 LspB lmo1101 Lipoprotein signal peptidase Detected in...”
• Comparison of Surface Proteomes of Adherence Variants of Listeria Monocytogenes Using LC-MS/MS for Identification of Potential Surface Adhesins
  Tiong, Pathogens (Basel, Switzerland) 2016
  • “...(2.2) Aminotransferase (48) C,M CY 2.5 (CM,E,C) CY No No 0 No No <1.8 0.23 lmo2510 * (1.6) Preprotein translocase subunit (95) M CY 0.03 (EC) CY No No 0 No No <1.8 0.46 lmo2748 * (5.2) Hypothetical protein (16) CY CY 2.5 (CM,E,C) CY No...”
• A prl mutation in SecY suppresses secretion and virulence defects of Listeria monocytogenes secA2 mutants
  Durack, Journal of bacteriology 2015
  • “...walI Similar to B. subtilis YycI protein lmo2510 lmo2537 secA mnaA Protein translocase subunit SecA UDP-N-acetylglucosamine 2-epimerase Reference genome,...”
• A systematic proteomic analysis of Listeria monocytogenes house-keeping protein secretion systems
  Halbedel, Molecular & cellular proteomics : MCP 2014
  • “...SpoIIIJ YqjG lmo2612 lmo0245 lmo2451 lmo1527 lmo1529 lmo2510 lmo0583 lmo1803 lmo1802 lmo1801 lmo2854 lmo1379 Sec substrates TatA TatC lmo0362 lmo0361 Folded...”
  • “...(lmo0362 lmo0361) bla erm bgaB secA (lmo2510) lmo2201-strep erm lmo0367-strep erm Phelp-lacO-lmo2201-strep lacI neo Phelp-lacO-lmo0367-strep lacI neo...”
• Transcriptional and phenotypic responses of Listeria monocytogenes to chlorine dioxide
  Pleitner, Applied and environmental microbiology 2014
  • “...lmo1611 lmo1620 lmo2068 lmo2069 lmo2199 lmo2206 lmo2398 lmo2468 lmo2510 Gene name L. monocytogenes Response to Chlorine Dioxide TABLE 4 Genes downregulated upon...”
• Subcellular localization of extracytoplasmic proteins in monoderm bacteria: rational secretomics-based strategy for genomic and proteomic analyses
  Renier, PloS one 2012
  • “...SecDF TC#2.A.6.4, TC#3.A.5, IPR03335, PF07549, PF02356 Lmo1529 Sec transcolon, subunit YajC TC#9.B.18, COG1862, TIGR00739, PF02699 Lmo2510 Sec translocase, ATPase, SecA TC#3.A.5, COG0653, IPR000185, TIGR00963 Lmo0583 Sec translocase, ATPase, SecA2 TC#3.A.5.10, COG0653 Lmo1803 Signal recognition particle (SRP) receptor subunit, FtsY TC#3.A.5, COG0552, IPR004390, IPR000897, TIGR00064, SSF47364 Lmo1801...”

BAS5038 preprotein translocase, SecA subunit from Bacillus anthracis str. Sterne
BA5421 preprotein translocase, SecA subunit from Bacillus anthracis str. Ames
48% identity, 99% coverage

• Secretion genes as determinants of Bacillus anthracis chain length
  Nguyen-Mau, Journal of bacteriology 2012
  • “...The genome of B. anthracis contains a second gene, BAS5038, whose 835-amino-acid product displays 51% sequence identity to E. coli SecA (901 amino acids). We...”
• Differential proteomic analysis of the Bacillus anthracis secretome: distinct plasmid and chromosome CO2-dependent cross talk mechanisms modulate extracellular proteolytic activities
  Chitlaru, Journal of bacteriology 2006
  • “...identified in the B. anthracis genome (BA0882 and BA5421 in the "Ames ancestor" genome) (147), suggesting that this bacterium has an alternative secretion...”

BC5189 Protein translocase subunit SecA from Bacillus cereus ATCC 14579
48% identity, 99% coverage

• SigB modulates expression of novel SigB regulon members via Bc1009 in non-stressed and heat-stressed cells revealing its alternative roles in Bacillus cereus
  Yeak, BMC microbiology 2023
  • “...hypothetical Membrane Spanning Protein 1.0 1.8 S 69 BC0675 hypothetical protein 1.0 2.0 S 70 BC5189 SecA Protein translocase subunit SecA 0.8 1.1 U 71 BC5241 YvbJ IG hypothetical 16,680 0.7 1.3 S 72 BC4791 YtiB Carbonic anhydrase 0.7 1.3 P 1 BC0385 Thioredoxin reductase, posttranslational...”
• Live-cell imaging tool optimization to study gene expression levels and dynamics in single cells of Bacillus cereus
  Eijlander, Applied and environmental microbiology 2013
  • “...Gene locus tag Properties PsecA PcotD PsigG Pupp BC5189 BC1560 BC3903 Strong promoter for the essential secA gene during vegetative growth (22)...”

ECHLIB_RS00175, ECHWAK_RS00175, ECHWP_RS00175, ECH_RS04650 preprotein translocase subunit SecA from Ehrlichia chaffeensis str. Heartland
48% identity, 99% coverage

• Comparative Genomics of the Zoonotic Pathogen Ehrlichia chaffeensis Reveals Candidate Type IV Effectors and Putative Host Cell Targets
  Noroy, Frontiers in cellular and infection microbiology 2016
  • “...0 0 0 0 1 0 0 0 1 0 1 1 0 IBRs ECH_RS04650 ECHLIB_RS00175 ECHWAK_RS00175 ECHWP_RS00175 Protein translocase subunit SecA 93 1 0 0 0 0 1 0 0 0 1 1 0 1 0 GSRs ECH_RS02080 ECHLIB_R502725 ECHWAK_R502740 ECHWP R501965 Hypothetical protein 93...”
  • “...immune and stress responses, cell organization, and cell death. Most of the proteins targeted by ECHLIB_RS00175 are located in the nucleus and are involved in nuclear organization (chromosomal protein HMG2) or biosynthetic process (proline-rich and zinc finger proteins) (Table S2 ). The nuclear effector ECHLIB_RS02435 interacts...”
  • “...0 0 0 1 0 0 0 1 0 1 1 0 IBRs ECH_RS04650 ECHLIB_RS00175 ECHWAK_RS00175 ECHWP_RS00175 Protein translocase subunit SecA 93 1 0 0 0 0 1 0 0 0 1 1 0 1 0 GSRs ECH_RS02080 ECHLIB_R502725 ECHWAK_R502740 ECHWP R501965 Hypothetical protein 93 0...”
  • “...0 0 1 0 0 0 1 0 1 1 0 IBRs ECH_RS04650 ECHLIB_RS00175 ECHWAK_RS00175 ECHWP_RS00175 Protein translocase subunit SecA 93 1 0 0 0 0 1 0 0 0 1 1 0 1 0 GSRs ECH_RS02080 ECHLIB_R502725 ECHWAK_R502740 ECHWP R501965 Hypothetical protein 93 0 0...”
  • “...1 0 0 0 0 1 0 0 0 1 0 1 1 0 IBRs ECH_RS04650 ECHLIB_RS00175 ECHWAK_RS00175 ECHWP_RS00175 Protein translocase subunit SecA 93 1 0 0 0 0 1 0 0 0 1 1 0 1 0 GSRs ECH_RS02080 ECHLIB_R502725 ECHWAK_R502740 ECHWP R501965 Hypothetical protein...”

TPANIC_0379 preprotein translocase subunit SecA from Treponema pallidum subsp. pallidum str. Nichols
47% identity, 99% coverage

• Comparison of transcriptional profiles of Treponema pallidum during experimental infection of rabbits and in vitro culture: Highly similar, yet different
  De, PLoS pathogens 2021
  • “...repair 297 628 1.09 2.81E-13 TPANIC_0870 flaB3 Cell envelope; Surface structures 7,160 15,287 1.09 4.15E-13 TPANIC_0379 secA Cellular processes; Protein and peptide secretion 3,552 7,397 1.10 7.75E-20 TPANIC_1029 dbpA Translation; rRNA processing* 2,436 5,649 1.10 3.21E-07 TPANIC_0965 macA Cell envelope; Other 1,074 2,333 1.11 8.26E-17 TPANIC_0195...”

TP0379 preprotein translocase subunit (secA) from Treponema pallidum subsp. pallidum str. Nichols
47% identity, 99% coverage

• Transcriptional and immunological analysis of the putative outer membrane protein and vaccine candidate TprL of Treponema pallidum
  Haynes, PLoS neglected tropical diseases 2021
  • “...tp0257 FAM-AAGGTAGGATCAGCGCTCAG GTTTCTTACTTTCGAGGCAAAGGTGTG 228 +29 tp0279 NED-TCCGTTTTCTGCCCTGTACT GTTTCTTTCAAGAGCGATGATCACGGT 162 +7 tp0347 FAM-GTTGGTCCCAGTGGTTGTTC GTTTCTTACGACAATGCCCAGAAACAC 169 +99 tp0379 HEX- AGCAGGGTTACACGTACGAA GTTTCTTAGCCAAAGATGAGCCTGAGT 193 -70 tp0381 HEX-CCAGCTCACATACATCCCCT GTTTCTTAAAAGACCCGTATCCGCCA 176 -7 tp0479 HEX-TGGCATACTCCTCTTCGCAA CAGCGAGCAAAGAACCTACG 180 +95 tp0617 HEX-TGATGTTCCGTGGTCAGTGT GTTTCTTAACGTACCACCCTCCATGTT 184 -1 tp0798 NED-TGACTGAAGGTTGGCTACGT GATCAAGCCACCAAGACTGC 234 +826 tp0969 FAM-CAGTGGTAGGGACGTTCAGA CCGCGTACACCAAGACTTTC 246 +56...”
• Transcription of TP0126, Treponema pallidum putative OmpW homolog, is regulated by the length of a homopolymeric guanosine repeat
  Giacani, Infection and immunity 2015
  • “...protein MetG, methionyl-tRNA synthetase Hypothetical protein TP0279 TP0347 TP0379 TP0479 TP0497 TP0697 TP0798 TP0860 Poly(G) locationb 100 31 153 24 48 307 341...”
• Length of guanosine homopolymeric repeats modulates promoter activity of subfamily II tpr genes of Treponema pallidum ssp. pallidum
  Giacani, FEMS immunology and medical microbiology 2007
  • “...TP0084 TP0107 TP0126 TP0127 TP0257 TP0279 TP0347 TP0379 TP0381 TP0479 TP0697 TP0798 TP0859 TP0860 TP0969 Flagellar motor switch protein (fliG-1) (Treponema...”
• BAC library of T. pallidum DNA in E. coli
  Smajs, Genome research 2002
  • “...eight copies. In addition, 10 other ORFs (TP0324, TP325, TP0379, TP0648, TP0669-TP0671, TP0720, TP0739, and TP0742) were found in less than eight copies. All 10...”
• Spirochaetal lipoproteins and pathogenesis
  Haake, Microbiology (Reading, England) 2000

A0RNI3 Protein translocase subunit SecA from Campylobacter fetus subsp. fetus (strain 82-40)
48% identity, 100% coverage

• Novel protein identification methods for biomarker discovery via a proteomic analysis of periodontally healthy and diseased gingival crevicular fluid samples
  Baliban, Journal of clinical periodontology 2012
  • “...A domain-containing protein 5B2 3 1.0 1.6 Q8NDL9 Cytosolic carboxypeptidase-like protein 5 3 1.0 1.4 A0RNI3 Protein translocase subunit secA 3 1.0 2.5 For each protein, the UniProt accession number is given along with the total number (No.) of samples that contained the protein, the average...”
  • “...A0RQ16 CNPD_CAMFF Serine hydroxymethyltransferase 3 1.0 3.0 O83110 GLYA_CAMFF Chaperone protein clpB 3 1.0 1.0 A0RNI3 CLPB_TREPA Protein translocase subunit secA 3 1.0 3.0 Q64MV4 SECA_CAMFF Phosphoenolpyruvate carboxykinase [ATP] 2 1.0 3.0 Q3K3V7 PPCK_BACFR 50S ribosomal protein L5 2 1.0 2.0 Q8RDR4 RL5_STRA1 GMP synthase [glutamine-hydrolyzing]...”

BS27_1200 preprotein translocase subunit SecA from Bifidobacterium breve S27
46% identity, 93% coverage

• A Phytase-Based Reporter System for Identification of Functional Secretion Signals in Bifidobacteria
  Osswald, PloS one 2015
  • “...BS27_1602 445 43% AHJ25374.1 SecE BS27_1723 75 29% AHJ25486.1 SecG BS27_0998 82 25% AHJ24814.1 SecA BS27_1200 960 46% AHJ24997.1 B . animalis subsp . lactis ATCC27673 [ 68 ] SecY BLAC_02015 449 42% AGW84625.1 SecE BLAC_01550 76 30% AGW84532.1 SecG BLAC_04320 82 31% AGW85057.1 SecA BLAC_05590...”

BBIF_1223 preprotein translocase subunit SecA from Bifidobacterium bifidum S17
47% identity, 93% coverage

• A Phytase-Based Reporter System for Identification of Functional Secretion Signals in Bifidobacteria
  Osswald, PloS one 2015
  • “...BBIF_1484 444 42% ADO53689.1 SecE BBIF_0279 75 31% ADO52484.1 SecG BBIF_0980 82 30% ADO53185.1 SecA BBIF_1223 960 47% ADO53428.1 B . breve S27 [ 67 ] SecY BS27_1602 445 43% AHJ25374.1 SecE BS27_1723 75 29% AHJ25486.1 SecG BS27_0998 82 25% AHJ24814.1 SecA BS27_1200 960 46% AHJ24997.1...”

BLONG_1273 preprotein translocase subunit SecA from Bifidobacterium longum E18
47% identity, 93% coverage

• A Phytase-Based Reporter System for Identification of Functional Secretion Signals in Bifidobacteria
  Osswald, PloS one 2015
  • “...BLONG_1793 445 43% ESV34191.1 SecE BLONG_2073 75 29% ESV34434.1 SecG BLONG_1190 82 25% ESV33665.1 SecA BLONG_1273 964 49% ESV33737.1 TatA BLONG_0090 96 35% ESV32709.1 TatB BLONG_0088 86 35% ESV32707.1 TatC BLONG_0089 360 29% ESV32708.1 B . bifidum S17 [ 66 ] SecY BBIF_1484 444 42% ADO53689.1...”

Awo_c28060 preprotein translocase subunit SecA from Acetobacterium woodii DSM 1030
46% identity, 99% coverage

• Genome-Scale Analysis of Acetobacterium woodii Identifies Translational Regulation of Acetogenesis
  Shin, mSystems 2021
  • “...values were compared for seven genes. Validated genes are represented by uppercase letters: A, secA (Awo_c28060), encoding a protein translocase subunit; B, gyrA (Awo_c00060), encoding DNA gyrase; C, hydA2 (Awo_c08260) of the HDCR gene cluster; D, acsD (Awo_c10710) of the WL pathway carbonyl branch; E, metF...”

B3DR89 Protein translocase subunit SecA from Bifidobacterium longum (strain DJO10A)
47% identity, 93% coverage

• In Silico Screening of the Human Gut Metaproteome Identifies Th17-Promoting Peptides Encrypted in Proteins of Commensal Bacteria
  Hidalgo-Cantabrana, Frontiers in microbiology 2017
  • “...stercorarium xylA 100 AR15 AIQDEIDQLSTEIDR P80583 FLA_CLOTY Flagellin (Fragment) Clostridium tyrobutyricum fla 75 FR16 FAIVDEVDSILIDEAR B3DR89 SECA_BIFLD Protein translocase subunit SecA Bifidobacterium longum DJO10A secA 100 WK19 WIEAVGYSLTQHPDPELEK E8MGH8 HYBA1_BIFL2 Non-reducing end beta-L-arabinofuranosidase Bifidobacterium longum subsp. longum ATCC 15707 hypBA1 100 VF10 VPSEKKAELF P38059 SLAP_LACHE S-layer...”

BDP_1418 Protein translocase subunit secA from Bifidobacterium dentium Bd1
47% identity, 94% coverage

• A Phytase-Based Reporter System for Identification of Functional Secretion Signals in Bifidobacteria
  Osswald, PloS one 2015
  • “...BDP_0451 457 42% ADB09126.1 SecE BDP_0350 75 30% ADB09028.1 SecG BDP_1140 82 33% ADB09771.1 SecA BDP_1418 958 46% ADB10026.1 a protein size in amino acid residues (aa). b percent identity on amino acid sequence level to the respective homologue of E . coli K12-W3110. Construction of...”

GYA98_RS15380 preprotein translocase subunit SecA from Bacillus velezensis
47% identity, 99% coverage

• Comparative transcriptome analysis reveals the biocontrol mechanism of Bacillus velezensis E68 against Fusarium graminearum DAOMC 180378, the causal agent of Fusarium head blight
  Liang, PloS one 2023
  • “...Table 1 . Specificity was assessed with PCR and agarose gel. recA (GYA98_RS07520) and secA (GYA98_RS15380) were used as housekeeping genes for B . velezensis [ 42 ]. GzUBH , ubiquitin thiolesterase (FGRAMPH1_01G03049) and TUB2 , tubulin beta chain (FGRAMPH1_01G26865) were used as housekeeping genes for...”
  • “...velezensis E68 GYA98_RS07520 $ Multifunctional protein RecA recA-F AAAAAACAAAGTCGCTCCTCCG [ 42 ] recA recA-R CGATATCCAGTTCAGTTCCAAG GYA98_RS15380 $ Protein translocase subunit SecA oNL25_secA_f CGTTTAAAGTGCAGCTGATGG This paper secA oNL26_secA_r GGCTCGCCAGATATTCGTTG GYA98_RS15140 Heme response regulator HssR oNL45_hssR_F TATGAAGGTGACGAGCGTAC This paper hssR oNL46_hssR_R TGGATGGCAAACGGATAGTC GYA98_RS00430 Alkaline phosphatase D oNL47_phoD_F GCGTTTGAAGTGAATGCCG...”

SECA_BACSU / P28366 Protein translocase subunit SecA; EC 7.4.2.8 from Bacillus subtilis (strain 168) (see 3 papers)
P28366 bacterial ABC-type protein transporter (EC 7.4.2.5) from Escherichia coli (see paper)
BSU35300 preprotein translocase subunit SecA from Bacillus subtilis subsp. subtilis str. 168
NP_391410 translocase binding subunit (ATPase) from Bacillus subtilis subsp. subtilis str. 168
48% identity, 99% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  cofactor: Zn(2+) (May bind 1 zinc ion per subunit.)
  subunit: Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may be involved. Monomer and many different homodimers can be isolated (PubMed:16989859), some of which are not formed in the presence of a synthetic signal peptide. A single SecA monomer interacts with SecY in the channel. Only shows some colocalization with FloA or FloT membrane assemblies (PubMed:27362352).
• The Blueprint of a Minimal Cell: MiniBacillus
  Reuß, Microbiology and molecular biology reviews : MMBR 2016
  • “...BSU15950 BSU23890 Yes Yes No No secA secE secY BSU35300 BSU01000 BSU01360 Yes Yes Yes secG sipS prsA BSU33630 BSU23310 BSU09950 No No Yes csaA BSU19040 No...”
• Motions of the SecA protein motor bound to signal peptide: Insights from molecular dynamics simulations.
  Milenkovic, Biochimica et biophysica acta. Biomembranes 2018 (PubMed)
  • GeneRIF: Hydrogen bond clusters contribute to the long-distance propagation of changes in SecA translocase (SecA) dynamics.
• Mechanism of conformational coupling in SecA: Key role of hydrogen-bonding networks and water interactions.
  Milenkovic, Biochimica et biophysica acta 2016 (PubMed)
  • GeneRIF: the nucleotide-binding site of ADP-bound SecA has a preferred geometry whereby the first two carboxylates of the DEAD motif bridge via hydrogen-bonding water.
• SecA dimer cross-linked at its subunit interface is functional for protein translocation.
  Jilaveanu, Journal of bacteriology 2006
  • GeneRIF: Cysteine-directed mutagenesis along with the crystal structure of the SecA dimer created a cross-linked dimer at its subunit interface, which was normally active for in vitro protein translocation
• iPDA: integrated protein disorder analyzer.
  Su, Nucleic acids research 2007
  • “...and DisPSSMP2 are plotted as red sticks on the structure of a homologous protein, SECA_BACSU (P28366). Other 12 WildSpan predicted residues that either provides inter-molecular interactions to ADP or intra-molecular interactions with each other and/or the previous 10 residues are plotted as yellow sticks . Distances...”
• Two nonredundant SecA homologues function in mycobacteria
  Braunstein, Journal of bacteriology 2001
  • “...U21192 Q55357 BAB41941 BAB43747 P47847 AE005672 AE005672 P10408 P28366 Q41062 P38380 AF116183 U32772 AAF41891 O25475 QO1570 OO7497 P47318 % Similarity to M....”

WP_161986335 preprotein translocase subunit SecA from Bacillus subtilis
48% identity, 99% coverage

• Using Graphs of Dynamic Hydrogen-Bond Networks To Dissect Conformational Coupling in a Protein Motor.
  Karathanou, Journal of chemical information and modeling 2019 (PubMed)
  • GeneRIF: Mutations near the nucleotide-binding site or changes of the nucleotide-binding state of SecA associate with altered dynamics at the preprotein binding domain and identify extended networks of hydrogen bonds that connect the active site of SecA to the region where SecA binds newly synthesized secretory proteins. Water molecules participate in hydrogen-bonded water chains that bridge functional domains of SecA.

CDR20291_0142 preprotein translocase SecA subunit from Clostridium difficile R20291
46% identity, 99% coverage

• Proteomic Signatures of Clostridium difficile Stressed with Metronidazole, Vancomycin, or Fidaxomicin
  Maaß, Cells 2018
  • “...MurA CDR20291_0122 UDP- N -acetylglucosamine 1-carboxyvinyltransferase x CDIF630erm_03828 Prs CDR20291_3351 ribose-phosphate pyrophosphokinase x CDIF630erm_00260 SecA1 CDR20291_0142 protein translocase subunit SecA1 x CDIF630erm_01292 MreB2 CDR20291_0982 rod shape-determining protein MreB x x CDIF630erm_03832 MurC CDR20291_3355 UDP- N -acetylmuramate- l -alanine ligase x x CDIF630erm_03585 Pgi CDR20291_3146 glucose-6-phosphate isomerase...”

SECA1_MYCS2 / P71533 Protein translocase subunit SecA 1; EC 7.4.2.8 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
P71533 bacterial ABC-type protein transporter (EC 7.4.2.5) from Mycolicibacterium smegmatis (see paper)
MSMEG_1881 preprotein translocase, SecA subunit from Mycobacterium smegmatis str. MC2 155
MSMEG_1881, MSMEI_1840 preprotein translocase subunit SecA from Mycolicibacterium smegmatis MC2 155
50% identity, 87% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  subunit: Monomer and homodimer. Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved.
  disruption phenotype: Essential, it cannot be disrupted.
• Interactome Analysis Identifies MSMEI_3879 as a Substrate of Mycolicibacterium smegmatis ClpC1
  Ogbonna, Microbiology spectrum 2023
  • “...0.57 0.34 0.41 0.18 A0QWL3 MSMEG_2982, MSMEI_2907 Putative periplasmic binding protein 0.46 0.3 0.44 0.04 P71533 secA1 , MSMEG_1881, MSMEI_1840 Protein translocase subunit SecA 1 0.07 0.06 0.04 0.05 A0QXF3 MSMEG_3280, MSMEI_3196 Polyamine-binding lipoprotein 0.06 0.03 A0QRB1 MSMEG_1052, MSMEG_2332 Amino acid carrier protein 0.13 0.13 0.1...”
  • “...pntA , MSMEG_0110, MSMEI_0106 NAD(P) transhydrogenase, alpha subunit (EC 1.6.1.1) BACTH b 0.059 18.000 WT P71533 secA1 , MSMEG_1881, MSMEI_1840 Protein translocase subunit SecA 1 ClpC1/P2 KD a 0.056 28.833 WT, EQ, NTD, CORE A0QZJ0 MSMEG_4042, MSMEI_3947 Transcriptional regulator, GntR family protein BACTH b 0.050 6.000...”
• Interactome Analysis Identifies MSMEI_3879 as a Substrate of Mycolicibacterium smegmatis ClpC1
  Ogbonna, Microbiology spectrum 2023
  • “...0.18 A0QWL3 MSMEG_2982, MSMEI_2907 Putative periplasmic binding protein 0.46 0.3 0.44 0.04 P71533 secA1 , MSMEG_1881, MSMEI_1840 Protein translocase subunit SecA 1 0.07 0.06 0.04 0.05 A0QXF3 MSMEG_3280, MSMEI_3196 Polyamine-binding lipoprotein 0.06 0.03 A0QRB1 MSMEG_1052, MSMEG_2332 Amino acid carrier protein 0.13 0.13 0.1 0.07 A0QYK4 MSMEG_3689,...”
  • “...MSMEI_0106 NAD(P) transhydrogenase, alpha subunit (EC 1.6.1.1) BACTH b 0.059 18.000 WT P71533 secA1 , MSMEG_1881, MSMEI_1840 Protein translocase subunit SecA 1 ClpC1/P2 KD a 0.056 28.833 WT, EQ, NTD, CORE A0QZJ0 MSMEG_4042, MSMEI_3947 Transcriptional regulator, GntR family protein BACTH b 0.050 6.000 EQ, CORE A0R616...”
• Characterization of Conserved and Novel Septal Factors in Mycobacterium smegmatis
  Wu, Journal of bacteriology 2018
  • “...2 FtsQ pulldown dataa MSMEG no. MSMEG_1881 MSMEG_2430 MSMEG_3748 MSMEG_1604 MSMEG_2416 MSMEG_4533 MSMEG_2690 MSMEG_6434 MSMEG_6105 MSMEG_4287 MSMEG_2410...”
• A complex regulatory network controlling intrinsic multidrug resistance in Mycobacterium smegmatis
  Bowman, Molecular microbiology 2014
  • “...smegmatis ID M. tuberculosis ID Protein ID 4 MSMEG_0059 Rv3868 ATPase, AAA family protein 9 MSMEG_1881 Rv3240c preprotein translocase subunit SecA 10 MSMEG_6091 Rv3596c negative regulator of genetic competence ClpC/mecB 16, 17 MSMEG_0456 Rv0006 DNA gyrase subunit A 15 MSMEG_0005 Rv0005 DNA gyrase subunit B 30...”
• Interactome Analysis Identifies MSMEI_3879 as a Substrate of Mycolicibacterium smegmatis ClpC1
  Ogbonna, Microbiology spectrum 2023
  • “...A0QWL3 MSMEG_2982, MSMEI_2907 Putative periplasmic binding protein 0.46 0.3 0.44 0.04 P71533 secA1 , MSMEG_1881, MSMEI_1840 Protein translocase subunit SecA 1 0.07 0.06 0.04 0.05 A0QXF3 MSMEG_3280, MSMEI_3196 Polyamine-binding lipoprotein 0.06 0.03 A0QRB1 MSMEG_1052, MSMEG_2332 Amino acid carrier protein 0.13 0.13 0.1 0.07 A0QYK4 MSMEG_3689, MSMEI_3602...”
  • “...NAD(P) transhydrogenase, alpha subunit (EC 1.6.1.1) BACTH b 0.059 18.000 WT P71533 secA1 , MSMEG_1881, MSMEI_1840 Protein translocase subunit SecA 1 ClpC1/P2 KD a 0.056 28.833 WT, EQ, NTD, CORE A0QZJ0 MSMEG_4042, MSMEI_3947 Transcriptional regulator, GntR family protein BACTH b 0.050 6.000 EQ, CORE A0R616 MSMEG_6391,...”

CD0143 preprotein translocase SecA subunit from Clostridium difficile 630
46% identity, 99% coverage

• Clostridium difficile has two parallel and essential Sec secretion systems
  Fagan, The Journal of biological chemistry 2011
  • “...SecA, putatively annotated as SecA1 and SecA2 (29, 43). SecA1 (CD0143 in strain 630) displays 47 and 51% amino acid sequence identity to the E. coli and B....”
  • “...at University of California, Berkeley on February 11, 2017 CD0143 is the housekeeping SecA1 protein and that the second protein, SecA2, may form the core of an...”

HMPREF0389_01740 preprotein translocase subunit SecA from Filifactor alocis ATCC 35896
46% identity, 98% coverage

• Proteome variation among Filifactor alocis strains
  Aruni, Proteomics 2012
  • “...prediction score and category d) Domains e) HI score f) Nature of protein g) 1. HMPREF0389_01740 Hypothetical protein 104.4/104.3 35/0.09 5 0.243 CM SecA ATPase domain 0.56 Nonsecretory protein 2. HMPREF0389_00724 ATP-dependent chaperone protein (CIpB) 97.5/97.6 14.98/1.85 82 0.380 CM AAA domain (ATP associated with wide...”

BAD_1020 preprotein translocase SecA subunit from Bifidobacterium adolescentis ATCC 15703
46% identity, 94% coverage

• A Phytase-Based Reporter System for Identification of Functional Secretion Signals in Bifidobacteria
  Osswald, PloS one 2015
  • “...BAD_0341 457 42% BAF39122.1 SecE BAD_0245 75 30% BAF39026.1 SecG BAD_0833 100 33% BAF39614.1 SecA BAD_1020 958 46% BAF39801.1 B . dentium Bd1 [ 69 ] SecY BDP_0451 457 42% ADB09126.1 SecE BDP_0350 75 30% ADB09028.1 SecG BDP_1140 82 33% ADB09771.1 SecA BDP_1418 958 46% ADB10026.1...”

BLAC_05590 preprotein translocase subunit SecA from Bifidobacterium animalis subsp. lactis ATCC 27673
46% identity, 92% coverage

• A Phytase-Based Reporter System for Identification of Functional Secretion Signals in Bifidobacteria
  Osswald, PloS one 2015
  • “...BLAC_02015 449 42% AGW84625.1 SecE BLAC_01550 76 30% AGW84532.1 SecG BLAC_04320 82 31% AGW85057.1 SecA BLAC_05590 974 45% AGW85303.1 B . adolescentis ATCC15703 NC_008618.1 SecY BAD_0341 457 42% BAF39122.1 SecE BAD_0245 75 30% BAF39026.1 SecG BAD_0833 100 33% BAF39614.1 SecA BAD_1020 958 46% BAF39801.1 B ....”

DIP0699 Translocase protein from Corynebacterium diphtheriae NCTC 13129
49% identity, 92% coverage

• The DtxR protein acting as dual transcriptional regulator directs a global regulatory network involved in iron metabolism of Corynebacterium glutamicum
  Brune, BMC genomics 2006
  • “...biosynthesis protein - DIP0625 1 TTAGGTAAGTGTAGCCTAT DIP06240629 3 iron ABC transport system cg0466 , JK0315 DIP0699 TTGTGTTAGCCTAGGCTAA - preprotein translocase subunit SecA - DIP0894 1 CTAGGATTGCCTACACTTA - hypothetical protein CE1009 DIP0922 1 TAACCTTAGGCTTGCCTTT - AraC-family regulatory protein cg1120 DIP1061 1 TTAGGGTAACCTGTCCAAC DIP1062-1059 3 iron ABC transport...”
• Prediction of DtxR regulon: identification of binding sites and operons controlled by Diphtheria toxin repressor in Corynebacterium diphtheriae
  Yellaboina, BMC microbiology 2004
  • “...predictions. A sample of predicted regulator binding motifs (Table 2 ) (upstream to ORFs: DIP2161, DIP0699, DIP0586, DIP2304, DIP2272) were experimentally verified by EMSA using IdeR, an orthologue of DtxR from M. tuberculosis . DtxR and IdeR are iron-dependent regulators. A pair wise sequence comparison of...”
  • “...Regulation of protein translation and translocation system DtxR could regulate two operons that contain genes DIP0699 ( secA ) and DIP0540 ( secY ) that code for the protein translocation system. The sec Y-containing operon, which is similar to the streptomycine operon spc from B. subtilis...”

NPW32_RS04480 preprotein translocase subunit SecA from Staphylococcus epidermidis
45% identity, 98% coverage

• The first genomic characterization of a stable, hemin-dependent small colony variant strain of Staphylococcus epidermidis isolated from a prosthetic-joint infection
  Bogut, Frontiers in microbiology 2023
  • “...family (PqqL) NPW32_RS07210 vraR A202V (8th aa from the C-terminus) Three-component system response regulator VraR NPW32_RS04480 secA P656T Preprotein translocase subunit SecA NPW32_RS06635 V283M Flavoprotein YhiN/ NAD(P)/FAD-dependent oxidoreductase NPW32_RS00235** clpP V24I, K52E, S138A, F175V, N218T, N227S, N228D Clp protease ClpP NPW32_RS11240 G430V Predicted extracellular nuclease/GldG family...”

SECA1_STAA8 / O06446 Protein translocase subunit SecA 1; EC 7.4.2.8 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
Q2FIN8 Protein translocase subunit SecA 1 from Staphylococcus aureus (strain USA300)
SA0708 translocase from Staphylococcus aureus subsp. aureus N315
NP_371277 translocase from Staphylococcus aureus subsp. aureus Mu50
SAOUHSC_00769 preprotein translocase, SecA subunit from Staphylococcus aureus subsp. aureus NCTC 8325
SAUSA300_0737 preprotein translocase, SecA subunit from Staphylococcus aureus subsp. aureus USA300_FPR3757
MW0715 preprotein translocase subunit from Staphylococcus aureus subsp. aureus MW2
46% identity, 98% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  cofactor: Zn(2+) (May bind 1 zinc ion per subunit.)
  subunit: Monomer and homodimer. Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved.
• In-Depth Characterization of the Staphylococcus aureus Phosphoproteome Reveals New Targets of Stk1
  Prust, Molecular & cellular proteomics : MCP 2021
  • “...serine protease HtrA T12 SAUSA300_1856 A0A0H2XHR8 Uncharacterized protein T89 SAUSA300_1909 A0A0H2XEY2 Uncharacterized protein T143 secA1 Q2FIN8 Protein translocase subunit SecA 1 S702 secA1 Q2FIN8 Protein translocase subunit SecA 1 S565 Table2 Phosphosites overrepresented in Stp1 mutant/Ctrl but not identified in Stk1 and no identification on full...”
• Mastitis-related Staphylococcus aureus-derived extracellular vesicles induce a pro-inflammatory response in bovine monocyte-derived macrophages
  Saenz-de-Juano, Scientific reports 2025 (no snippet)
• Screening a library of temperature-sensitive mutants to identify secretion factors in Staphylococcus aureus
  Leddy, Journal of bacteriology 2025 (no snippet)
• The antimicrobial peptide Temporin-L induces vesicle formation and reduces the virulence in S. aureus
  Canè, Biochemistry and biophysics reports 2024
  • “...sub alpha accA 2.8 Fatty Acid Biosynthesis Q2FXT8 Multifunctional fusion protein secD 2.19 Cell Wall O06446 Protein translocase subunit SecA 1 secA1 2.23 Cell Wall Q2FZW3 Protein DltD dltD 2.29 Cell Wall Q2FXK8 Septation ring formation regulator EzrA ezrA 2.29 Cell Wall Q2FXJ7 1-acyl- sn -glycerol-3-phosphate...”
• Characterizing the effects of inorganic acid and alkaline shock on the Staphylococcus aureus transcriptome and messenger RNA turnover
  Anderson, FEMS immunology and medical microbiology 2010
  • “...SA1243 putative glycerol-3-phosphate acyltransferase sa_c7092s6204_a_at 5.8 2.5 2.5 SA0426 acetyl-CoA acetyltransferase sa_c8003s6987_a_at 4.5 2.5 ND SA0708 DAK2 domain protein sa_c8019s7004_a_at 5.2 2.5 2.5 SA0712 lipase/esterase sa_c1242s1022_a_at * 3.6 2.5 2.5 SA1240 DAK2 domain protein sa_c3216s2764_a_at 26.0 2.5 ND SA1776 putative 1-acyl-sn-glycerol-3-phosphate acyltransferase sa_c3830s3301_a_at 3.8 2.5 2.5...”
• Blood Serum Affects Polysaccharide Production and Surface Protein Expression in S. Aureus
  Islam, Advances in biotechnology & microbiology (Newbury, Calif.) 2017
  • “...Alpha-keto acid dehydrogenase (pdhc) Carbohydrate metabolism 4.8/46 NP_371619 2. Preprotein translocase (secA) Protein export 5_0/46 NP_371277 3. Translation initiation factor (infE) Protects of tRNA from hydrolysis 5.2/77 NP_371619 b8 1. Formate acetytansferase Anaerobic glycolysis 52184 NP_370750 2. CIpB chaperone-like protein Stress proteins 4_2/98 NP_371499 3. Translation...”
• Identification of RNAIII-binding proteins in Staphylococcus aureus using tethered RNAs and streptavidin aptamers based pull-down assay
  Zhang, BMC microbiology 2015
  • “...proteins with RNA-binding and DNA-binding domains identified by MS Proteins with RNA-binding domains Gene Protein SAOUHSC_00769 Protein translocase subunit SecA SAOUHSC_01035 Ribonuclease J 1 SAOUHSC_01252 Ribonuclease J 2 SAOUHSC_01659 Putative uncharacterized protein SAOUHSC_01679 Putative uncharacterized protein SAOUHSC_01207 Signal recognition particle protein SAOUHSC_01184 Sun protein SAOUHSC_02362 Transcription...”
• Genetic variation in the Staphylococcus aureus 8325 strain lineage revealed by whole-genome sequencing
  Bæk, PloS one 2013
  • “...of the engineered mntH disruption has not yet been clearly defined. Alignment of Sec A1 (SAOUHSC_00769) homologs shows that all members of this protein family have an acidic amino acid (aspartate or glutamate) at the mutated position (VETS E YISN), thus a substitution to valine might...”
• Whole-genome sequencing of Staphylococcus aureus strain RN4220, a key laboratory strain used in virulence research, identifies mutations that affect not only virulence factors but also the fitness of the strain
  Nair, Journal of bacteriology 2011
  • “...G42S A106T SAOUHSC_00383 SAOUHSC_00591 SAOUHSC_00769 SAOUHSC_00812 SAOUHSC_00859 SAOUHSC_00961 SAOUHSC_01048 SAOUHSC_01053 SAOUHSC_01102 SAOUHSC_01...”
• Novel Regulation of Alpha-Toxin and the Phenol-Soluble Modulins by Peptidyl-Prolyl cis/trans Isomerase Enzymes in Staphylococcus aureus
  Keogh, Toxins 2019
  • “...protein SAUSA300_2510 0.20 Conserved hypothetical protein SAUSA300_2312 Mqo 0.18 Energy metabolism SAUSA300_2296 0.17 Unknown function SAUSA300_0737 SecA1 0.10 Protein fate SAUSA300_2477 CidC 0.09 Energy metabolism SAUSA300_1711 PutA 0.05 Energy metabolism SAUSA300_2125 0.05 Transport and binding proteins SAUSA300_0857 PpiB 0.01 Conserved hypothetical protein 1 Fold change is...”
  • “...Number Protein Name Fold Change 1 Protein Description SAUSA300_0857 PpiB 31.5 Putative peptidyl-prolyl cis-trans isomerase SAUSA300_0737 SecA1 8.5 Protein translocase subunit SecA 1 SAUSA300_1027 RpmF 7.8 50S ribosomal protein L32 SAUSA300_2364 Sbi 7.5 Immunoglobulin-binding protein sbi SAUSA300_1535 RpsU 6.25 30S ribosomal protein S21 SAUSA300_1178 RecA 5.75...”
• Extracellular vesicles produced by human and animal Staphylococcus aureus strains share a highly conserved core proteome
  Tartaglia, Scientific reports 2020
  • “...+ + + + Lipoteichoic acid synthase MW0681 ltaS + + Preprotein translocase subunit SecA MW0715 secA1 + + + + + Preprotein translocase subunit SecDF MW1587 secDF + + + + + a adapted from 84 . S. aureus EV proteomes reflect strain properties To...”

Q8CPZ2 Protein translocase subunit SecA 1 from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
SERP0420 preprotein translocase, SecA subunit from Staphylococcus epidermidis RP62A
45% identity, 98% coverage

• The Extracellular Vesicles from the Commensal Staphylococcus Epidermidis ATCC12228 Strain Regulate Skin Inflammation in the Imiquimod-Induced Psoriasis Murine Model
  Gómez-Chávez, International journal of molecular sciences 2021
  • “...ligase family protein L Q8CSH8 COG0776 - Transcriptional regulator M Q8CP74 COG0744 - Transglycosylase U Q8CPZ2 COG0653 secA1 Protein translocase subunit C Q8CNJ3 COG0711 atpF ATP synthase subunit b C Q8CT13 COG0508 pdhC Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex C Q8CPN3 COG1071 pdhA Pyruvate dehydrogenase...”
• Concentration-Dependent Global Quantitative Proteome Response of Staphylococcus epidermidis RP62A Biofilms to Subinhibitory Tigecycline
  Sung, Cells 2022
  • “...with quorum sensing. Fold Ratio Locus Tag Gene PATRIC ID COG Description T1 T2 T3 SERP0420 secA1 fig|176279.9.peg.400 U Protein translocase subunit 1000.00 2.93 1000.00 SERP0738 SERP0738 fig|176279.9.peg.717 S Phenol soluble modulin beta 1 1000.00 1000.00 0.00 SERP0803 ffh fig|176279.9.peg.781 U Signal recognition particle protein 1000.00...”
  • “...COG Description T1 T2 T3 SERP0024 SERP0024 fig|176279.9.peg.23 U Signal peptidase I 0.00 1000.00 1000.00 SERP0420 secA1 fig|176279.9.peg.400 U Protein translocase subunit 1000.00 2.93 1000.00 SERP0553 spsB fig|176279.9.peg.533 U Signal peptidase I 3.77 12.13 14.23 SERP0803 ffh fig|176279.9.peg.781 U Signal recognition particle protein 1000.00 1000.00 1000.00...”

MAB_3580c Preprotein translocase secA 1 subunit from Mycobacterium abscessus ATCC 19977
48% identity, 90% coverage

• Mycobacterium abscessus extracellular vesicles increase mycobacterial resistance to clarithromycin in vitro
  Vermeire, Proteomics 2024 (secret)
• Comparing the Utilities of Different Multilocus Sequence Typing Schemes for Identifying Outbreak Strains of Mycobacterium abscessus subsp. massiliense
  Cheng, Journal of clinical microbiology 2019 (secret)
• High-level relatedness among Mycobacterium abscessus subsp. massiliense strains from widely separated outbreaks
  Tettelin, Emerging infectious diseases 2014
  • “...subsp. massiliense genomes showed a GT substitution at position 820 (by using the secA1 gene MAB_3580c from the M. abscessus subsp. abscessus type strain) shared by the Papworth and Seattle cystic fibrosis outbreak strains but not by the soft tissue outbreak strains from Brazil or additional...”

EF1763 preprotein translocase, SecA subunit from Enterococcus faecalis V583
47% identity, 100% coverage

• Pilin and sortase residues critical for endocarditis- and biofilm-associated pilus biogenesis in Enterococcus faecalis
  Nielsen, Journal of bacteriology 2013
  • “...of anti-SecA immune sera. Full-length E. faecalis V583 secA (EF1763) was amplified from V583 genomic DNA using the primers rSecA-f and rSecA-r (listed in Table...”

SAV_5071 preprotein translocase subunit SecA from Streptomyces avermitilis MA-4680
49% identity, 88% coverage

• Genomic data mining reveals a rich repertoire of transport proteins in Streptomyces
  Zhou, BMC genomics 2016 (no snippet)

jhp0723 PREPROTEIN TRANSLOCASE SUBUNIT from Helicobacter pylori J99
48% identity, 98% coverage

• Inter-species horizontal transfer resulting in core-genome and niche-adaptive variation within Helicobacter pylori
  Saunders, BMC genomics 2005
  • “...109 adenine/cytosine DNA methyltransferase HP0054 NAH - 120 20 119 preprotein translocase subunit (secA) HP0786 JHP0723 159 176 49 121 hypothetical protein HP0058 JHP0051 394 16 53 122 hypothetical protein HP0513 JHP0462 104 28 15 125 type I restriction enzyme M protein (hsdM) HP1403 JHP1423 299...”
  • “...160 169 GMP reductase (guaC) HP0854 JHP0790 44 451 176 preprotein translocase subunit (secA) HP0786 JHP0723 119 49 181 cell division protein (ftsK) HP1090 JHP0335 37 90 207 adenine specific DNA methyltransferase (mod) HP1522 JHP1411 363 11 210 type III restriction enzyme R protein (res) HP1521...”

WP_000588127 preprotein translocase subunit SecA from Helicobacter pylori Puno135
48% identity, 98% coverage

• Establishment of serine protease htrA mutants in Helicobacter pylori is associated with secA mutations.
  Zawilak-Pawlik, Scientific reports 2019
  • GeneRIF: Establishment of serine protease htrA mutants in Helicobacter pylori is associated with secA mutations.

O25475 Protein translocase subunit SecA from Helicobacter pylori (strain ATCC 700392 / 26695)
HP0786 preprotein translocase subunit (secA) from Helicobacter pylori 26695
47% identity, 98% coverage

• Outer Membrane Vesicles Secreted by Helicobacter pylori Transmitting Gastric Pathogenic Virulence Factors
  Wei, ACS omega 2022
  • “...P56452 alaS 377 P94842 ybgC 378 O24885 gmd 379 O24864 CheV 380 P56184 prs 381 O25475 secA 382 O25477 HP_0788 383 O24973 OmpR 384 O26096 metN 385 P56157 dnaE 386 O24890 HP_0049 387 O26064 HP_1539 388 O25533 coaX 389 P56115 hemL 390 O25577 carB 391 P56176...”
  • “...O25424 ansA 210 O26031 Omp32 211 O25564 HP_0906 212 P56104 adk 213 O25477 HP_0788 214 O25475 secA 215 P56035 rplI 216 O25474 lolA 217 O25165 guaA 218 O25283 accA 219 P56468 purB 220 O25574 FrpB 221 O24924 thrC 222 O25572 HP_0914 223 P56004 efp 224 P56032...”
• Decipher the Helicobacter pylori Protein Targeting in the Nucleus of Host Cell and their Implications in Gallbladder Cancer: An insilico approach
  Wang, Journal of Cancer 2021
  • “...binding, structural constituent of ribosome Protein inferred from homology 9.78 15184 0 4.3 Nucleus Nucleus O25475 Protein translocase subunit SecA ATP binding, metal ion binding Protein inferred from homology 5.62 99084 0 5.6 Nucleus Nucleus Q09064 Urease accessory protein UreE Nickel cation binding Experimental evidence at...”
• Complete sequence and organization of pBtoxis, the toxin-coding plasmid of Bacillus thuringiensis subsp. israelensis
  Berry, Applied and environmental microbiology 2002
  • “...Helicobacter pylori preprotein translocase SecA subunit hp0786 SW:SECA_HELPY (O25475) (48 in 31 aa); contains HMMPfam hit to PF02810; SEC-C motif (the motif is...”
  • “...of Helicobacter pylori preprotein translocase SecA subunit SW:SECA_HELPY (O25475) (48.38 in 31 aa); contains HMMPfam hit to PF02810; SEC-C motif (the motif is...”
• Two nonredundant SecA homologues function in mycobacteria
  Braunstein, Journal of bacteriology 2001
  • “...AE005672 P10408 P28366 Q41062 P38380 AF116183 U32772 AAF41891 O25475 QO1570 OO7497 P47318 % Similarity to M. tuberculosisa SecA1 SecA2 100.0 98.6 88.0 90.4 50.2...”
• Identification of an Essential LolD-Like Protein in Helicobacter pylori
  McClain, Journal of bacteriology 2023 (secret)
• Application of FLP-FRT System to Construct Unmarked Deletion in Helicobacter pylori and Functional Study of Gene hp0788 in Pathogenesis
  Ji, Frontiers in microbiology 2017
  • “...performed as previously described. In the wild type of H. pylori , amplicons corresponding to hp0786, hp0787, hp0788, hp0789 , and hp0790 were all present, while the hp0788 amplicon was not obtained in the hp0788 mutant (Figure 2B ). This result indicated that hp0788 was deleted....”
• Aconitase Functions as a Pleiotropic Posttranscriptional Regulator in Helicobacter pylori
  Austin, Journal of bacteriology 2015
  • “...HP1177 HP0604 HP1110 HP0392 HP1133 HP1430 HP0913 HP1422 HP0786 HP1296 HP1468 HP0480 HP1048 HP0297 Gene Aconitase in Helicobacter TABLE 3 Putative targets for...”
• Structural and functional aspects of the Helicobacter pylori secretome
  Zanotti, World journal of gastroenterology 2014
  • “...HP1569 HP1216 HP1546 HP0362 HP1498 HP1082 HP0655 HP1378 HP0786 HP1300 HP1203 HP1255 HP1550 HP1549 HP1551 HP1540 HP1152 HP0763 HP0320 HP1060 HP1061 HP0175 HP1019...”
• Outer membrane biogenesis in Escherichia coli, Neisseria meningitidis, and Helicobacter pylori: paradigm deviations in H. pylori
  Liechti, Frontiers in cellular and infection microbiology 2012
  • “...lipoprotein HP1378 bamD *** *** OM associated lipoprotein N/A bamE OM associated lipoprotein Sec PATHWAY HP0786 secA 0.0 49%/64% Preprotein translocase subunit N/A secB Protein export chaperone HP1300 secY 7e 105 42%/67% Preprotein translocase subunit HP1203a secE *** *** Preprotein translocase subunit HP1255 secG 0.001 35%/61%...”
• Involvement of the HP0165-HP0166 two-component system in expression of some acidic-pH-upregulated genes of Helicobacter pylori
  Wen, Journal of bacteriology 2006
  • “...HP0540 HP0541 HP0542 HP0543 HP0259 HP0786 HP1240 Methyl-accepting chemotaxis transducer (tlpC) Lysyl-tRNA synthetase (lysS) Serine hydroxymenthyltransferase...”
• Inter-species horizontal transfer resulting in core-genome and niche-adaptive variation within Helicobacter pylori
  Saunders, BMC genomics 2005
  • “...21 109 adenine/cytosine DNA methyltransferase HP0054 NAH - 120 20 119 preprotein translocase subunit (secA) HP0786 JHP0723 159 176 49 121 hypothetical protein HP0058 JHP0051 394 16 53 122 hypothetical protein HP0513 JHP0462 104 28 15 125 type I restriction enzyme M protein (hsdM) HP1403 JHP1423...”
  • “...50 160 169 GMP reductase (guaC) HP0854 JHP0790 44 451 176 preprotein translocase subunit (secA) HP0786 JHP0723 119 49 181 cell division protein (ftsK) HP1090 JHP0335 37 90 207 adenine specific DNA methyltransferase (mod) HP1522 JHP1411 363 11 210 type III restriction enzyme R protein (res)...”
• Acid-adaptive genes of Helicobacter pylori
  Wen, Infection and immunity 2003
  • “...2.33 2.79 2.43 2.37 3.08 HP0382 HP0570 HP0786 HP0793 Zinc-metalloprotease (YJR117W) Aminopeptidase a/i (pepA) Preprotein translocase subunit (secA) Polypeptide...”
• More

SCO3005 translocase from Streptomyces coelicolor A3(2)
49% identity, 87% coverage

• Effects of carbon ion beam-induced mutagenesis for the screening of RED production-deficient mutants of Streptomyces coelicolor JCM4020
  Yanagisawa, PloS one 2022
  • “...F membrane protein (SarA) JCM4020_41980 SCO4069 100.0 3,444,416 795C>T S preprotein translocase subunit SecA JCM4020_31820 SCO3005 99.9 2,493,601 712G>A Ala238Thr M lipoyl synthase JCM4020_23420 SCO2194 99.7 11 Mt 208014 4,593,233 C>A UTR 4,565,012 1316_1317insG Val440>FS F membrane protein (SarA) JCM4020_41980 SCO4069 100.0 2,981,624 G>A UTR 2,708,647...”
• Genomic data mining reveals a rich repertoire of transport proteins in Streptomyces
  Zhou, BMC genomics 2016 (no snippet)
• Pre-sporulation stages of Streptomyces differentiation: state-of-the-art and future perspectives
  Yagüe, FEMS microbiology letters 2013
  • “...SCO1707 SCO2969 SCO3958 SCO5339 SCO6259 SCO7008 SCO0491 SCO1719 SCO2975 SCO4075 SCO5383 SCO6295 SCO7051 SCO0493 SCO1742 SCO3005 SCO4116 SCO5387 SCO6366 SCO7173 SCO0504 SCO1780 SCO3217 SCO4259 SCO5439 SCO6426 SCO7689 SCO0700 SCO1798 SCO3235 SCO4316 SCO5448 SCO6512 SCO7690 SCO0723 SCO1840 SCO3257 SCO4359 SCO5449 SCO6517 SCO7841 SCO0742 SCO1848 SCO3261 SCO4405 SCO5451...”
• Noncoding RNA of glutamine synthetase I modulates antibiotic production in Streptomyces coelicolor A3(2)
  D'Alia, Journal of bacteriology 2010
  • “...(17.98) a cnc3005(5-7) (spanning three predicted ncRNAs in SCO3005), cnc3005.5, cnc4425, and cnc5998.2 could not be compared to the background since unspecific...”

1m74A / P28366 Crystal structure of mg-adp-bound seca from bacillus subtilis (see paper)
49% identity, 90% coverage

• Ligand: adenosine-5'-diphosphate (1m74A)

Q8NSB6 bacterial ABC-type protein transporter (EC 7.4.2.5) from Corynebacterium glutamicum (see paper)
NCgl0726 preprotein translocase subunit SecA from Corynebacterium glutamicum ATCC 13032
cg0868 preprotein translocase subunit SecA from Corynebacterium glutamicum ATCC 13032
49% identity, 90% coverage

• Understanding the high L-valine production in Corynebacterium glutamicum VWB-1 using transcriptomics and proteomics
  Zhang, Scientific reports 2018
  • “...hydrolase family 4.29/14458.40 2069.05 4579.75 3.1 92 NCgl2659 cg3050 Acyltransferase 4.61/20172.76 0.00 790.25 1.5 93 NCgl0726 cg0868 secA Preprotein translocase subunit seca 5.01/95404.70 809.37 2279.75 NC 95 NCgl0336 cg0413 cmt1 Trehalose corynomycolyl transferase 4.56/39506.27 683.01 0.00 3.0 96 NCgl0888 cg1055 menG ribonuclease activity regulator protein RraA...”
• Functional Genomics Uncovers Pleiotropic Role of Rhomboids in Corynebacterium glutamicum
  Luenenschloss, Frontiers in microbiology 2022
  • “...in lower amounts at 40C. Intracellular Trafficking, Secretion, and Vesicular Transport Preprotein translocase subunit SecA (Cg0868) and preprotein translocase subunit YajC (Cg1868) decreased their abundance in the MF at 30C, suggesting overall decreased protein secretion in the deletion strain. Signal recognition particle GTPase (Cg2262) increased in...”
• Understanding the high L-valine production in Corynebacterium glutamicum VWB-1 using transcriptomics and proteomics
  Zhang, Scientific reports 2018
  • “...family 4.29/14458.40 2069.05 4579.75 3.1 92 NCgl2659 cg3050 Acyltransferase 4.61/20172.76 0.00 790.25 1.5 93 NCgl0726 cg0868 secA Preprotein translocase subunit seca 5.01/95404.70 809.37 2279.75 NC 95 NCgl0336 cg0413 cmt1 Trehalose corynomycolyl transferase 4.56/39506.27 683.01 0.00 3.0 96 NCgl0888 cg1055 menG ribonuclease activity regulator protein RraA 4.53/17364.56...”

secA / CAA90577.1 SecA from Streptomyces lividans (see paper)
49% identity, 87% coverage

SAV_2565 preprotein translocase subunit SecA from Streptomyces avermitilis MA-4680
48% identity, 94% coverage

• Genomic data mining reveals a rich repertoire of transport proteins in Streptomyces
  Zhou, BMC genomics 2016 (no snippet)

SGR_4531 putative preprotein translocase SecA subunit from Streptomyces griseus subsp. griseus NBRC 13350
48% identity, 88% coverage

• Genomic data mining reveals a rich repertoire of transport proteins in Streptomyces
  Zhou, BMC genomics 2016 (no snippet)

P47994 Protein translocase subunit SecA from Staphylococcus carnosus (strain TM300)
45% identity, 98% coverage

• S-bacillithiolation protects conserved and essential proteins against hypochlorite stress in firmicutes bacteria
  Chi, Antioxidants & redox signaling 2013
  • “...synthetase 2 7.2 4.6 4.1 0.8 2.9 0.6 0.3 P47994 B9DJB3 B9DMV5 B9DMX6 B9DN38 AC-No. (Uniprot) Phosphoglycerate dehydrogenase B4AKF2 Tpx 0.8 0.8 2.5 0.9 30 0.8...”

SECA_BRAHW / C0QZS7 Protein translocase subunit SecA; EC 7.4.2.8 from Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) (see paper)
BHWA1_00872 preprotein translocase, SecA subunit from Brachyspira hyodysenteriae WA1
43% identity, 93% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  cofactor: Zn(2+) (May bind 1 zinc ion per subunit.)
  subunit: Monomer and homodimer. Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved.
• Genome sequence of the pathogenic intestinal spirochete brachyspira hyodysenteriae reveals adaptations to its lifestyle in the porcine large intestine
  Bellgard, PloS one 2009
  • “...environment. Purines may be imported via different subtypes of ATP/ADP translocases including yidC (BHWA1_01539), secA (BHWA1_00872), yajC (BHWA1_01380), secD (BHWA1_01381), secF homolog (BHWA1_01382), putative secE (BHWA1_02319) secY (BHWA1_02143) and secG (BHWA1_02635). Interconversion of pyrimidine nucleotides was feasible in B. hyodysenteriae due to the presence of deoxycytidine...”

SCAB_55371 preprotein translocase from Streptomyces scabiei 87.22
48% identity, 87% coverage

• Genomic data mining reveals a rich repertoire of transport proteins in Streptomyces
  Zhou, BMC genomics 2016 (no snippet)

SECA_BORBU / O07497 Protein translocase subunit SecA; EC 7.4.2.8 from Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) (Borrelia burgdorferi) (see paper)
BB0154 preprotein translocase subunit (secA) from Borrelia burgdorferi B31
44% identity, 100% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  cofactor: Zn(2+) (May bind 1 zinc ion per subunit.)
  subunit: Monomer and homodimer. Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved.
• Toll-like receptors 1 and 2 heterodimers alter Borrelia burgdorferi gene expression in mice and ticks
  Fikrig, The Journal of infectious diseases 2009
  • “...No prediction 5.20 bbr02 Hypothetical b Cytoplasm 3.40 bb0634 DNA metabolism b No prediction 1.50 bb0154 Protein and peptide trafficking b Cytoplasm/cytoplasmic membrane 1.50 bb0836 DNA metabolism b Cytoplasm 1.45 bb0803 Protein synthesis b No prediction 4.65 bb0694 Protein/peptide trafficking b Cytoplasm/cytoplasmic membrane 1.50 bb0355 Transcription...”
• Examination of the Borrelia burgdorferi transcriptome in Ixodes scapularis during feeding
  Narasimhan, Journal of bacteriology 2002
  • “...bb0420 bb0435-bb0436 bb0835-bb0838 bba11-bba15c bb0600-bb0603c bb0154 bb0374-bb0378 Central intermediary metabolism; hypothetical protein Oligopeptide ABC...”
• Spirochaetal lipoproteins and pathogenesis
  Haake, Microbiology (Reading, England) 2000

ML0779 putative preprotein translocase subunit from Mycobacterium leprae TN
P57996 Protein translocase subunit SecA 1 from Mycobacterium leprae (strain TN)
48% identity, 88% coverage

• Implications of high level pseudogene transcription in Mycobacterium leprae
  Williams, BMC genomics 2009
  • “...ML0665 (p) 800705801966 ML0679 814145814372 -22.57 ML0680 (p) 814992816275 ML0727c (p) 870011869612 -37.21 ML0728c 870918870028 ML0779 921772924544 -21.89 ML0780 (p) 924814925329 ML0928 10980531098337 -15.05 ML0929 (p) 10985871099186 1 Mycobacterium leprae TN, complete genome: . 2 G < -14 = intrinsic terminator using Genome Scanner for Terminators...”
• Two nonredundant SecA homologues function in mycobacteria
  Braunstein, Journal of bacteriology 2001
  • “...genitalium SecA a Accession no. Z95121 U66080 U66081 P57996 Z78020 AF287049 O32922 D17428 U21192 Q55357 BAB41941 BAB43747 P47847 AE005672 AE005672 P10408 P28366...”

STER_1705, STER_RS08335 preprotein translocase subunit SecA from Streptococcus thermophilus LMD-9
45% identity, 100% coverage

• Identification of Hanks-Type Kinase PknB-Specific Targets in the Streptococcus thermophilus Phosphoproteome
  Henry, Frontiers in microbiology 2019
  • “...Preprotein translocase YajC subunit YP_819755.1 WP_011225395.1 STER_0243 STER_RS01190 SecA Preprotein translocase SecA subunit YP_821044.1 WP_011681614.1 STER_1705 STER_RS08335 Lipid metabolism AccB Acetyl-CoA carboxylase, Biotin carboxyl carrier protein YP_819919.1 WP_011680783.1 STER_0435 STER_RS02130 Nucleotide metabolism and transport ParE DNA topoisomerase IV subunit B YP_820096.1 WP_011680910.1 STER_0633 STER_RS03105 PyrE Orotate...”
  • “...translocase YajC subunit YP_819755.1 WP_011225395.1 STER_0243 STER_RS01190 SecA Preprotein translocase SecA subunit YP_821044.1 WP_011681614.1 STER_1705 STER_RS08335 Lipid metabolism AccB Acetyl-CoA carboxylase, Biotin carboxyl carrier protein YP_819919.1 WP_011680783.1 STER_0435 STER_RS02130 Nucleotide metabolism and transport ParE DNA topoisomerase IV subunit B YP_820096.1 WP_011680910.1 STER_0633 STER_RS03105 PyrE Orotate phosphoribosyltransferase...”

P9WGP5 bacterial ABC-type protein transporter (EC 7.4.2.5) from Mycobacterium tuberculosis (see 2 papers)
TC 3.A.5.2.2 / P0A5Y8 Protein translocase subunit secA 1, component of The general secretory pathway. SecA1 is the housekeeping protein; SecA2 is the accessory protein, essential for normal physiology and virulence from Mycobacterium tuberculosis (see 3 papers)
Rv3240c translocase from Mycobacterium tuberculosis H37Rv
YP_177950 protein translocase subunit SecA from Mycobacterium tuberculosis H37Rv
48% identity, 87% coverage

• substrates: proteins
  tcdb comment: The functions of SecA2 have been reviewed (Bensing et al. 2013)
• Impact of the elderly lung mucosa on <i>Mycobacterium tuberculosis</i> transcriptional adaptation during infection of alveolar epithelial cells
  Olmo-Fontánez, Microbiology spectrum 2024
  • “...tag M.tb gene A i vs A E i vs E Product/function Sec secretion system Rv3240C secA1 0.5768 1.2521 Probable preprotein translocase SecA1 1 subunit/involved in protein export Rv1821 secA2 0.4800 0.1331 Possible preprotein translocase ATPase SecA2/involved in protein export Rv2587C secD 0.1348 0.0324 Probable protein-export...”
• The unfoldase ClpC1 of Mycobacterium tuberculosis regulates the expression of a distinct subset of proteins having intrinsically disordered termini
  Lunge, The Journal of biological chemistry 2020 (secret)
• Systematic Identification of Mycobacterium tuberculosis Effectors Reveals that BfrB Suppresses Innate Immunity
  He, Molecular & cellular proteomics : MCP 2017
  • “...In addition, there are 2 (Rv0462, Rv3339c) and 3 (Rv3240c, Rv0203 and Rv2164c) unique membrane or secreted proteins that interact with proteins from the THP-1...”
  • “...(Rv0462) (20, 55), SahH (Rv3248c) (22), Rv3655c (23), SecA1 (Rv3240c) (56), FadD13 (Rv3089) (57), BfrA (Rv1876) (41, 51) and BfrB (Rv3841) (41, 51, 58) are...”
• Use of whole-genome sequencing to distinguish relapse from reinfection in a completed tuberculosis clinical trial
  Witney, BMC medicine 2017
  • “...Rv0530 S 1315992 pks4 NS 1540497 Rv1367c CP, non-essential S 2788333 plsB2 033 NS 3618159 Rv3240c, secA1 Protein export, essential 036 S 923816 lysT NS 924229 Rvnt13, pheU tRNA NS 924234 Rvnt13, pheU tRNA S 924263 pheU NS 1476973 Rvnr03, rrf 5S rRNA Function assigned using...”
• Comparative Genome and Network Centrality Analysis to Identify Drug Targets of Mycobacterium tuberculosis H37Rv
  Melak, BioMed research international 2015
  • “...0.0479375 2GQ3; 3S9I; 3S9Z; 3SAD; 3SAZ; 3SB0 Rv0467 23928.854 0.00293969 53 0.0481574 1F61; 1F8I; 1F8M Rv3240c 22790.56 0.00369075 64 0.0481586 1NKT; 1NL3 Rv0216 20616.273 0.01939864 57 0.0482126 2BI0 Rv1611 17798.758 0.00289133 57 0.0481961 3QJA; 3T40; 3T44; 3T55; 3T78; 4FB7 Rv2773c 17351.877 0.00189925 52 0.0480259 1C3V; 1P9L;...”
• A complex regulatory network controlling intrinsic multidrug resistance in Mycobacterium smegmatis
  Bowman, Molecular microbiology 2014
  • “...ID M. tuberculosis ID Protein ID 4 MSMEG_0059 Rv3868 ATPase, AAA family protein 9 MSMEG_1881 Rv3240c preprotein translocase subunit SecA 10 MSMEG_6091 Rv3596c negative regulator of genetic competence ClpC/mecB 16, 17 MSMEG_0456 Rv0006 DNA gyrase subunit A 15 MSMEG_0005 Rv0005 DNA gyrase subunit B 30 MSMEG_1670...”
• The ins and outs of Mycobacterium tuberculosis protein export
  Ligon, Tuberculosis (Edinburgh, Scotland) 2012
  • “...E. coli growth a M. tuberculosis homolog Required for M. tuberculosis growth b SecA yes Rv3240c (SecA1) yes Rv1821 (SecA2) no * 45 SecY yes Rv0732 yes SecE yes Rv0638 yes SecG no Rv1440 no SecD no Rv2587c yes SecF no Rv2586c yes YajC no Rv2588c...”
• Protein-protein interaction networks suggest different targets have different propensities for triggering drug resistance
  Padiadpu, Systems and synthetic biology 2010
  • “...category, while CcdA (Rv0527), IniA (Rv0342) and SecA1 (Rv3240c) are examples of the second, third and fourth categories respectively. Previously, we had...”
  • “...(Rv2720), Rv0818 Genes implicated in HGT SecA1 (Rv3240c), SecA2 (Rv1821), Rv3659c, Rv3660c Cytochromes CcdA (Rv0527), CcsA (Rv0529), CtaB (Rv1451), CtaC...”
• More
• In Silico Drug Discovery Strategies Identified ADMET Properties of Decoquinate RMB041 and Its Potential Drug Targets against Mycobacterium tuberculosis
  Knoll, Microbiology spectrum 2022
  • “...Thr A:223, Val A:255, Asp A:257, Phe A:259, Ser A:281, Leu A:288 SecA1 (Rv3240) 1NKT P9WGP5 4.90 6.6 Gln A:80, Phe A:83, Gln A:86, Lys A:107, Leu A:109, Arg A:137, Trp A:141, Asp A:493, Asn A:499, Asp A:501, Arg A:573 GlnA1 (Rv2220) 2bvc P9WN39 4.71 6.5...”
• In Vitro Interaction of the Housekeeping SecA1 with the Accessory SecA2 Protein of Mycobacterium tuberculosis.
  Prabudiansyah, PloS one 2015
  • GeneRIF: The housekeeping protein SecA1 forms heterodimers with the accessory SecA2 protein of Mycobacterium tuberculosis in solution.
• Structural Similarities and Differences between Two Functionally Distinct SecA Proteins, Mycobacterium tuberculosis SecA1 and SecA2.
  Swanson, Journal of bacteriology 2015
  • GeneRIF: Many of the structural features of SecA1 are conserved in the SecA2 structure, including putative contacts with the SecYEG channel.
• ADP-dependent conformational changes distinguish Mycobacterium tuberculosis SecA2 from SecA1.
  D'Lima, The Journal of biological chemistry 2014
  • GeneRIF: conformational change involving closure of the clamp in SecA2 may provide a mechanism for the cell to direct protein export through the conventional SecA1 pathway under normal growth conditions
• ATPase activity of Mycobacterium tuberculosis SecA1 and SecA2 proteins and its importance for SecA2 function in macrophages.
  Hou, Journal of bacteriology 2008
  • GeneRIF: Here, M. tuberculosis SecA1 and SecA2 are shown to bind ATP with high affinity

PPA1333 preprotein translocase SecA subunit from Propionibacterium acnes KPA171202
48% identity, 90% coverage

• Comparative genomics and transcriptomics of Propionibacterium acnes
  Brzuszkiewicz, PloS one 2011
  • “...was more strongly expressed during the EP than the SP, in particular the components secA (PPA1333), secF (PPA1163) and ftsY (PPA1447) and also signal peptidase I (PPA1434). Previously, we identified secreted factors of P. acnes by a proteomic approach [26] . Strikingly, we found that not...”

SMU_1838 preprotein translocase subunit SecA from Streptococcus mutans UA159
Q8DSF0 Protein translocase subunit SecA from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
46% identity, 98% coverage

• Protein Interactomes of Streptococcus mutans YidC1 and YidC2 Membrane Protein Insertases Suggest SRP Pathway-Independent- and -Dependent Functions, Respectively
  Lara, mSphere 2021
  • “...initiation factor IF3 (SMU_697) Putative alanyl-tRNA synthetase (alanine-tRNA ligase) (SMU_650) Translocation Preprotein translocase subunit SecA (SMU_1838) Putative preprotein translocase SecY protein (SMU_2006) Putative secreted protein, preprotein translocase subunit YajC (SMU_1787c) Putative signal peptidase II (SMU_1661c) Chaperones/proteases Peptidyl-prolyl isomerase RopA (trigger factor) (SMU_91) Peptidyl-prolyl isomerase RopA (trigger...”
  • “...ribosomal protein L16 (SMU_2020) tRNA uridine 5-carboxymethylaminomethyl modification protein (SMU_2141) Translocation Preprotein translocase subunit SecA (SMU_1838) Preprotein translocase subunit YajC (SMU_1787c) DNA replication/repair DNA-directed RNA polymerase subunit beta' (SMU_1989) DNA repair protein RadA (SMU_327) Deoxyribonuclease HsdR DNA topoisomerase I (SMU_1002) DNA topoisomerase IV subunit B (SMU_1277)...”
• Pharmacoinformatics-Based Approach for Uncovering the Quorum-Quenching Activity of Phytocompounds against the Oral Pathogen, Streptococcus mutans
  Marimuthu, Molecules (Basel, Switzerland) 2023
  • “...response regulator CiaR Q8DSC7 LepC Signal peptidase I Q8DW23 OppC Putative transmembrane protein, permease OppC Q8DSF0 SecA Protein translocase subunit SecA Q8DSJ8 SMU1784c Putative Eep protein-like protein Q8DV49 SMU659 Putative response regulator SpaR Q8DSP8 YidC2 Membrane protein insertase YidC 2 molecules-28-05514-t008_Table 8 Table 8 List of...”

1nktA / P9WGP5 Crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis complex with adpbs (see paper)
48% identity, 91% coverage

• Ligand: adenosine-5'-diphosphate (1nktA)

SPD_1512 preprotein translocase, SecA subunit from Streptococcus pneumoniae D39
45% identity, 100% coverage

• The Rgg1518 transcriptional regulator is a necessary facet of sugar metabolism and virulence in Streptococcus pneumoniae
  Shlla, Molecular microbiology 2021
  • “...SPD_1053, SPD_1634, SPD_1342, SPD_1461, SPD_1127, SPD_0113, SPD_0122, SPD_0193, SPD_0197, SPD_0208, SPD_0126, SPD_0341, SPD_0378, SPD_0404 and SPD_1512. The genetic fragment containing the putative promoter sites of target genes were amplified using primers containing 5-FAM fluorescent tags ( STable 4 ), and the amplicons were purified using a...”
  • “...pathway, galactose catabolism SPD_1344-SPD_1349 2.042.88 acetyltransferase, GNAT family protein synthesis SPD_1473- SPD_1480 2.635.48 Cell division SPD_1512- SPD_1517 2.649.48 Membrane protein synthesis SPD_1667- SPD_1671 2.387.63 oligopeptide ABC transporter SPD_1683- SPD_1698 2.025.53 tRNA biosynthesis SPD_1726- SPD_1730 2.14.81 Pneumolysin/ hypothetical protein synthesis SPD_1985- SPD_1989 2.12.14 Mannose transport and metabolism...”

SP_1702 preprotein translocase subunit SecA from Streptococcus pneumoniae TIGR4
45% identity, 100% coverage

• The Streptococcus pneumoniae transcriptome in patient cerebrospinal fluid identifies novel virulence factors required for meningitis
  Wall, 2024

A3CLD3 bacterial ABC-type protein transporter (EC 7.4.2.5) from Streptococcus parasanguinis (see paper)
45% identity, 100% coverage

spr1544 Preprotein translocase secA subunit from Streptococcus pneumoniae R6
45% identity, 100% coverage

• Genomic characterization of ciprofloxacin resistance in a laboratory-derived mutant and a clinical isolate of Streptococcus pneumoniae
  Lupien, Antimicrobial agents and chemotherapy 2013
  • “...64 64 64 128 2 Mutation parC gyrA patAa,b patBc spr0335 spr1544 spr1902 WT C245T C245T C245T C245T C245T C245T WT WT G253A WT G253A G253A G253A G253A WT WT WT*...”
  • “...parent mutant (Table 2). These occurred upstream of spr1544 and within the coding regions of the 6-phosphogluconate dehydrogenase gene spr0335 and the...”

I872_01620 preprotein translocase subunit SecA from Streptococcus cristatus AS 1.3089
45% identity, 100% coverage

• Redox-Regulated Adaptation of Streptococcus oligofermentans to Hydrogen Peroxide Stress
  Tong, mSystems 2020
  • “...NVETCLAQPVLLR C318 100 0 100* 7 I872_00060 Hypoxanthine phosphoribosyltransferase NLCNLFK C112 100 0 100* 8 I872_01620 Protein translocase subunit SecA ELGGLCVIGTER C507 100 10 10 98 2* 9 I872_09640 Probable thiol peroxidase VLSIVPSIDTGVCSTQTR C58 100 0 36.5 3.5* 10 I872_03205 Thioredoxin family protein FWASWCGPCK b C82...”

SECA1_STRGN / Q9AET4 Protein translocase subunit SecA 1; EC 7.4.2.8 from Streptococcus gordonii (see paper)
Q9AET4 bacterial ABC-type protein transporter (EC 7.4.2.5) from Streptococcus gordonii (see paper)
45% identity, 98% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  cofactor: Zn(2+) (May bind 1 zinc ion per subunit.)
  subunit: Monomer and homodimer. Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved.
  disruption phenotype: Essential.

SGO_0415 preprotein translocase, SecA subunit from Streptococcus gordonii str. Challis substr. CH1
45% identity, 98% coverage

• Proteomics of Streptococcus gordonii within a model developing oral microbial community
  Hendrickson, BMC microbiology 2012
  • “...SgPg SGO_0006 0.2 0.5 0.1 0.3 0.1 0.4 SGO_0255 1.9 1.6 2.2 0.3 0.2 0.1 SGO_0415 1.1 1.0 1.2 0.1 0.1 0.1 SGO_1059 1.6 0.5 0.8 2.1 2.4 0.3 SGO_1060 1.6 0.2 1.3 1.4 0.4 1.0 SGO_1123 1.0 1.2 1.0 0.3 0.0 0.2 SGO_1216 1.4 1.8...”
  • “...they emerge from the ribosome and is necessary for efficient extracytoplasmic protein export. Both SecA, SGO_0415, the only detected sec protein, and SGO_0255, one of two detected signal peptidases, showed significant reduction in the mixed communities (Table 7 ). SGO_1338, the other detected signal peptidase, showed...”

M5005_Spy_1534 protein translocase subunit from Streptococcus pyogenes MGAS5005
44% identity, 100% coverage

• TrxR, a new CovR-repressed response regulator that activates the Mga virulence regulon in group A Streptococcus
  Leday, Infection and immunity 2008
  • “...Repression M5005_Spy_1408 M5005_Spy_1412 M5005_Spy_1298 M5005_Spy_1534 M5005_Spy_1417 M5005_Spy_0722 M5005_Spy_1139 M5005_Spy_1413 M5005_Spy_0552 M5005_Spy_0621...”

B5XI23 Protein translocase subunit SecA from Streptococcus pyogenes serotype M49 (strain NZ131)
44% identity, 100% coverage

• Dynamic Protein Phosphorylation in Streptococcus pyogenes during Growth, Stationary Phase, and Starvation
  Mikkat, Microorganisms 2024
  • “..., 44 , 45 , 46 , 49 , 50 , 52 , 53 ] B5XI23 Protein translocase subunit SecA T809 + + + + A0A0H3BXH0 Endolytic murein transglycosylase T122 + 3 + n.i. + A0A0H3C2P8 Uncharacterized protein Spy49_1748c T13 + + + + A0A0H3C0J7 Phosphocarrier...”

SAK_RS08555 preprotein translocase subunit SecA from Streptococcus agalactiae A909
46% identity, 98% coverage

• CsbD, a Novel Group B Streptococcal Stress Response Factor That Contributes to Bacterial Resistance against Environmental Bile Salts
  Jia, Journal of bacteriology 2023
  • “...11.54 10.22 11.61 36.77 39.99 37.35 SAK_RS04730 Phosphoenolpyruvate-protein phosphotransferase 8.45 12.97 10.77 33.26 35.05 33.91 SAK_RS08555 Asp23/Gls24 family envelope stress response protein 11.43 11.72 11.51 5.40 5.63 5.46 SAK_RS08310 Serine/threonine transporter SstT 11.05 11.32 11.12 27.60 29.63 27.60 SAK_RS03415 DNA-binding protein WhiA 10.64 7.93 10.72 17.68...”

ZY05719_08610 preprotein translocase subunit SecA from Streptococcus suis
SSU1615 preprotein SecA subunit from Streptococcus suis P1/7
44% identity, 100% coverage

• Establishment of Streptococcus suis Biofilm Infection Model In Vivo and Comparative Analysis of Gene Expression Profiles between In Vivo and In Vitro Biofilms
  Yi, Microbiology spectrum 2023
  • “...ZY05719_01030 AKG39619.1 Phosphotransferase system, galactitol-specific IIB component Protein transport ZY05719_02345 AKG39854.1 Sortase (surface protein transpeptidase) ZY05719_08610; secA AKG41039.1 Preprotein translocase subunit SecA Transmembrane transport ZY05719_02690 AKG39922.1 Amino acid ABC transporter permease ZY05719_02700 AKG39924.1 Glutamine ABC transporter substrate-binding protein Signal transduction ZY05719_06490 AKG40636.1 Signal transduction histidine kinase...”
• Identification of conditionally essential genes for Streptococcus suis infection in pigs
  Arenas, Virulence 2020
  • “...division protein FtsY 6.2 5.1 6.2 SSU1775 secE Preprotein translocase subunit SecE 3.4 2.1 3.7 SSU1615 secA Preprotein translocase subunit SecA 3.7 Membrane and secreted structures SSU1128 Surface anchored protein 3.9 SSU0375 Membrane protein 9.8 SSU0386 Membrane protein 7.9 6.8 8.6 SSU0473 Membrane protein 8.6 7.5...”

CD630_27920 preprotein translocase subunit SecA from Clostridioides difficile 630
Q183M9 Protein translocase subunit SecA 2 from Clostridioides difficile (strain 630)
CD2792 preprotein translocase SecA subunit from Clostridium difficile 630
46% identity, 90% coverage

• Systems biology analysis of the Clostridioides difficile core-genome contextualizes microenvironmental evolutionary pressures leading to genotypic and phenotypic divergence
  Norsigian, NPJ systems biology and applications 2020
  • “...regulator, GntR family 6 bp coding (192197/723 nt) CD630_12060 Putative membrane protein AT K120N (AAAAAT) CD630_27920 Protein translocase subunit secA 2 TA P669P (CCACCT) CD630_31840/CD630_31850 Diaminopropionate ammonia-lysase/Fragment of putative RNA-binding protein 9 bp Intergenic (393/+222) Table 2 Comparison of deletions detected across three C. difficile 630...”
• The Structure of Clostridioides difficile SecA2 ATPase Exposes Regions Responsible for Differential Target Recognition of the SecA1 and SecA2-Dependent Systems
  Lindič, International journal of molecular sciences 2020
  • “...4. Materials and Methods 4.1. CDSecA2 Protein Expression and Purification The gene encoding CDSecA2 (UniProt: Q183M9; KEGG ID: CD630 27920) was cloned into the pMCSG7 ligation-independent vector [ 60 ] and overexpressed in E. coli BL21 (DE3) cells. Cultures were grown in 2 L of ZYM-5052...”
• In-Depth Characterization of the Clostridioides difficile Phosphoproteome to Identify Ser/Thr Kinase Substrates
  Garcia-Garcia, Molecular & cellular proteomics : MCP 2022
  • “...DDGPQ T (1)HLAK T 46 CD2754 Diguanylate kinase signaling protein GLTDGL T (1)GVVTR T 360 CD2792 secA2 Protein translocase subunit SecA 2 TSSNEN T (1)AIESK T 573 CD3397 whiA Probable cell division protein WhiA IVNCE T (1)ANLSK T 236 CD3594 Uncharacterized protein NEELFR T (1)R T...”
• Clostridium difficile has two parallel and essential Sec secretion systems
  Fagan, The Journal of biological chemistry 2011
  • “...respectively, compared with 41 and 47% for SecA2 (CD2792) (supplemental Fig. S1). Furthermore, SecA2 is smaller than SecA1 (781 and 891 residues, respectively)...”

6t4hA / Q183M9 Crystal structure of the accessory translocation atpase, seca2, from clostridium difficile, in complex with adenosine-5'-(gamma-thio)- triphosphate (see paper)
47% identity, 89% coverage

• Ligand: phosphothiophosphoric acid-adenylate ester (6t4hA)

SEQ_0435 preprotein SecA subunit from Streptococcus equi subsp. equi 4047
43% identity, 100% coverage

• Differences in the Accessory Genomes and Methylomes of Strains of Streptococcus equi subsp. equi and of Streptococcus equi subsp. zooepidemicus Obtained from the Respiratory Tract of Horses from Texas
  Morris, Microbiology spectrum 2022
  • “...285357 m6A CTGCAG SEQ_0302 288740 m6A CTGCAG SEQ_0340 323013 m6A CTGCAG SEQ_0340 323016 m6A CTGCAG SEQ_0435 417164 m6A CTGCAG SEQ_0435 417167 m6A CTGCAG SEQ_0474 460537 m6A CTGCAG SEQ_0474 461395 m6A CTGCAG SEQ_0497 482852 m6A CTGCAG SEQ_0497 482855 m6A CTGCAG SEQ_0596 580039 m6A CTGCAG SEQ_0596 580042 m6A...”
  • “...in horses warrants further investigation. The quorum-sensing pathway was associated with 3 CDS (SEQ_1918, SEQ_2009, SEQ_0435). Quorum sensing has been described in S. pyogenes to play a role in establishing disease in the host and evading the hosts immune system ( 48 ) and was recently...”

A9WMN9 Protein translocase subunit SecA from Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
47% identity, 89% coverage

• Proteome analysis of the Gram-positive fish pathogen Renibacterium salmoninarum reveals putative role of membrane vesicles in virulence
  Kroniger, Scientific reports 2022
  • “...functions of R.salmoninarum . For example, proteins involved in protein transport (A9WP49; A9WP50; A9WSE1; A9WSE2; A9WMN9; A9WST8), glycine betaine transport (A9WPC5; A9WQW0; A9WPC8), amino acid transport (A9WRT5; A9WRT3), oligopeptide transport (A9WPA0; A9WPE4), iron and hemin transport (A9WSK5; A9WMV9; A9WRJ4; A9WRJ5) and other ABC transporters (A9WUM2; A9WM30;...”

B2RKT2 Protein translocase subunit SecA from Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
PGN_1458 preprotein translocase SecA subunit from Porphyromonas gingivalis ATCC 33277
39% identity, 82% coverage

• Proteomic analysis of endodontic infections by liquid chromatography-tandem mass spectrometry
  Nandakumar, Oral microbiology and immunology 2009
  • “...Paenibacillus sp. 8 Cell adhesion Q7MWV9 YngK protein ( 1 ) Porphyromonas gingivalis 2 Unknown B2RKT2 Preprotein translocase SecA subunit ( 1 ) P. gingivalis 3 Protein export Q7MUL8 TraG family protein ( 1 ) P. gingivalis 3 Conjugation Q6ABI3 Putative penicillin-binding protein ( 2 )...”
• Gingimaps: Protein Localization in the Oral Pathogen Porphyromonas gingivalis
  Gabarrini, Microbiology and molecular biology reviews : MMBR 2020 (secret)
• Comparison of inherently essential genes of Porphyromonas gingivalis identified in two transposon-sequencing libraries
  Hutcherson, Molecular oral microbiology 2016
  • “...secE (PGN_1577, PGTDC60_1503); secG (PGN_0258, PGTDC60_0422); secD/F (PGN_1702, PG1762, PGTDC60_1374); yajC (PGN_1485, PG0485, PGTDC60_1601); SecA (PGN_1458, PG0514, PGTDC60_1633); SRP54/ffh (PGN_1205, PG1115, PGTDC60_1100); ftsY (PGN_0264, PG0151, PGTDC60_0428). yidC (PGN_1446, PG0526, PGTDC60_1645) was found to be non-essential. The orthologues in P. gingivalis W83 and P. gingivalis TDC60, respectively,...”
• A two-component system regulates hemin acquisition in Porphyromonas gingivalis
  Scott, PloS one 2013
  • “...Putative ABC transporter permease protein x PGN_1432 Probable outer membrane efflux protein xxx x xx PGN_1458 Preprotein translocase subunit SecA x x x PGN_1518 Putative oligopeptide transporter xx xxx x PGN_1830 Putative TonB-dependent receptor x xx PGN_1953 TonB-dependent outer membrane receptor x Iron/virulence PGN_1058, bcp Bacterioferritin...”

PG0514 preprotein translocase subunit SecA from Porphyromonas gingivalis W83
39% identity, 82% coverage

• Gingimaps: Protein Localization in the Oral Pathogen Porphyromonas gingivalis
  Gabarrini, Microbiology and molecular biology reviews : MMBR 2020 (secret)
• Comparison of inherently essential genes of Porphyromonas gingivalis identified in two transposon-sequencing libraries
  Hutcherson, Molecular oral microbiology 2016
  • “...(PGN_1577, PGTDC60_1503); secG (PGN_0258, PGTDC60_0422); secD/F (PGN_1702, PG1762, PGTDC60_1374); yajC (PGN_1485, PG0485, PGTDC60_1601); SecA (PGN_1458, PG0514, PGTDC60_1633); SRP54/ffh (PGN_1205, PG1115, PGTDC60_1100); ftsY (PGN_0264, PG0151, PGTDC60_0428). yidC (PGN_1446, PG0526, PGTDC60_1645) was found to be non-essential. The orthologues in P. gingivalis W83 and P. gingivalis TDC60, respectively, are...”
• Protective role of the PG1036-PG1037-PG1038 operon in oxidative stress in Porphyromonas gingivalis W83
  Henry, PloS one 2013
  • “...oxidoreductase 60 kDa Energy metabolism; Electron transport Oxidoreductase activity; iron-sulfur cluster binding; Iron ion binding PG0514 Preprotein translocase subunit A 126 kDa Protein Fate; Protein and peptide secretion and trafficking Nucleic acid binding; Helicase activity; Protein binding; ATP binding PG0414 Conserved hypothetical protein 72 kDa Unknown;...”
• Porphyromonas gingivalis genes involved in community development with Streptococcus gordonii
  Simionato, Infection and immunity 2006
  • “...F R GAACTGTCAGCCGTCCGTATTG CCCTCTCTGCCACTGCTTCTG 168 PG0514 F R GATACCGCCGTCTACCAAAACC GCCGTTACCAGTCAGAGCATTG 192 PG0548 F R TCGCAGCCAATGTGAAGAACTC...”
  • “...PG0083 PG0104 PG0258 PG0273 PG0275 PG0432 PG0434 PG0491 PG0514 PG0548 PG0620 PG0665 PG0686 PG0699 PG0707 PG0788 PG0889 PG1017 PG1036 PG1116 PG1129 PG1321 PG1545...”
• Complete genome sequence of the oral pathogenic Bacterium porphyromonas gingivalis strain W83
  Nelson, Journal of bacteriology 2003
  • “...New identification Invasion PG0151 PG0293 PG0485 PG0514 PG1115 PG1598 PG1762 PG1918 PG2000 PG2001 Signal recognition particle-docking protein FtsY...”

SECA_THEMA / Q9X1R4 Protein translocase subunit SecA; EC 7.4.2.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
Q9X1R4 bacterial ABC-type protein transporter (EC 7.4.2.5) from Thermotoga maritima (see paper)
TM1578 preprotein translocase SecA subunit from Thermotoga maritima MSB8
45% identity, 89% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  subunit: Monomer and homodimer (By similarity). Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved. A single SecA monomer interacts with SecY in the channel.
• Evolution of mal ABC transporter operons in the Thermococcales and Thermotogales
  Noll, BMC evolutionary biology 2008
  • “...TM1201 TM1201 TM1201 TM1202 TM1202 TM1202 TM1202 TM1203 TM1203 TM1203 TM1203 TM1204 TM1204 TM1204 TM1204 TM1578 TM1205 TM1217 TM1205 TM0372 X TM1206 TM1218 TM1206 X TM1581 TM1207 TM1219 TM1207 TM0945 TM0009 TM1875 TM1208 TM1220 TM1208 TM1851 TM1581 TM1209 TM1221 TM1209 TM1836 TM1836 TM1203 TM1203 TM1204 TM1839...”

3dinA / Q9X1R4 Crystal structure of the protein-translocation complex formed by the secy channel and the seca atpase (see paper)
45% identity, 89% coverage

• Ligands: magnesium ion; adenosine-5'-diphosphate; beryllium trifluoride ion (3dinA)

lp_0739 preprotein translocase, SecA subunit from Lactobacillus plantarum WCFS1
46% identity, 91% coverage

• Selection and characterization of conditionally active promoters in Lactobacillus plantarum, using alanine racemase as a promoter probe
  Bron, Applied and environmental microbiology 2004
  • “...lp_3000 lp_3399 (cpd) lp_2793 lp_1512 (dnaB) lp_0739 (secA) lp_3363 (copB) lp_0542 lp_2608 Function of homologue(s) Phosphoribosylaminoimidazole carboxylase,...”

PGTDC60_1633 preprotein translocase subunit SecA from Porphyromonas gingivalis TDC60
39% identity, 82% coverage

• Gingimaps: Protein Localization in the Oral Pathogen Porphyromonas gingivalis
  Gabarrini, Microbiology and molecular biology reviews : MMBR 2020 (secret)
• Comparison of inherently essential genes of Porphyromonas gingivalis identified in two transposon-sequencing libraries
  Hutcherson, Molecular oral microbiology 2016
  • “...PGTDC60_1503); secG (PGN_0258, PGTDC60_0422); secD/F (PGN_1702, PG1762, PGTDC60_1374); yajC (PGN_1485, PG0485, PGTDC60_1601); SecA (PGN_1458, PG0514, PGTDC60_1633); SRP54/ffh (PGN_1205, PG1115, PGTDC60_1100); ftsY (PGN_0264, PG0151, PGTDC60_0428). yidC (PGN_1446, PG0526, PGTDC60_1645) was found to be non-essential. The orthologues in P. gingivalis W83 and P. gingivalis TDC60, respectively, are also...”

LGG_00899 preprotein translocase subunit SecA from Lacticaseibacillus rhamnosus GG
LGG_00899 preprotein translocase subunit SecA (ATPase, RNA helicase) from Lactobacillus rhamnosus GG
46% identity, 91% coverage

• Growth phase-associated changes in the proteome and transcriptome of Lactobacillus rhamnosus GG in industrial-type whey medium
  Laakso, Microbial biotechnology 2011
  • “...gph Hydrolase, haloacid dehalogenaselike family 116 1.8 0.495 LGG_00744 dkgA Aldo/keto reductase 117 1.6 0.71 LGG_00899 secA Protein translocase subunit secA 118 2.1 0.076 LGG_01265 mreB Rod shapedetermining protein MreB 119 1.6 0.331 LGG_01311 ykqC Metallobetalactamase superfamily protein 120 2 0.493 LGG_01327 typA GTPbinding protein TypA...”

APY09_05665 preprotein translocase subunit SecA from Schaalia odontolytica
46% identity, 87% coverage

• Ultrasmall epibiont <i>Nanosynbacter lyticus</i> strain TM7x and host bacteria transcriptional activity after initial host parasitism
  Hendrickson, Journal of oral microbiology 2024
  • “...preprotein translocase subunit yajC (APY09_08240), and secA , secD , s ecE , and secF (APY09_05665, APY09_08235, APY09_04705, APY09_08230). Taken together these implied a reduction in sec pathway export during recovery. In contrast to its host, TM7 COG intracellular trafficking and secretion trended upwards during recovery...”

5eulA / P28366 Structure of the seca-secy complex with a translocating polypeptide substrate (see paper)
46% identity, 88% coverage

• Ligands: adenosine-5'-diphosphate; hexatantalum dodecabromide (5eulA)

WS105_1073 preprotein translocase subunit SecA from Weissella ceti
45% identity, 89% coverage

• Comparative genome analysis of Weissella ceti, an emerging pathogen of farm-raised rainbow trout
  Figueiredo, BMC genomics 2015
  • “...genes are the canonical ones, i.e., the genes encoding the cytoplasmic preprotein translocase subunit SecA (WS105_1073) and the SecY/SecE/SecG protein-conducting pore proteins (WS105_1140, WS105_1121, and WS105_0197, respectively). In the absence of the SecA2SecY2 secretion system, the putative translocation of the proteins encoded by the sraP genes...”

RB11690 preprotein translocase subunit SecA from Rhodopirellula baltica SH 1
RB11690 preprotein translocase SecA subunit from Pirellula sp. 1
48% identity, 56% coverage

• Transcriptional response of the model planctomycete Rhodopirellula baltica SH1(T) to changing environmental conditions
  Wecker, BMC genomics 2009
  • “...cascade. R . baltica also showed an extracytoplasmic stress response. The gene coding for SecA (RB11690), belonging to the Sec system, was induced. This indicated an activation of protein translocation, most probably from the riboplasma to the paryphoplasm or medium. Proton channels were induced and motility...”

BA0882 preprotein translocase, SecA subunit from Bacillus anthracis str. Ames
BAS0838 preprotein translocase, SecA subunit from Bacillus anthracis str. Sterne
45% identity, 90% coverage

• Differential proteomic analysis of the Bacillus anthracis secretome: distinct plasmid and chromosome CO2-dependent cross talk mechanisms modulate extracellular proteolytic activities
  Chitlaru, Journal of bacteriology 2006
  • “...SecA gene were identified in the B. anthracis genome (BA0882 and BA5421 in the "Ames ancestor" genome) (147), suggesting that this bacterium has an alternative...”
• Secretion genes as determinants of Bacillus anthracis chain length
  Nguyen-Mau, Journal of bacteriology 2012
  • “...1B). Inverse PCR mapped the transposon insertions to BAS0838, a gene specifying a 788-residue polypeptide with homology (43% sequence identity) to the SecA...”
  • “...to be the secA homologue of B. anthracis and BAS0838 to be secA2, an accessory secretion gene whose function is required for the efficient secretion of the...”

2fshA / P10408 Complex seca:amp-pnp from escherichia coli (see paper)
67% identity, 51% coverage

• Ligand: phosphoaminophosphonic acid-adenylate ester (2fshA)

BpOF4_05800 preprotein translocase subunit SecA from Bacillus pseudofirmus OF4
43% identity, 89% coverage

• Genome of alkaliphilic Bacillus pseudofirmus OF4 reveals adaptations that support the ability to grow in an external pH range from 7.5 to 11.4
  Janto, Environmental microbiology 2011
  • “...for SCWP synthesis in B. anthracis ( Kern et al., 2010 ); and a SecA (BpOF4_05800) secretion protein. Another SCWP of B. pseudofirmus OF4 predicted by the genome sequence is a poly--glutamate capsule that is anchored in the cell wall ( Fig. 4 ). There are...”

BMMGA3_RS14655 accessory Sec system translocase SecA2 from Bacillus methanolicus MGA3
43% identity, 90% coverage

• Genomic and Transcriptomic Investigation of the Physiological Response of the Methylotroph Bacillus methanolicus to 5-Aminovalerate
  Haupka, Frontiers in microbiology 2021
  • “...(C to G) 3,002,923 AVA10 between BMMGA3_RS14650 (undecaprenyl/decaprenyl-phosphate alpha- N -acetylglucosaminyl L -phosphate transferase) and BMMGA3_RS14655 (accessory Sec system translocase SecA2) Substitution (T to G) Curiously, AVA10 contained an SNP in gene locus BMMGA3_RS03040 coding for a peptide major facilitator superfamily (MFS) transporter. The members of...”

GMI18_RS01115 preprotein translocase subunit SecA from Spiroplasma citri
42% identity, 89% coverage

• Genome analysis of Spiroplasma citri strains from different host plants and its leafhopper vectors
  Rattner, BMC genomics 2021
  • “...citri utilizes a sec-dependent protein export pathway. In S. citri LB 319, secY (GMI18_RS01645), secA (GMI18_RS01115), ftsY (GMI18_RS00765), ffh (GMI18_RS02240), secE (GMI18_RS01245), and yidC (GMI18_RS10485) are the genes involved in the sec-dependent pathway and are conserved across S. citri strains. Several sequences in plasmid pScp-C1891 were...”

YP_001999788 preprotein translocase subunit SecA from Mycoplasma arthritidis 158L3-1
43% identity, 88% coverage

• Proteomic analysis and qRT-PCR verification of temperature response to Arthrospira (Spirulina) platensis
  Huili, PloS one 2013
  • “...] Inorganic ion transport and metabolism 19.67/23.51 4.93/6.24 10 70% 81 8.50E-03 + 0.740.052 423 YP_001999788 ORF2422 Preprotein translocase subunit seca [ Mycoplasma arthritidis ] Intracellular trafficking and secretion 99.38/34.57 5.10/5.15 21 28% 76 2.60E-02 + 0.590.034 540 ZP_06381727 ORF2131 Beta-lactamase-like protein [ Arthrospira platensis ]...”
  • “...high homology with the Arthrospira platensis genus. However, the other 6 proteins (YP_002248469, YP_002485086, ZP_04040440, YP_001999788, YP_912068, ZP_05256482) had high homology with other prokaryotes, which belonged to Hermodesulfovibrio yellowstonii, Cyanothece sp. PCC 7425, Meiothermus ruber DSM 1279, Mycoplasma arthritidis, Chlorobium phaeobacteroides and Bacteroides , respectively. All...”

Q85G35 chloroplast protein-transporting ATPase (EC 7.4.2.4) from Cyanidioschyzon merolae (see paper)
48% identity, 70% coverage

MMCAP2_0095 preprotein translocase subunit SecA from Mycoplasma mycoides subsp. capri str. GM12
40% identity, 88% coverage

• Disruption of the S41 peptidase gene in mycoplasma mycoides capri impacts proteome profile, H(2)O(2) production, and sensitivity to heat shock
  Allam, PloS one 2012
  • “...GI:256383992 MMCAP2_0840 Nus G 100% Increase 1472 GI:256383992 MMCAP2_0840 Nus G 100% Increase 206 GI:256383767 MMCAP2_0095 SecA 100% Decrease 1844 GI:256384171 MMCAP2_0128 Hypothetical protein 99% Decrease 602 GI:256384387 MMCAP2_0061 SerinetRNA ligase 100% Increase 962 GI:256383734 MMCAP2_0766 Adenylosuccinate synthase 100% Decrease 1001 GI:256383985 MMCAP2_0606 Phosphoglycerate kinase 100%...”

Q8DHU4 Protein translocase subunit SecA from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
58% identity, 55% coverage

• Finding Species-Specific Extracellular Surface-Facing Proteomes in Toxic Dinoflagellates.
  Chan, Toxins 2021
  • “...Plasma membrane (GO:0005886) ATP synthesis coupled proton transport (GO:0015986) Cluster-6994.53837 20 ATCI03 1.8 10 138 (Q8DHU4) Protein translocase subunit SecA Plasma membrane (GO:0005886) Protein import (GO:0017038) Cluster-15238.31582 7 8.4 10 190 (P11024) NAD(P) transhydrogenase, mitochondrial Membrane (GO:0016020) Proton transmembrane transport (GO:1902600) Cluster-15238.36601 3 CCMP1937 0 (Q00610)...”

DMIN_01310 protein translocase subunit secA from Candidatus Sulcia muelleri DMIN
38% identity, 73% coverage

• One bacterial cell, one complete genome
  Woyke, PloS one 2010
  • “...metagenome, while we identified two SNPs in the host pool metagenome, in genes DMIN_00390 and DMIN_01310 ( Table 4 ), indicating that the genetic diversity of this spatially defined Sulcia population within its culture-maintained host is very low. 10.1371/journal.pone.0010314.t004 Table 4 Identified SNPs within the host...”
  • “...locus Sequence variation DMIN_00390 (3-isopropylmalate dehydratase, small subunit) Single cell genome TTTTTTCAAAAATTTC[ta]TTTTTTTTTT Metagenome (MH) TTTTTTCAAAAATTTC[ag]TTTTTTTTTT DMIN_01310 (protein translocase subunit secA) Single cell genome ATCAACTCTTT[a]CCCATATAA Metagenome (MH) ATCAACTCTTT[c]CCCATATAA Genomic variation is a function of the product of the mutation rate and the coalescence time of the sequenced...”

BP951000_0230 preprotein translocase subunit SecA from Brachyspira pilosicoli 95/1000
54% identity, 53% coverage

• The complete genome sequence of the pathogenic intestinal spirochete Brachyspira pilosicoli and comparison with other Brachyspira genomes
  Wanchanthuek, PloS one 2010
  • “...had genes for the Sec pathway and ABC-type transporters. Six sec genes were identified: secA (BP951000_0230), secY (BP951000_1006), secF (BP951000_1532), secD (BP951000_1533), secE (BP951000_1559) and secG (BP951000_1896), and there were 36 genes encoding ABC transporters (compared to 35 and 29 for B. hyodysenteriae and B. murdochii...”

SECA2_LISM4 / G2K3V6 Protein translocase subunit SecA 2; EC 7.4.2.8 from Listeria monocytogenes serotype 1/2a (strain 10403S) (see paper)
41% identity, 84% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  subunit: Monomer and homodimer. Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved.
  disruption phenotype: Cells show reduced secretion of autolysins p60 and MurA, as well as at least 7 other proteins, and are responsible for a smooth to rough phenotype change. These deletion mutants are not as virulent as wild-type when used in mouse infection tests. Large in- frame deletions of this gene reduce secretion of autolysins p60 and MurA, as well as at least 7 other proteins, and are responsible for a smooth to rough phenotype change. These deletion mutants are not as virulent as wild-type when used in mouse infection tests.

Q722W7 Protein translocase subunit SecA 2 from Listeria monocytogenes serotype 4b (strain F2365)
41% identity, 84% coverage

• Proteomic Exploration of Listeria monocytogenes for the Purpose of Vaccine Designing Using a Reverse Vaccinology Approach
  Srivastava, International journal of peptide research and therapeutics 2021
  • “...0.872 Non-allergen 66 Q724F0 0.73 Non-allergen 67 Q71WP3 1.021 Non-allergen 68 Q71WF9 1.887 Non-allergen 69 Q722W7 0.595 Non-allergen 70 Q71YH0 0.671 Non-allergen 71 Q71WB6 1.955 Non-allergen 72 Q71YB9 0.633 Non-allergen 73 Q71VR4 0.492 Non-allergen 74 Q71W89 1.05 Non-allergen 75 Q71W91 0.849 Non-allergen 76 Q721K3 0.808 Non-allergen...”
  • “...DRB1_0701 MKFLFPLKL 175.8 2.3447 Antigen DRB1_0701 VTLTLAIMV 181.1 1.2651 Antigen DRB1_1301 ICTRNLQRR 16.9 1.1843 Antigen Q722W7 DRB1_0101 WVMHLDAMV 1508.3 1.4715 Antigen DRB1_0701 IVYEVSWRY 223.4 1.2052 Antigen DRB1_0701 YHFYFAHAL 234.2 1.4315 Antigen DRB1_1301 LMGRSGRRG 11.8 1.4813 Antigen DRB1_1301 LRITMLLMR 26.9 1.1065 Antigen DRB1_1301 QLMGRSGRR 27.3 1.1831 Antigen...”

SECA2_LISMO / P0DJP3 Protein translocase subunit SecA 2; EC 7.4.2.8 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) (see paper)
lmo0583 similar to preprotein translocase SecA subunit from Listeria monocytogenes EGD-e
41% identity, 84% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  subunit: Monomer and homodimer. Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved.
  disruption phenotype: Knockout causes a smooth to rough phenotype transition; cells grow as filaments longer than 10 um in length with septa between cells but no indentations. Knockout also causes a smooth to rough phenotype transition; cells grow as filaments longer than 10 um in length with septa between cells but no indentations (PubMed:16321943).
• Virulence Potential and Antimicrobial Resistance of Listeria monocytogenes Isolates Obtained from Beef and Beef-Based Products Deciphered Using Whole-Genome Sequencing
  Manqele, Microorganisms 2024
  • “...Sec system SecY lmo2612 SecE lmo0245 SecG lmo2451 SecDF lmo152 YajC lmo1529 SecA lmo2510 SecA2 lmo0583 FtsY lmo1803 YlxM lmo1802 Ffh lmo1801 SpolllJ lmo2854 YqjG lmo1379 The Tat system TatA lmo0362 TatC lmo0361 Flagella Exporter FlhBA lmo0679-0680 FliO lmo0682 FliPQR lmo0676-0678 FliH lmo0715 Flil lmo0716 Fimbrial...”
• SecA2 Associates with Translating Ribosomes and Contributes to the Secretion of Potent IFN-β Inducing RNAs
  Teubner, International journal of molecular sciences 2022
  • “...underlined. Lmo Nr. Gene Name Protein Name Function (COGs) * emPAI * mol % * lmo0583 secA2 Protein translocase subunit SecA 2 Intracellular trafficking and secretion 5.81 6.75 lmo2632 rplC 50S ribosomal protein L3 Translation 4.75 4.69 lmo1934 hup DNA-binding protein HU Replication. recombination and repair...”
• Different Shades of Listeria monocytogenes: Strain, Serotype, and Lineage-Based Variability in Virulence and Stress Tolerance Profiles
  Muchaamba, Frontiers in microbiology 2021
  • “...lmo1379 YidC/Oxa1 family membrane protein insertase 1 SecA lmo2510 Preprotein translocase subunit SecA 3 SecA2 lmo0583 Protein-secreting ATPase 16 PrsA2 lmo2219 Secreted bacterial lipoprotein chaperone 7 Lsp lmo1844 Lipoprotein signal peptidase 3 LspB lmo1101 Lipoprotein signal peptidase Detected in EGDe only a A selection of L....”
• A systematic proteomic analysis of Listeria monocytogenes house-keeping protein secretion systems
  Halbedel, Molecular & cellular proteomics : MCP 2014
  • “...YqjG lmo2612 lmo0245 lmo2451 lmo1527 lmo1529 lmo2510 lmo0583 lmo1803 lmo1802 lmo1801 lmo2854 lmo1379 Sec substrates TatA TatC lmo0362 lmo0361 Folded substrates...”
• Subcellular localization of extracytoplasmic proteins in monoderm bacteria: rational secretomics-based strategy for genomic and proteomic analyses
  Renier, PloS one 2012
  • “...subunit YajC TC#9.B.18, COG1862, TIGR00739, PF02699 Lmo2510 Sec translocase, ATPase, SecA TC#3.A.5, COG0653, IPR000185, TIGR00963 Lmo0583 Sec translocase, ATPase, SecA2 TC#3.A.5.10, COG0653 Lmo1803 Signal recognition particle (SRP) receptor subunit, FtsY TC#3.A.5, COG0552, IPR004390, IPR000897, TIGR00064, SSF47364 Lmo1801 Signal recognition particle (SRP), Ffh TC#3.A.5, COG0541, IPR004780, TIGR00959,...”
• Genetic organization and molecular characterization of secA2 locus in Listeria species
  Mishra, Gene 2011 (PubMed)
  • “...and downstream by a putative membrane protein (lmo0583, lmo f2365_0613) in all analyzed Listeria species, demonstrating conserved genetic organization of the...”
  • “...3.2 Identification of intergenic sequences and downstream gene (lmo0583, lmo f2365_0613) linked to secA2 locus in Listeria 3.3 Identification and cloning of...”
• Simultaneous deficiency of both MurA and p60 proteins generates a rough phenotype in Listeria monocytogenes
  Machata, Journal of bacteriology 2005
  • “...Lmo2691 Lmof2365_2670 Lin2838 Lwe MurA 100 96 91 84 Lmo0583 Lmo2365_612 Lin0592 Lwe SecA2 100 99 97 98 Downloaded from http://jb.asm.org/ on February 11, 2017...”

Synpcc7942_0289 preprotein translocase, SecA subunit from Synechococcus elongatus PCC 7942
Q55357 Protein translocase subunit SecA from Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
56% identity, 54% coverage

• The Freshwater Cyanobacterium Synechococcus elongatus PCC 7942 Does Not Require an Active External Carbonic Anhydrase
  Kupriyanova, Plants (Basel, Switzerland) 2024
  • “...C T method. The data were normalized to the transcript levels of the secA (CyanoBase, Synpcc7942_0289), petB (Synpcc7942_2331), ilvD (Synpcc7942_0626), and ppc (Synpcc7942_2252) genes, which were pre-selected as maintaining expression stability (change in transcript level less than two-fold) under the experimental conditions used. Semi-quantitative RT-PCR was...”
• The stringent response regulates adaptation to darkness in the cyanobacterium Synechococcus elongatus
  Hood, Proceedings of the National Academy of Sciences of the United States of America 2016
  • “...formation. Three candidate reference genes, secA (Synpcc7942_0289), rimM (Synpcc7942_2259), and rnpA (Synpcc7942_1615), were selected for normalization based on...”
• Two nonredundant SecA homologues function in mycobacteria
  Braunstein, Journal of bacteriology 2001
  • “...U66081 P57996 Z78020 AF287049 O32922 D17428 U21192 Q55357 BAB41941 BAB43747 P47847 AE005672 AE005672 P10408 P28366 Q41062 P38380 AF116183 U32772 AAF41891 O25475...”

alr4851 preprotein translocase SecA subunit from Nostoc sp. PCC 7120
56% identity, 55% coverage

• Cell surface-associated proteins in the filamentous cyanobacterium Anabaena sp. strain PCC 7120
  Yoshimura, Microbes and environments 2012
  • “...the subunits of Sec and Tat pathways are annotated in CyanoBase. The former ORFs are alr4851 to secA , all0121 to secD , asr5298 to secE , all0120 to secF , asl4181 to secG and all4197 to secY . The latter ORFs are asr3878 to tatA/E...”

lin0592 similar to preprotein translocase SecA subunit from Listeria innocua Clip11262
41% identity, 85% coverage

• Simultaneous deficiency of both MurA and p60 proteins generates a rough phenotype in Listeria monocytogenes
  Machata, Journal of bacteriology 2005
  • “...Lin2838 Lwe MurA 100 96 91 84 Lmo0583 Lmo2365_612 Lin0592 Lwe SecA2 100 99 97 98 Downloaded from http://jb.asm.org/ on February 11, 2017 by University of...”

sll0616 preprotein translocase SecA subunit from Synechocystis sp. PCC 6803
53% identity, 55% coverage

• Identification of the direct regulon of NtcA during early acclimation to nitrogen starvation in the cyanobacterium Synechocystis sp. PCC 6803
  Giner-Lamia, Nucleic acids research 2017
  • “...820281 promoter 0.399 transketolase 820067 N sll1049 90302 90801 promoter 0.399 hypothetical protein 90594c N sll0616 secA 2648652 2648801 intragenic 0.671 preprotein translocase SecA subunit N sll1536 moeB 2041452 2041601 promoter 0.707 molybdopterin biosynthesis MoeB protein 2041560 NH 4 sll0413 2544264 2545469 intragenic 0.802 hypothetical protein...”
• Identification and Roles of Photosystem II Assembly, Stability, and Repair Factors in Arabidopsis
  Lu, Frontiers in plant science 2016
  • “...2007 ; Schunemann, 2007 ; Cline and Dabney-Smith, 2008 ; Walter et al., 2015 cpSecA1 sll0616 At4g01800 117 111 CS, TM Thylakoid protein targeting: cpSec translocase Insertion and assembly of PSII proteins such as PsbO Cline and Theg, 2007 ; Schunemann, 2007 ; Cline and Dabney-Smith,...”
• The proteome and lipidome of Synechocystis sp. PCC 6803 cells grown under light-activated heterotrophic conditions
  Plohnke, Molecular & cellular proteomics : MCP 2015
  • “...1.4 1.2 0.9 18.4 1.0 Membrane translocation sll0616 sll1814 ssl3335 slr1471 Preprotein translocase SecA Preprotein translocase SecY Preprotein translocase SecE...”
  • “...amount of the Sec translocase subunits SecA (Sll0616), SecY (Sll1814), and SecE (Ssl3335) was significantly reduced under LAHG conditions. Furthermore, besides...”
• Integrated OMICS guided engineering of biofuel butanol-tolerance in photosynthetic Synechocystis sp. PCC 6803
  Zhu, Biotechnology for biofuels 2013
  • “...slr2047 2.06 1.65 1.62 Phosphate starvation-inducible protein ssl2250 6.00 2.00 5.00 Bacterioferritin-associated ferredoxin Protein fate sll0616 4.19 1.88 3.54 Preprotein translocase SecA subunit sll0716 3.50 3.00 1.83 Probable signal peptidase I-1 slr0835 1.87 2.17 6.92 MoxR protein homolog slr0994 2.22 1.62 2.30 Octanoyltransferase slr1046 1.86 1.75...”
  • “...were up-regulated by butanol. Trnascriptomic analysis showed that ssr3307 encoding a preprotein translocase SecG subunit, sll0616 encoding a preprotein translocase SecA subunit and slr1046 encoding a putative TatA protein, were up-regulated by butanol. Genes slr1046 and slr1047 were organized in the same operon. The results confirmed...”
• Comparative analysis of chloroplast genomes: functional annotation, genome-based phylogeny, and deduced evolutionary patterns
  De, Genome research 2002
  • “...0.1306 sal3436 rpl29 0.1306 sal3445 rpl31 0.1306 sll0616 secA 0.1306 sll0194 ycf43 0.1306 slr2087 ycf44 Genome Research www.genome.org Profile Protein function...”
• Highly expressed and alien genes of the Synechocystis genome
  Mrázek, Nucleic acids research 2001
  • “...[0.79] 427 Processing protease Assembly and export sll0616 1.10 931 Preprotein translocase subunit (secA) slr0774 [0.89] 471 Protein export membrane protein...”

SYNPCC7002_A1259 preprotein translocase, SecA subunit from Synechococcus sp. PCC 7002
54% identity, 55% coverage

• The response of Synechococcus sp. PCC 7002 to micro-/nano polyethylene particles - Investigation of a key anthropogenic stressor
  Machado, PloS one 2020
  • “...protein: synthesis and modification SYNPCC7002_A1245 GATCGCCCCGAACTCGAAGC TTCTGGTTGGCATCGGTGACTTC secA Part of the Sec protein translocase complex SYNPCC7002_A1259 GCCGAAATGAGAACCGGGGAAG GAAACGGTGTACCTGCCCCATC rbcL Biological Process: carbon utilization by fixation of carbon dioxide SYNPCC7002_A1798 GTGCATGATGATGGGAGTGCGA CTACAAGGGTCGTTGCTA Esterase (Est) Esterase/lipase SYNPCC7002_G0018 TCCCCCCAAACTTGAACC CGCACCCTCTATCTCCAC serine esterase (SerEst) hydrolase activity SYNPCC7002_A2540 CCCTGAAAATCTTCCCGTTCC ATTTGCCAACTGCCCACC caspase...”

SECA1_ARATH / Q9SYI0 Protein translocase subunit SECA1, chloroplastic; AtcpSecA; Protein ALBINO OR GLASSY YELLOW 1; EC 7.4.2.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT4G01800 preprotein translocase secA subunit, putative from Arabidopsis thaliana
54% identity, 50% coverage

• function: Has a central role in coupling the hydrolysis of ATP to the transfer of proteins across the thylakoid membrane. Involved in photosynthetic acclimation and required for chloroplast biogenesis.
  catalytic activity: ATP + H2O + chloroplast-proteinSide 1 = ADP + phosphate + chloroplast-proteinSide 2.
  subunit: Part of the Sec protein translocation apparatus. Interacts probably with SCY1
  disruption phenotype: Seedling lethal. Albino seedlings with yellow and translucent (glassy) lateral organs when grown heterotrophically.
• Yellow barley xan-m mutants are deficient in the motor unit SECA1 of the SEC1 translocase system
  Stuart, Planta 2025 (no snippet)
• Defining the heterogeneous composition of Arabidopsis thylakoid membrane
  Trotta, The Plant journal : for cell and molecular biology 2025 (no snippet)
• Light Quality Modulates Plant Cold Response and Freezing Tolerance
  Kameniarová, Frontiers in plant science 2022
  • “...), calcium-sensing receptor CaS (AT5G23060; Huang et al., 2012 ), and protein translocase subunit SECA1 (AT4G01800; Skalitzky et al., 2011 ). An increase in abundance was found also for a protein required for chlorophyll accumulation under normal growth conditions (GUN4, AT3G59400; Larkin et al., 2003 ),...”
• artMAP: A user-friendly tool for mapping ethyl methanesulfonate-induced mutations in Arabidopsis
  Javorka, Plant direct 2019
  • “...SIMPLE Mapped by artMAP 300 AT3G13870 Ser584Phe + + 3004 AT3G13870 Ser584Phe + + 3007 AT4G01800 Arg752* + + EMS608 AT5G24630 Gly324Glu + + EMS633 AT3G54660 Ala264Thr + + John Wiley & Sons, Ltd 3 Experimental procedure The biggest challenge in creating artMAP was integration of...”
• Natural variation among Arabidopsis thaliana accessions in tolerance to high magnesium supply
  Niu, Scientific reports 2018
  • “...under the normal Mg 2+ , had a MAF of 0.079 and was located within AT4G01800 ALBINO OR GLASSY YELLOW 1 ( AGY1 ) gene which was co-expressed with MAGNESIUM CHELATASE I2 (CHLI2) while CHLI2 regulates the function of Mg 2+ chelatase 48 . It should...”
• Consideration of non-canonical splice sites improves gene prediction on the Arabidopsis thaliana Niederzenz-1 genome sequence
  Pucker, BMC research notes 2017
  • “...) TCGGGTTCATCAATCGAGCATCC 23 Reverse 61 S017 At1g79350 ( FGT1 ) AAGAACAGGTAGTTTCTCCTGCTCC 25 Reverse 60 S003 At4g01800 ( AGY1 ) ACTGGTGAAGGGAAAACGCTTG 22 Forward 59 S004 At4g01800 ( AGY1 ) AATGTATATCCCGCTCAAAGGCTG 24 Reverse 59 S005 At4g01800 ( AGY1 ) TCTTCTGCTTTTCATCAACAGTGTAATG 28 Reverse 58 S018 At4g27500 ( PPI1 )...”
  • “...in the Col-0 nucleome within the Araport11 annotation, as well as the first transcripts of At4g01800 and At3g10350, were mapped to the Nd-1 genome sequence via BLAT [ 43 ]. Perl scripts provided in the AUGUSTUS package filterPSL.pl and blat2hints.pl ( http://bioinf.uni-greifswald.de/augustus/binaries/scripts/ ) were used to...”
• Identification and Roles of Photosystem II Assembly, Stability, and Repair Factors in Arabidopsis
  Lu, Frontiers in plant science 2016
  • “...; Schunemann, 2007 ; Cline and Dabney-Smith, 2008 ; Walter et al., 2015 cpSecA1 sll0616 At4g01800 117 111 CS, TM Thylakoid protein targeting: cpSec translocase Insertion and assembly of PSII proteins such as PsbO Cline and Theg, 2007 ; Schunemann, 2007 ; Cline and Dabney-Smith, 2008...”
• Transcriptional profiling unravels potential metabolic activities of the olive leaf non-glandular trichome
  Koudounas, Frontiers in plant science 2015
  • “...al., 2009 ). Finally, a unigene similar to Arabidopsis AGY1 (Albino or Glassy Yellow 1, At4g01800), which encodes a subunit of the translocase subunit secA, was identified. Loss of AGY1 function leads to decreased branching of Arabidopsis trichome. Transcriptional analysis employing the -glucuronidase ( GUS )...”
• More
• Proteome and Interactome Linked to Metabolism, Genetic Information Processing, and Abiotic Stress in Gametophytes of Two Woodferns
  Ojosnegros, International journal of molecular sciences 2023
  • “...Q9SKQ0 CYP19-2 PEPTIDYL-PROLYL CIS-TRANS ISOMERASE CYP19-2 21.6 27 5 24 2.24 10 90 Sorting 19573-562_5_ORF2 Q9SYI0 SECA1 PROTEIN TRANSLOCASE SUBUNIT SECA1 115.7 2 1 2 0 Sorting 146969-201_2_ORF1 F4JL11 IMPA2 IMPORTIN SUBUNIT ALPHA-2 59.1 5 0 2 6 10 61 Sorting 151836-193_1_ORF2 P40941 AAC2 ADP, ATP...”

A0A1P8B485 Protein translocase subunit SecA from Arabidopsis thaliana
54% identity, 50% coverage

• Disclosing proteins in the leaves of cork oak plants associated with the immune response to Phytophthora cinnamomi inoculation in the roots: A long-term proteomics approach
  Coelho, PloS one 2021
  • “...0.110 0.026 -0.6 Beta-galactosidase 1 BGAL1 F4JYM8 0.543 0.294 0.026 -0.6 Thiolase family protein F4JYM8 A0A1P8B485 0.402 0.257 0.015 -0.6 Protein translocase subunit SecA A0A1P8B485 P25697 8.890 6.489 0.015 -0.6 Phosphoribulokinase, chloroplastic KPPR/PRK Q9LRR9 1.487 0.662 0.002 -0.6 (S)-2-hydroxy-acid oxidase GLO1 GLO1/GOX1 B3H4S6 0.434 0.300 0.041...”

SECA_PEA / Q41062 Protein translocase subunit SecA, chloroplastic; EC 7.4.2.4 from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see 3 papers)
55% identity, 50% coverage

• function: Has a central role in coupling the hydrolysis of ATP to the transfer of proteins across the thylakoid membrane (PubMed:7758587, PubMed:7989297, PubMed:9342223). Facilitates the transport of precursor proteins from the chloroplast stroma to thylakoid lumen (PubMed:7758587, PubMed:7989297, PubMed:9342223).
  catalytic activity: ATP + H2O + chloroplast-proteinSide 1 = ADP + phosphate + chloroplast-proteinSide 2.
• Two nonredundant SecA homologues function in mycobacteria
  Braunstein, Journal of bacteriology 2001
  • “...BAB41941 BAB43747 P47847 AE005672 AE005672 P10408 P28366 Q41062 P38380 AF116183 U32772 AAF41891 O25475 QO1570 OO7497 P47318 % Similarity to M. tuberculosisa...”

SECA2_STRPN / Q97P83 Protein translocase subunit SecA 2; EC 7.4.2.8 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see 3 papers)
SP_RS08710 accessory Sec system translocase SecA2 from Streptococcus pneumoniae TIGR4
SP_1759 preprotein translocase subunit SecA from Streptococcus pneumoniae TIGR4
39% identity, 88% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane. Plays a role in export of a number of proteins from the cell including glycosylated PsrP and pneumolysin (ply) (PubMed:28456649).
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  subunit: Monomer and homodimer. Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved.
  disruption phenotype: A single gene deletion has about 60% decreased biofilm formation, 75% decreased adherence to human lung pneumocytes. Has higher pneumolysin (ply) i.e. hemolytic activity in the cytoplasm but less in the cell wall. Decreased levels of a number of cell wall and secreted proteins (PubMed:28456649). Deletion of 15 genes (from psrP, SP_1772 to SP_1756, includes the accessory Sec export proteins SecA2 and SecY2) and infection of female BALB/cJ mice, shows the psrP- secY2A2 region is required for lung infection and for infection to progress to blood. Mice infected intraperitoneally showed wild-type infection. Decreased adherence to lung but not pharynx or brain cells. The psrP-secY2A2 region deletion has no effect on bacterial growth rate, capsule levels, autolysis, or transformation (PubMed:18507531). In vitro significantly decreased biofilm formation is seen; the large deletion mutant (SP_1772 to SP_1756) is no more affected than the single psrP deletion (PubMed:20714350).
• The accessory Sec system (SecY2A2) in Streptococcus pneumoniae is involved in export of pneumolysin toxin, adhesion and biofilm formation
  Bandara, Microbes and infection 2017
  • “...asp1 (SP_1762), asp2 (SP_1761), asp3 (SP_1760), asp4 (SP_1756), asp5 (SP_1755); secY2 (SP_1763) and secA2 (SP_1759, SP_RS08710). *gene contains a frame shift mutation. Fig.1 To determine if Ply export was mediated or modulated by the SecY2A2 system in S. pneumoniae , the translocon function was inactivated by...”
• Pan-genome study underlining the extent of genomic variation of invasiveStreptococcus pneumoniaein Malawi
  Iranzadeh, 2023
• Prediction and Validation of Immunogenic Domains of Pneumococcal Proteins Recognized by Human CD4⁺ T Cells
  van, Infection and immunity 2019
  • “...47 SP_0348 TIGR4 CpsC 230 Capsular polysaccharide biosynthesis protein Cell membrane 114 18.68 2.68 36 SP_1759 TIGR4 SecA-2 790 Preprotein translocase, SecA subunit Cell membrane, cytoplasm 395 18.25 1.09 36 SP_0770 TIGR4 513 ABC transporter, ATP-binding protein Unknown 254 18.14 1.98 36 SP_1732 TIGR4 StkP 659...”
• The accessory Sec system (SecY2A2) in Streptococcus pneumoniae is involved in export of pneumolysin toxin, adhesion and biofilm formation
  Bandara, Microbes and infection 2017
  • “...proteins asp1 (SP_1762), asp2 (SP_1761), asp3 (SP_1760), asp4 (SP_1756), asp5 (SP_1755); secY2 (SP_1763) and secA2 (SP_1759, SP_RS08710). *gene contains a frame shift mutation. Fig.1 To determine if Ply export was mediated or modulated by the SecY2A2 system in S. pneumoniae , the translocon function was inactivated...”

SSA_0836 SecA-like protein, putative from Streptococcus sanguinis SK36
39% identity, 89% coverage

• Transcriptome, Phenotypic, and Virulence Analysis of Streptococcus sanguinis SK36 Wild Type and Its CcpA-Null Derivative (ΔCcpA)
  Bai, Frontiers in cellular and infection microbiology 2019
  • “...0.00001 c184_g324 c SSA_1098 a 196.99 699.14 1.69 0.00002 c184_g290 b , c , m SSA_0836 85.66 253.80 1.21 0.00002 c185_g121 b , m SSA_0637 43.18 200.86 1.63 0.00003 c184_g170 b , c , m SSA_0072 a 32.86 179.23 1.71 0.00003 c185_g32 b , c ,...”

G7IBQ7 Protein translocase subunit SecA from Medicago truncatula
54% identity, 50% coverage

• Label-free quantitative proteomic analysis of alfalfa in response to microRNA156 under high temperature
  Arshad, BMC genomics 2020
  • “...adenylyltransferase Q45FF2 MTR_2g017520 1.29 0.0080 Q45FF2_MEDTR Pyridoxal 5-phosphate synthase A2Q5N9 MTR_7g085490 1.29 0.0155 Galactose mutarotase-like G7IBQ7 MTR_1g086050 1.31 0.0429 Protein translocase subunit SecA G7K882 MTR_5g027530 1.31 0.0080 Phosphoribulokinase Q84UC1 MTR_2g021255 1.32 0.0274 Glutamine synthetase A0A072V8Q4 MTR_2g046710 1.32 0.0144 S-adenosylmethionine synthase G7IED1 MTR_1g072260 1.36 0.0221 Putative NAD(P)-binding...”

MPN210 preprotein translocase SecA from Mycoplasma pneumoniae M129
39% identity, 83% coverage

• Heterologous protein exposure and secretion optimization in Mycoplasma pneumoniae
  Ana, Microbial cell factories 2024
  • “...signal peptidase [ 26 , 29 ]. Mpn contains a fully functional Sec complex machinery (mpn210 SecA, mpn396 SecD, mpn068 SecE, mpn242 SecG, mpn184 SecY), the SRP protein (mpn061) and the protein translocase to insert membrane proteins (mpn680, YidC) [ 30 ] but no SPase I...”
• Protein quality control and regulated proteolysis in the genome-reduced organism Mycoplasma pneumoniae
  Burgos, Molecular systems biology 2020
  • “...MPN396 (SecD). Secreted and membraneassociated proteins containing signal peptides are delivered to the membrane by MPN210 (SecA) or cotranslationally through the signal recognition particle MPN061 (SRP). All intracellular proteases and peptidases encoded in M.pneumoniae are also represented with their main functions. These include MPN671 (FtsH) and...”
• Re-annotating the Mycoplasma pneumoniae genome sequence: adding value, function and reading frames
  Dandekar, Nucleic acids research 2000
  • “...PID:g1674366 VXpSPT7_orf184 MPN479 361.0 PID:g1674040 P01_orf197 MPN210 622.0 PID:g1674324 G07_orf808 MPN482 358.0-359.0 hypothetical 64 aa MPN223 609.0...”

SECA2_STRGN / Q9AET6 Protein translocase subunit SecA 2; EC 7.4.2.8 from Streptococcus gordonii (see 2 papers)
Q9AET6 bacterial ABC-type protein transporter (EC 7.4.2.5) from Streptococcus gordonii (see paper)
TC 3.A.5.10.1 / Q9AET6 SecA2, component of The GspB-specific secretory system (accessory Sec system for export of the 286 kDa cell wall-anchored platelet-binding adhesin, GspB) (Bensing and Sullam, 2002; Bensing et al., 2004; Takamatsu et al., 2004, 2005). These extra Sec systems are found in species of Streptococcus, Mycobacterium, and Listeria (Rigel and Braunstein, 2008). A region of approximately 20 residues from the amino-terminal end of mature GspB (the accessory Sec transport or AST domain) is essential, possibly as an α-helix, for SecA2/Y2-dependent transport. This AST domain may be essential, both for targeting to the SecA2/Y2 translocase, and for initiating translocation through the SecY2 channel from Streptococcus gordonii (see 4 papers)
38% identity, 89% coverage

• function: Part of the accessory SecA2/SecY2 system specifically required to export GspB, a serine-rich repeat cell wall protein encoded upstream in the same operon.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  subunit: Monomer and homodimer (Potential). Part of the accessory SecA2/SecY2 protein translocation apparatus required to export cell wall protein GspB.
  disruption phenotype: Loss of export of cell wall protein GspB; glycosylated GspB accumulates in the cytoplasm.
• substrates: Adhesin, GspB
  tcdb comment: The functions of SecA2 have been reviewed (Bensing et al. 2013)

P47318 Protein translocase subunit SecA from Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
38% identity, 86% coverage

• Potential therapeutic targets for combating Mycoplasma genitalium
  Barik, 3 Biotech 2023
  • “...Replication P47299 Protein translocase subunit SecA P47318 Acyl carrier protein homolog P47529 Phosphate acyltransferase Q49427 Processive diacylglycerol...”
• Subtractive Genomics Approach for Identification of Novel Therapeutic Drug Targets in Mycoplasma genitalium
  Fatoba, Pathogens (Basel, Switzerland) 2021
  • “...Phosphomannomutase K01840 mge00541-O-Antigen-nucleotide-sugar-biosynthesis, mge01110-Biosynthesis-of-secondary-metabolites P47301 Uncharacterised protein K03073 mge02024-Quorum-sensing, mge03070-Bacterial-secretion-system P47315 PTS system K20118 mge02060-Phosphotransferase-system-(PTS) P47318 Protein translocase subunit K03070 mge02024-Quorum-sensing, mge03070-Bacterial-secretion-system P47323 Oligopeptide transport system permease protein K15581 mge02024-Quorum-sensing P47324 Oligopeptide transport system permease protein K15582 mge02024-Quorum-sensing P47357 Glucose-6-phosphate isomerase K01810 mge01110-Biosynthesis-of-secondary-metabolites, mge01120-Microbial-metabolism-in-diverse-environments P47391 Bifunctional...”
  • “...component system No P47299 Phosphomannomutase Cytoplasmic mge01110-Biosynthesis of secondary metabolites No mge00541-O-Antigen nucleotide sugar biosynthesis P47318 Protein translocase subunit Cytoplasmic mge02024-Quorum-sensing No mge03070-Bacterial secretion system P47529 Acyl carrier protein homolog Cytoplasmic mge01110-Biosynthesis of secondary metabolites No P47612 Probable tRNA sulfurtransferase Cytoplasmic mge04122-Sulfur relay system No Q49427...”
• Two nonredundant SecA homologues function in mycobacteria
  Braunstein, Journal of bacteriology 2001
  • “...P28366 Q41062 P38380 AF116183 U32772 AAF41891 O25475 QO1570 OO7497 P47318 % Similarity to M. tuberculosisa SecA1 SecA2 100.0 98.6 88.0 90.4 50.2 50.2 50.1 74.9...”

BT4362 preprotein translocase SecA subunit from Bacteroides thetaiotaomicron VPI-5482
41% identity, 64% coverage

• Competitive metagenomic DNA hybridization identifies host-specific microbial genetic markers in cow fecal samples
  Shanks, Applied and environmental microbiology 2006
  • “...synthetase (BT2933), a preprotein translocase (SecA subunit, BT4362), a reticulocyte binding protein (BT0749), and a conserved hypothetical protein BT0921 (39)....”

gbs1518 Unknown from Streptococcus agalactiae NEM316
38% identity, 89% coverage

• Role of pilus proteins in adherence and invasion of Streptococcus agalactiae to the lung and cervical epithelial cells
  Sharma, The Journal of biological chemistry 2013
  • “...(GBS67). Additionally, we have also selected pilus protein GBS1518 related to PI-2b. Further studies were carried out with these selected pilus proteins to...”
  • “...showed a laddering pattern expression for the GBS80 and GBS1518. Our data reveal that expression of GBS80, GBS67, and SAN1518 does not differ in geographically...”
• Molecular dissection of the secA2 locus of group B Streptococcus reveals that glycosylation of the Srr1 LPXTG protein is required for full virulence
  Mistou, Journal of bacteriology 2009
  • “...(O1-O2; O3-O4), gbs1529 (srr1) (O5-O6; O7-O8), and gbs1518 (secA2) (O13-O14; O15-O16) and in the glycosyltransferase-encoding genes gbs1523 to gbs1528 (gtfC to...”

SECA_THET8 / Q5SIW3 Protein translocase subunit SecA; EC 7.4.2.8 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
TTHA1251 preprotein translocase SecA subunit from Thermus thermophilus HB8
WP_011228548 preprotein translocase subunit SecA from Thermus thermophilus
55% identity, 47% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  subunit: Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved. Monomer and homodimer.
• Lysine propionylation is a prevalent post-translational modification in Thermus thermophilus
  Okanishi, Molecular & cellular proteomics : MCP 2014
  • “...Intracellular trafficking and secretion TTHA0365 TTHA0443 TTHA1251 Cell cycle control, mitosis, and meiosis TTHA0564 TTHA1816 Cell wall/membrane biogenesis...”
• Cloning, expression, purification, crystallization and initial crystallographic analysis of the preprotein translocation ATPase SecA from Thermus thermophilus
  Vassylyeva, Acta crystallographica. Section F, Structural biology and crystallization communications 2006
  • “...NdeI-EcoRV fragment containing the entire SecA gene (TTHA1251) from pET-TtsecA (Mikako Shirouzu, RIKEN Genomic Sciences Center, unpublished results) was...”
• Characterization of a polypeptide-binding site in the DEAD Motor of the SecA ATPase.
  Khalili, FEBS letters 2017 (PubMed)
  • GeneRIF: Characterization of a polypeptide-binding site in the DEAD Motor of the SecA ATPase has been presented.

SECA2_STAA8 / Q2FUW6 Protein translocase subunit SecA 2; EC 7.4.2.8 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
EQG65_13950 accessory Sec system translocase SecA2 from Staphylococcus aureus
SAUSA300_2584 preprotein translocase, secA protein from Staphylococcus aureus subsp. aureus USA300_FPR3757
NWMN_2548 preprotein translocase subunit SecA from Staphylococcus aureus subsp. aureus str. Newman
SACOL2671 secA family protein from Staphylococcus aureus subsp. aureus COL
37% identity, 89% coverage

• function: Part of the accessory SecA2/SecY2 system specifically required to export SraP, a serine-rich repeat cell wall protein encoded upstream in the same operon.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  subunit: Monomer and homodimer (Potential). Part of the accessory SecA2/SecY2 protein translocation apparatus required to export cell wall protein SraP.
  disruption phenotype: No effect on cell growth, significantly reduces export of the cell wall protein SrpA. The small amount that is exported seems to be glycosylated normally.
• Antibacterial Activity and Components of the Methanol-Phase Extract from Rhizomes of Pharmacophagous Plant Alpinia officinarum Hance
  Fu, Molecules (Basel, Switzerland) 2022
  • “...8.05-fold, p < 0.05). Meanwhile, in protein export, the expression of all the DEGs (except EQG65_13950 ) were significantly enhanced (2.006- to 3.472-fold, p < 0.05), such as the cooperation of signal peptidase IB ( EQG65_04850 ), protein translocase subunit SecDF ( EQG65_08470 ), lipoprotein signal...”
• Staphylococcal Enterotoxins Dose-Dependently Modulate the Generation of Myeloid-Derived Suppressor Cells
  Stoll, Frontiers in cellular and infection microbiology 2018
  • “...Library Fey et al., 2013 USA300 (JE2) secA- NE66 Tn insertion in preprotein translocase gene SAUSA300_2584 Fey et al., 2013 USA300 (JE2) putative enterotoxin type A- NE309 Tn insertion in putative enterotoxin type A gene SAUSA300_1559 Fey et al., 2013 USA300 (JE2) sek- NE1255 Tn insertion...”
• Transcriptional Response of Staphylococcus aureus to Sunlight in Oxic and Anoxic Conditions
  McClary, Frontiers in microbiology 2018
  • “...protein 0.22 0.5 NWMN_2597 Conserved hypothetical protein 0.22 8.8 citZ Citrate synthase II 0.21 9.9 NWMN_2548 Conserved hypothetical protein 0.21 3.2 qoxC Quinol oxidase polypeptide III 0.21 2.4 NWMN_2087 Conserved hypothetical protein 0.21 11.1 katA Catalase 0.20 2.0 poxB Pyruvate oxidase 0.20 2.4 tpi Triosephosphate isomerase...”
• Apt (Adenine Phosphoribosyltransferase) Mutation in Laboratory-Selected Vancomycin-Intermediate Staphylococcus aureus
  Lamichhane-Khadka, Antibiotics (Basel, Switzerland) 2021
  • “...PTS system, lactose-specific IIA component 10.8 (4.0) 9.0 (3.2) SACOL2187 lacA1 Hypothetical protein 14 9.4 SACOL2671 secA secA preprotein translocase subunit 2.7 3.1 Downregulated genes SACOL0209 coa Staphylocoagulase precursor 3.0 (1.1) 3.3 (2.1) SACOL0478 ssl11 Superantigen-like protein ND 2.1 SACOL0507 aaa Multifunctional autolysin ND 3.2 SACOL0723...”

SAR2728 preprotein translocase SecA subunit-like protein from Staphylococcus aureus subsp. aureus MRSA252
37% identity, 89% coverage

• The Staphylococcus aureus response to unsaturated long chain free fatty acids: survival mechanisms and virulence implications
  Kenny, PloS one 2009
  • “...rpsM 30S ribosomal protein S13 2.45 3.12E-02 SAR2313 infA translation initiation factor IF-1 2.08 1.49E-02 SAR2728 preprotein translocase SecA subunit-like protein 3.85 6.58E-03 Peptidoglycan Synthesis SAR0878 csdB putative selenocysteine lyase 2.52 3.07E-02 SAR1026 atl bifunctional autolysin precursor 2.65 6.16E-03 SAR1158 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase 2.13 9.56E-04 SAR1159 murD...”

SA2442 translocase from Staphylococcus aureus subsp. aureus N315
SA_RS13995 accessory Sec system translocase SecA2 from Staphylococcus aureus subsp. aureus N315
37% identity, 89% coverage

• The C-terminal region of the RNA helicase CshA is required for the interaction with the degradosome and turnover of bulk RNA in the opportunistic pathogen Staphylococcus aureus
  Giraud, RNA biology 2015
  • “...system gtf2 2.1 1.9 2.4 2.8 SA2441 SA2440-SA2446 Glycosyltransferase Gtf1 gtf1 2.0 1.9 2.9 2.9 SA2442 SA2440-SA2446 Protein translocase subunit SecA 2 SA2442 2.5 2.1 2.7 2.7 SA2487 Uncharacterized protein, similar to transporter SA2487 2.1 2.1 2.1 2.1 SA2491 Uncharacterized protein SA2491 2.4 2.1 1.3 9.4...”
• Mutation of RNA polymerase β-subunit gene promotes heterogeneous-to-homogeneous conversion of β-lactam resistance in methicillin-resistant Staphylococcus aureus
  Aiba, Antimicrobial agents and chemotherapy 2013
  • “...Secretion and other transport system SA0956 SA2203 SA2442 SA2443 SA2444 SA2445 SA2446 Productb IP-H5/N315IP N315rpoB(N967I)/ N315 lrgA lrgB cidC cidB cidA...”
• An RpoB mutation confers dual heteroresistance to daptomycin and vancomycin in Staphylococcus aureus
  Cui, Antimicrobial agents and chemotherapy 2010
  • “...SA1023 SA1026 SA1027 SA1212 SA1267 SA1898 SA2097 SA2356 SA2442 SA2446 SA2455 SA2456 SA2457 ftsL murD div1b opp-2D ebhA Other functions SA0128 SA0222 SA0309...”
• Characterizing the effects of inorganic acid and alkaline shock on the Staphylococcus aureus transcriptome and messenger RNA turnover
  Anderson, FEMS immunology and medical microbiology 2010
  • “...proton/sodium-glutamate symport sa_c5534s4791_a_at * 5.8 2.5 ND SA2386 nitrite extrusion protein sa_c5739s4980_a_at 3.9 2.5 2.5 SA2442 putative Na+/H+ antiporter sa_c10690s11140_s_at * 2.7 2.5 30 SA2718 anion transporter family protein Lipid transport and metabolism sa_c9605s8367_a_at * 6.6 2.5 15 cdsA SA1280 phosphatidate cytidylyltransferase sa_c1260s1035_a_at * 5.4 2.5...”
• Global regulation of Staphylococcus aureus genes by Rot
  Saïd-Salim, Journal of bacteriology 2003
  • “...SA0292 SA0271 SA2131 SA2132 SA2440 SA2001 SA1320 SA0380 SA2442 SA0675 SA2436 HP HP Conserved HP Conserved HP HP, similar to ABC transporter (ATP-binding...”
• Development of a Single-nucleotide Polymorphism Genotyping Assay for the Rapid Detection of Vancomycin-intermediate Resistance in Staphylococcus aureus Epidemic Lineage ST5
  Kim, Annals of laboratory medicine 2023
  • “...AT Intergenic (16/+497) O-acetyltransferase OatA/GNAT family acetyltransferase 78.6 SA_RS13735 2,689,707 CT P294L Malate:quinone oxidoreductase 78.6 SA_RS13995 2,748,292 GT R524S Accessory Sec system translocase SecA2 78.6 *Arrows indicate gene orientation; Nonsynonymous amino-acid changes are indicated in bold. Abbreviations: SNP, single-nucleotide polymorphism; VISA, vancomycin-intermediate resistant Staphylococcus aureus ;...”

SH0331 hypothetical protein from Staphylococcus haemolyticus JCSC1435
37% identity, 89% coverage

• Comparative Genomic Analysis of Staphylococcus haemolyticus Reveals Key to Hospital Adaptation and Pathogenicity
  Pain, Frontiers in microbiology 2019
  • “...32.6 NA SH0155 MFS transporter 96.8 47.8 sraP X SH0326 SraP 96.8 47.8 secA2 X SH0331 Protein translocase subunit SecA2 96.8 47.8 yjjG X SH0452 Pyrimidine 5-nucleotidase YjjG 84.6 26.1 PHAGE StauST398-2/vB_saus_phi2 51.2 0.0 All these genes/gene versions were significantly enriched in clinical isolates ( p...”

SECA2_ARATH / D8WUA4 Protein translocase subunit SECA2, chloroplastic; EC 7.4.2.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
50% identity, 48% coverage

• function: Involved in protein export. Probably interacts with other proteins to allow the postimport or conservative sorting pathway for inner membrane proteins in plastids. May have a central role in coupling the hydrolysis of ATP to the transfer of proteins across the membrane.
  catalytic activity: ATP + H2O + chloroplast-proteinSide 1 = ADP + phosphate + chloroplast-proteinSide 2.
  subunit: Part of a second Sec protein translocation apparatus. Interacts probably with SCY2
  disruption phenotype: Embryo lethal.

AT1G21650 ATP binding / protein binding from Arabidopsis thaliana
NP_173584 Preprotein translocase SecA family protein from Arabidopsis thaliana
50% identity, 48% coverage

• Yellow barley xan-m mutants are deficient in the motor unit SECA1 of the SEC1 translocase system
  Stuart, Planta 2025 (no snippet)
• Genome-wide (ChIP-seq) identification of target genes regulated by WRKY33 during submergence stress in Arabidopsis
  Zhang, BMC genomic data 2021
  • “...overlap Table 1 List of genes and their putative function Gene Name Putative Function Fold-Change AT1G21650 Preprotein translocase SecA family protein 8.0 AT1G64628 conserved peptide upstream open reading frame 57 5.2 AT2G01008 maternal effect embryo arrest protein 8.1 AT2G15540 non-LTR retrotransposon family 5.2 AT2G18220 Noc2p family...”
• Unraveling Hidden Components of the Chloroplast Envelope Proteome: Opportunities and Limits of Better MS Sensitivity
  Bouchnak, Molecular & cellular proteomics : MCP 2019
  • “...X 10 AT5G20300 TOC90 X 8.9 AT3G16620 TOC120 X X 5.2 AT1G63900 SP1 X 8.0 AT1G21650 SECA2 X 27.8 AT2G31530 SCY2 X X 7.9 AT1G45170 OEP24A X X 1.9 AT3G52230 OEP24 X X X 4.1 AT5G42960 OEP24-II X X 1.9 Functional Classification of the 1269 Proteins...”
  • “...58 ) and its structure was later solved ( 59 ). As previously observed, SecA2 (At1g21650) and SCY2 (At2g31530) were only detected in the envelope fraction and have relatively high EF values (28 and 8, respectively). Although SecA2 was previously detected in the envelope fraction using...”
• Quantitative Proteomics Reveals a Role for SERINE/ARGININE-Rich 45 in Regulating RNA Metabolism and Modulating Transcriptional Suppression via the ASAP Complex in Arabidopsis thaliana
  Chen, Frontiers in plant science 2019
  • “...At1g11930/F12F1_20 0.476 0.348 SAS AT1G16610 SR45 0.156 0.072 SAS/SAR AT1G20120 GDSL esterase/lipase 0.411 0.276 SAS AT1G21650 Protein translocase subunit SECA2, chloroplastic 0.385 0.587 AT2G21385 ATCGLD11, BFA3, BIOGENESIS FACTORS REQUIRED FOR ATP SYNTHASE 3, CGLD11 0.436 0.268 AT2G21590 APL4 0.459 0.543 AT2G22400 ATTRM4B, TRM4B 0.352 0.498 AT2G27880...”
• Identification and Roles of Photosystem II Assembly, Stability, and Repair Factors in Arabidopsis
  Lu, Frontiers in plant science 2016
  • “...2007 ; Schunemann, 2007 ; Cline and Dabney-Smith, 2008 ; Albiniak et al., 2012 cpSecA2 At1g21650 203 203 CS, TM Thylakoid protein targeting: cpSec translocase Insertion and assembly of PSII proteins such as PsbO Cline and Theg, 2007 ; Schunemann, 2007 ; Cline and Dabney-Smith, 2008...”
• Wheat germ-based protein libraries for the functional characterisation of the Arabidopsis E2 ubiquitin conjugating enzymes and the RING-type E3 ubiquitin ligase enzymes
  Ramadan, BMC plant biology 2015
  • “...No (c) , Yes (d) UBC8, UBC31 (f) At5g03180 v 52,475 Yes (a) nd nd At1g21650 SECA2 177,644 Yes (a) nd nd Truncated At1g79810 PEX2/TED3 HCa 38,175 Yes (a) nd nd At2g35330 HCa 79,194 Yes (a) Yes (d) nd At1g63170 H2 42,677 Yes (a) nd nd...”
• The protein translocation systems in plants - composition and variability on the example of Solanum lycopersicum
  Paul, BMC genomics 2013
  • “...a=0.992. ( d ) Domain architecture of cpSecA2 orthologues from A.thaliana and S. lycopersicum . AT1G21650 corresponds to Solyc11g005020 whereas AT1G21651 corresponds to the combination of Solyc11g005040 and Solyc11g005030. ( e ) RT-PCR results confirming that Solyc11g005040 and Solyc11g005030 is one gene; lanes 1 to 4:...”
  • “...was observed. However, the domain architecture enabled us to assign one cpSecA2 orthologue in Arabidopsis (AT1G21650) to Solyc11g005020 whereas the other orthologue AT1G21651 (zinc finger-RING_2_domain; 3x WD40 domain) could be similar to the combination of Solyc11g005040 (zinc finger-C3HC4_2 domain) and Solyc11g005030 (3x WD40 domains; Figure 1...”
• Analysis of essential Arabidopsis nuclear genes encoding plastid-targeted proteins
  Savage, PloS one 2013
  • “...protein with cactin-binding domain. Seed development defect, late stage siliques, top, SALK_014008, annotated as affecting At1g21650, Sec system component; bottom, SALK_035460, annotated as affecting At5g60750, CAAX amino terminal protease family protein. Seed pigment defect: late stage siliques, top, FLAG_583E05, annotated as affecting At4g14870, Secretory system component;...”
• More
• Identification of Putative Substrates of SEC2, a Chloroplast Inner Envelope Translocase.
  Li, Plant physiology 2017
  • GeneRIF: Data show that the SEC2 translocase consisting of SCY2, SECE2, and SECA2 likely integrates a subset of inner envelope membrane proteins.
• Plastids contain a second sec translocase system with essential functions.
  Skalitzky, Plant physiology 2011
  • GeneRIF: SCY2 and SECA2 function in Sec-mediated integration and translocation processes at the inner envelope membrane. [SECA2]

SERP2276 secA family protein from Staphylococcus epidermidis RP62A
34% identity, 89% coverage

• A New Bioactive Compound From the Marine Sponge-Derived Streptomyces sp. SBT348 Inhibits Staphylococcal Growth and Biofilm Formation
  Balasubramanian, Frontiers in microbiology 2018
  • “...1.56E-39 sepA Extracellular elastase precursor 2.3264 4.49E-17 SERP2272 Peptide methionine sulfoxide reductase putative 2.6559 5.30E-18 SERP2276 SecA family protein 2.2325 1.96E-31 hisH Amidotransferase HisH 2.5488 6.82E-14 hisB Imidazoleglycerol-phosphate dehydratase 3.4466 1.62E-17 hisD Histidinol dehydrogenase 2.6795 3.23E-18 hisG ATP phosphoribosyltransferase 2.8203 5.58E-10 SERP2338 Peptide synthetase 2.4122 9.72E-67...”

NPW32_RS03325 accessory Sec system translocase SecA2 from Staphylococcus epidermidis
34% identity, 89% coverage

• The first genomic characterization of a stable, hemin-dependent small colony variant strain of Staphylococcus epidermidis isolated from a prosthetic-joint infection
  Bogut, Frontiers in microbiology 2023
  • “...NPW32_RS07655 A155T Sensor histidine kinase LytS/YehU family NPW32_RS05480 L59P, A81V Alanine/ornithine racemase family PLP-dependent enzyme NPW32_RS03325 secA2 T108A Accessory Sec system translocase SecA2 NPW32_RS07960 graX / apsX A30T Nucleoside-diphosphate-sugar epimerase (WcaG)/auxiliary protein GraX/ApsX/cell wall/membrane/envelope biogenesis NPW32_RS09060 sigB M65I RNA polymerase sigma factor SigB NPW32_RS01410 L62F Predicted...”

MAB_2397 Preprotein translocase secA 2 subunit from Mycobacterium abscessus ATCC 19977
36% identity, 89% coverage

• β-Lactam Combinations That Exhibit Synergy against Mycobacteroides abscessus Clinical Isolates
  Story-Roller, Antimicrobial agents and chemotherapy 2021 (secret)

P9WGP3 bacterial ABC-type protein transporter (EC 7.4.2.5) from Mycobacterium tuberculosis (see 4 papers)
TC 3.A.5.2.2 / P66785 Protein translocase subunit secA 2, component of The general secretory pathway. SecA1 is the housekeeping protein; SecA2 is the accessory protein, essential for normal physiology and virulence from Mycobacterium tuberculosis (see 2 papers)
NP_216337 accessory Sec system translocase SecA2 from Mycobacterium tuberculosis H37Rv
MT1869 translocase from Mycobacterium tuberculosis CDC1551
Rv1821 translocase from Mycobacterium tuberculosis H37Rv
35% identity, 90% coverage

• substrates: proteins
  tcdb comment: The functions of SecA2 have been reviewed (Bensing et al. 2013)
• Mycobacterium tuberculosis exploits host ATM kinase for survival advantage through SecA2 secretome.
  Lochab, eLife 2020
  • GeneRIF: Mycobacterium tuberculosis exploits host ATM kinase for survival advantage through SecA2 secretome.
• Mycobacterium tuberculosis SatS is a chaperone for the SecA2 protein export pathway.
  Miller, eLife 2019
  • GeneRIF: SatS is required for the export of a subset of SecA2 substrates and for growth in macrophages and is a protein export chaperone
• In Vitro Interaction of the Housekeeping SecA1 with the Accessory SecA2 Protein of Mycobacterium tuberculosis
  Prabudiansyah, PloS one 2015
  • GeneRIF: The housekeeping protein SecA1 forms heterodimers with the accessory SecA2 protein of Mycobacterium tuberculosis in solution.
  • “...codon used is a GTG located at nucleotide position 91 from the annotated start codon (NP_216337), since this represents the true start codon [ 36 ]. PIP151 and PIP152 were used as templates to generate other plasmids. A cysteine was introduced by site directed mutagenesis replacing...”
• Structural Similarities and Differences between Two Functionally Distinct SecA Proteins, Mycobacterium tuberculosis SecA1 and SecA2
  Swanson, Journal of bacteriology 2015
  • GeneRIF: Many of the structural features of SecA1 are conserved in the SecA2 structure, including putative contacts with the SecYEG channel.
  • “...California, Berkeley amino acids (aa) (e.g., NCBI accession no. NP_216337). However, the start site in this annotation is likely to be incorrect, as the first...”
• Label-free Quantitative Proteomics Reveals a Role for the Mycobacterium tuberculosis SecA2 Pathway in Exporting Solute Binding Proteins and Mce Transporters to the Cell Wall.
  Feltcher, Molecular & cellular proteomics : MCP 2015
  • GeneRIF: Label-free Quantitative Proteomics Reveals a Role for the Mycobacterium tuberculosis SecA2 Pathway in Exporting Solute Binding Proteins and Mce Transporters to the Cell Wall
• Structural Similarities and Differences between Two Functionally Distinct SecA Proteins, Mycobacterium tuberculosis SecA1 and SecA2.
  Swanson, Journal of bacteriology 2015
  • GeneRIF: Many of the structural features of SecA1 are conserved in the SecA2 structure, including putative contacts with the SecYEG channel.
  • “...California, Berkeley amino acids (aa) (e.g., NCBI accession no. NP_216337). However, the start site in this annotation is likely to be incorrect, as the first...”
• ADP-dependent conformational changes distinguish Mycobacterium tuberculosis SecA2 from SecA1
  D'Lima, The Journal of biological chemistry 2014
  • GeneRIF: conformational change involving closure of the clamp in SecA2 may provide a mechanism for the cell to direct protein export through the conventional SecA1 pathway under normal growth conditions
  • “...91 from the annotated start site (NCBI accession number NP_216337) because this site represents the true start site (15). An ATG start codon that codes for...”
• ADP-dependent conformational changes distinguish Mycobacterium tuberculosis SecA2 from SecA1.
  D'Lima, The Journal of biological chemistry 2014
  • GeneRIF: conformational change involving closure of the clamp in SecA2 may provide a mechanism for the cell to direct protein export through the conventional SecA1 pathway under normal growth conditions
  • “...91 from the annotated start site (NCBI accession number NP_216337) because this site represents the true start site (15). An ATG start codon that codes for...”
• More
• The unfoldase ClpC1 of Mycobacterium tuberculosis regulates the expression of a distinct subset of proteins having intrinsically disordered termini
  Lunge, The Journal of biological chemistry 2020 (secret)
• Mycobacterium tuberculosis-induced IFN-β production requires cytosolic DNA and RNA sensing pathways
  Cheng, The Journal of experimental medicine 2018
  • “...Notre Dame, IN). WT M.tb CDC1551 was ordered from BEI Resources. The M.tb secA2 ( MT1869 ) transposon insertion mutant strain (position of insertion: 1352) was from the Tuberculosis Animal Research and Gene Evaluation Taskforce. Before infection of macrophages, all M.tb strains were grown in MiddleBrook...”
  • “...Generation of secA2 complementary strain To rescue M.tb CDC1551 secA2 -inactivated mutant, the SecA2-encoding gene, MT1869 , was cloned into an integrative vector pMH406-hyg, a generous gift from Dr. Patricia Champion (University of Notre Dame, Notre Dame, IN). Briefly, a 2,456-bp DNA fragment covering the secA2...”
• Mycobacterium tuberculosis SecA2-dependent activation of host Rig-I/MAVs signaling is not conserved in Mycobacterium marinum
  Serene, PloS one 2024
  • “...50 ]. Generation of complementation strains M . marinum (MMAR_2698) complementation and M . tuberculosis (Rv1821) cross complementation strains were generated using an integrative vector (pMV306H) under the control of the mycobacterial optimal promoter (MOP; George et al., 1995). To begin, secA2 was amplified from either...”
  • “...or M . tuberculosis CDC1551 genomic DNA with primers MMAR_2698 P1 and MMAR_2698 P2 or Rv1821 P1 and Rv1821 P1, respectively, using Phusion High Fidelity polymerase with HF buffer and 3% DMSO (NEB) under the following cycling conditions: 98C, 30 seconds; 98C, 10 seconds, 72C, 30...”
• Impact of the elderly lung mucosa on <i>Mycobacterium tuberculosis</i> transcriptional adaptation during infection of alveolar epithelial cells
  Olmo-Fontánez, Microbiology spectrum 2024
  • “...secretion system Rv3240C secA1 0.5768 1.2521 Probable preprotein translocase SecA1 1 subunit/involved in protein export Rv1821 secA2 0.4800 0.1331 Possible preprotein translocase ATPase SecA2/involved in protein export Rv2587C secD 0.1348 0.0324 Probable protein-export membrane protein SecD Rv0638 secE1 0.6131 1.1954 Probable preprotein translocase SecE1/essential for protein...”
• Live Attenuated Vaccines against Tuberculosis: Targeting the Disruption of Genes Encoding the Secretory Proteins of Mycobacteria
  Veerapandian, Vaccines 2024
  • “...above, Mtb possesses two secretory transport systems: the primary SecA1 (Rv3241c) and the accessory SecA2 (Rv1821). The latter is predicted to be a unique system in Mtb to transport a small subset of Mtb proteins related to its pathogenicity. Consistent with this prediction, an secA2 deletion...”
• Pathogenicity and virulence of Mycobacterium tuberculosis
  Rahlwes, Virulence 2023
  • “...IL-12, TNF-, and IL-6, required for lung tissue colonization [ 250 , 251 ] SecA2 Rv1821 Secretion system Protein export system that participates in the phagosome and autophagosome maturation arrest [ 247 , 252 ] PtpA MptpA Rv2234 Hydrolase, Protein phosphatase Inhibits phagosome-lysosome fusion, phagosome acidification,...”
• Genomic analysis of Mycobacterium brumae sustains its nonpathogenic and immunogenic phenotype
  Renau-Mínguez, Frontiers in microbiology 2022
  • “...Other virulence factors 75.7 99 Rv1540 Rv1540 1,742,845 1,743,771 Forward Other virulence factors 81.6 100 Rv1821 secA2 2,066,457 2,068,883 Forward Secretion system 81.2 100 Rv1854c ndh 2,101,651 2,103,042 Reverse Other virulence factors 71.1 99.8 Rv2097c pafA 2,355,319 2,356,677 Reverse Proteasome-associated protein 92.7 100 Rv2115c mpa 2,374,461...”
• Different modalities of host cell death and their impact on Mycobacterium tuberculosis infection
  Nisa, American journal of physiology. Cell physiology 2022 (secret)
• Genetic Determinants of Intrinsic Antibiotic Tolerance in Mycobacterium avium
  Matern, Microbiology spectrum 2021
  • “...the susceptibility of M. avium to multiple antibiotics. For example, mutations in secA2 (DFS55_12665 or rv1821 ) conferred hypersusceptibility to both CLR and MOX. The Sec export pathway is conserved across bacteria and exports secreted proteins across the cytoplasmic membrane ( 37 ). Mycobacteria have two...”
• More

O32922 Protein translocase subunit SecA 2 from Mycobacterium leprae (strain TN)
35% identity, 88% coverage

• Two nonredundant SecA homologues function in mycobacteria
  Braunstein, Journal of bacteriology 2001
  • “...no. Z95121 U66080 U66081 P57996 Z78020 AF287049 O32922 D17428 U21192 Q55357 BAB41941 BAB43747 P47847 AE005672 AE005672 P10408 P28366 Q41062 P38380 AF116183...”

CTL0070 preprotein translocase subunit from Chlamydia trachomatis 434/Bu
42% identity, 58% coverage

• Transposon Mutagenesis in Chlamydia trachomatis Identifies CT339 as a ComEC Homolog Important for DNA Uptake and Lateral Gene Transfer
  LaBrie, mBio 2019
  • “...upstream of dppD / phoU dppD (oligopeptide ABC transporter ATP-binding protein) and phoU (phosphate transport) ctl0070 / 0071 ( ct701 / 702 ) Converging 87381 ctl0111 / 0112 ( ct742 / 743 ) Shared direction 142632 98 nt upstream of trmA (CTL0111) trmA ; 23S rRNA...”

MAP1534 SecA2 from Mycobacterium avium subsp. paratuberculosis str. k10
38% identity, 76% coverage

• MAP1272c encodes an NlpC/P60 protein, an antigen detected in cattle with Johne's disease
  Bannantine, Clinical and vaccine immunology : CVI 2012
  • “...M. avium subsp. paratuberculosis also has SecA2 encoded by MAP1534 (21), and deletion of this gene results in attenuation in mouse macrophages (9, 21). We have...”

O84707 Protein translocase subunit SecA from Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
CT701 Protein Translocase from Chlamydia trachomatis D/UW-3/CX
42% identity, 58% coverage

• Molecular characterization and subcellular localization of macrophage infectivity potentiator, a Chlamydia trachomatis lipoprotein
  Neff, Journal of bacteriology 2007
  • “...no. (Swiss-Prot/ TrEMBL) ffh CT025 O84028 secA CT701 O84707 secD/secF secE secY CT448 CT321 CT510 O84454 O84323 P28539 lnt CT534 O84539 lspA CT408 O84413...”
• Transposon Mutagenesis in Chlamydia trachomatis Identifies CT339 as a ComEC Homolog Important for DNA Uptake and Lateral Gene Transfer
  LaBrie, mBio 2019
  • “...phoU dppD (oligopeptide ABC transporter ATP-binding protein) and phoU (phosphate transport) ctl0070 / 0071 ( ct701 / 702 ) Converging 87381 ctl0111 / 0112 ( ct742 / 743 ) Shared direction 142632 98 nt upstream of trmA (CTL0111) trmA ; 23S rRNA (uracil-5-)-methyltransferase ctl0160 / 0162...”
• The alternative translational profile that underlies the immune-evasive state of persistence in Chlamydiaceae exploits differential tryptophan contents of the protein repertoire
  Lo, Microbiology and molecular biology reviews : MMBR 2012
  • “...protein components of the secretory machinery (encoded by CT025, CT701, CT448, CT321, and CT510) exhibit a range of low to average p/P Trp ratios, the final...”
• Chlamydia trachomatis secretion of an immunodominant hypothetical protein (CT795) into host cell cytoplasm
  Qi, Journal of bacteriology 2011
  • “...with two chlamydial homologs of SecA (CT141 and CT701) to bring the substrate proteins to the chlamydial SecYEG translocon. In addition, the chlamydial FtsY...”
• Toll-like receptor 2 activation by Chlamydia trachomatis is plasmid dependent, and plasmid-responsive chromosomal loci are coordinately regulated in response to glucose limitation by C. trachomatis but not by C. muridarum
  O'Connell, Infection and immunity 2011
  • “...hypothetical protein downstream of GTPase and upstream of CT701 (secA) A single microarray analysis was performed for each strain pairing, using mRNA recovered...”
• Secretion of the chlamydial virulence factor CPAF requires the Sec-dependent pathway
  Chen, Microbiology (Reading, England) 2010
  • “...these chaperones may help secretion by interacting with two chlamydial homologues of SecA (CT141 and CT701) to bring the substrate protein to the chlamydial SecYEG translocon. In addition, the chlamydial FtsY (an SRP receptor-like protein) may act as a GTP-dependent chaperone that promotes interaction between the...”
• An iterative strategy combining biophysical criteria and duration hidden Markov models for structural predictions of Chlamydia trachomatis sigma66 promoters
  Mallios, BMC bioinformatics 2009
  • “...ompA 282 M,T TATACA AAAATGGCTCTCTGCTT(17) TATTGC 8 CT681b ompA 60 M,T GTGCCG CCAGAAAAAGATAGCGAG(18) CACAAA 8 CT701 secA_2 57 M TGTATA GGCGCCTTTAAATAAGAGGG(20) TAGGTT 8 CT708 - 66 G TTGATT TAGCGGAAGTAAAAAGG(17) TACAAG 16 CT743 hctA 83 M,T TTGCAT GAATTTGAACAAACAAAC(18) TAATTA 24 CT752 efp_2 62 G TGGACA AAGCTTAGAAGAGAACGA(18) TAACAT...”
  • “...TTCAAG 59 TTGCTT TTATCGATAAAAGAAAC(17) TTCAAG CT518 rl14 198 CTGTTG TTGTTCGAGTCGAAAGGG(18) TATACT 195 TTGTTG TTCGAGTCGAAAGGGTA(17) TACTCG CT701 secA_2 57 TGTATA GGCGCCTTTAAATAAGAGGG(20) TAGGTT 61 TTGTTG TATAGGCGCCTTTAAA(16) TAAGAG Given two models, one training set a subset of the other, that both classify their respective training sets with 100% accuracy,...”
• Molecular characterization and subcellular localization of macrophage infectivity potentiator, a Chlamydia trachomatis lipoprotein
  Neff, Journal of bacteriology 2007
  • “...accession no. (Swiss-Prot/ TrEMBL) ffh CT025 O84028 secA CT701 O84707 secD/secF secE secY CT448 CT321 CT510 O84454 O84323 P28539 lnt CT534 O84539 lspA CT408...”
• Synovial Chlamydia trachomatis up regulates expression of a panel of genes similar to that transcribed by Mycobacterium tuberculosis during persistent infection
  Gérard, Annals of the rheumatic diseases 2006
  • “...with MUR-NAc-L-alanine and D-alanine-Dalanine ligase activity), Ct701 (secA, preprotein translocase subunit A protein), Ct624 (mviN, a putative virulence...”
  • “...regulation of expression in the monocyte system (Ct762, Ct701, Ct624, Ct868) all showed some level of increased expression in the patient samples, consistent...”
• More

MMAR_2698 preprotein translocase ATPase SecA2 from Mycobacterium marinum M
38% identity, 75% coverage

• Mycobacterium tuberculosis SecA2-dependent activation of host Rig-I/MAVs signaling is not conserved in Mycobacterium marinum
  Serene, PloS one 2024
  • “...rapid genotyping process previously described [ 50 ]. Generation of complementation strains M . marinum (MMAR_2698) complementation and M . tuberculosis (Rv1821) cross complementation strains were generated using an integrative vector (pMV306H) under the control of the mycobacterial optimal promoter (MOP; George et al., 1995). To...”
  • “...from either M . marinum M or M . tuberculosis CDC1551 genomic DNA with primers MMAR_2698 P1 and MMAR_2698 P2 or Rv1821 P1 and Rv1821 P1, respectively, using Phusion High Fidelity polymerase with HF buffer and 3% DMSO (NEB) under the following cycling conditions: 98C, 30...”
• Mycobacterium marinum SecA2 promotes stable granulomas and induces tumor necrosis factor alpha in vivo
  Watkins, Infection and immunity 2012
  • “...mutant with an insertion mutation in the MMAR_2698 gene, was constructed using a previously published double-selection strategy (12). Flanking upstream sequence...”
  • “...sequencing. The secA2 strain was complemented with secA2 (MMAR_2698) to produce the SA2comp strain, by integration of this gene and the mycobacterial hsp60...”

DFS55_12665 accessory Sec system translocase SecA2 from Mycobacterium avium subsp. hominissuis
38% identity, 76% coverage

• Genetic Determinants of Intrinsic Antibiotic Tolerance in Mycobacterium avium
  Matern, Microbiology spectrum 2021
  • “...to enhance the susceptibility of M. avium to multiple antibiotics. For example, mutations in secA2 (DFS55_12665 or rv1821 ) conferred hypersusceptibility to both CLR and MOX. The Sec export pathway is conserved across bacteria and exports secreted proteins across the cytoplasmic membrane ( 37 ). Mycobacteria...”

SECA2_MYCS2 / A0QYG9 Protein translocase subunit SecA 2; EC 7.4.2.8 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
A0QYG9 bacterial ABC-type protein transporter (EC 7.4.2.5) from Mycobacterium tuberculosis (see paper)
MSMEG_3654 ATPase SecA2 from Mycobacterium smegmatis str. MC2 155
39% identity, 73% coverage

• function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane.
  catalytic activity: ATP + H2O + cellular proteinSide 1 = ADP + phosphate + cellular proteinSide 2.
  subunit: Monomer and homodimer. Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved.
  disruption phenotype: Not essential, the disruption mutant is super- sensitive to azide, export of some proteins is decreased and has a small colony growth phenotype on rich agar medium. It cannot replace secA1.
• Characterization of Conserved and Novel Septal Factors in Mycobacterium smegmatis
  Wu, Journal of bacteriology 2018
  • “...MSMEG_2690 MSMEG_6434 MSMEG_6105 MSMEG_4287 MSMEG_2410 MSMEG_3654 MSMEG_6051 MSMEG_5058 MSMEG_1642 MSMEG_2424 MSMEG_3027 MSMEG_5223 MSMEG_0690 MSMEG_3655...”

MKAN_RS00320 accessory Sec system translocase SecA2 from Mycobacterium kansasii ATCC 12478
38% identity, 74% coverage

• Comprehensive essentiality analysis of the Mycobacterium kansasii genome by saturation transposon mutagenesis and deep sequencing
  Levendosky, mBio 2023
  • “...subsp. hominissuis, c M. abscessus, d and M. smegmatis e Locus tag Gene name Description MKAN_RS00320 secA2 Accessory Sec system translocase SecA2 MKAN_RS14925 Cation-translocating P-type ATPase MKAN_RS16715 Hypothetical protein MKAN_RS17105 thiD Bifunctional hydroxymethylpyrimidine/phosphomethylpyrimidine kinase MKAN_RS18455 rpmG 50S ribosomal protein L33 MKAN_RS18980 zf-HC2 domain-containing protein MKAN_RS22360 Cysteine...”

Q8NQJ4 bacterial ABC-type protein transporter (EC 7.4.2.5) from Corynebacterium glutamicum (see paper)
cg1629 preprotein translocase subunit SecA from Corynebacterium glutamicum ATCC 13032
34% identity, 90% coverage

• Adaptation of Corynebacterium glutamicum to ammonium limitation: a global analysis using transcriptome and proteome techniques
  Silberbach, Applied and environmental microbiology 2005
  • “...cg1575 cg1880 cg1290 cg2450 cg1725 cg2166 cg2323 cg2166 cg1629 cg0583 cg0482 cg2797 cg2958 cg0299 cg2429 cg1267 cg0655 cg1790 cg1790 cg0655 cg0948 cg1072 cg2782...”

SPO2713 preprotein translocase subunit SecA from Ruegeria pomeroyi DSS-3
40% identity, 67% coverage

• A mutant fitness assay identifies bacterial interactions in a model ocean hot spot
  Schreier, Proceedings of the National Academy of Sciences of the United States of America 2023
  • “...gspF ) Antimicrobial/Efflux 0.11 -0.13 SPO1757 capsular polysaccharide export protein ( kpsS ) Efflux -0.18 SPO2713 Protein translocase subunit SecA 2 ( secA 2) Efflux 0.42 SPO2251 gene transfer agent ( orfg 14) Gene transfer 0.84 SPO0071 competence protein F, putative Gene transfer 0.13 0.2 SPOA0111...”

Aasi_1610 hypothetical protein from Candidatus Amoebophilus asiaticus 5a2
31% identity, 4% coverage

• The draft genome of strain cCpun from biting midges confirms insect Cardinium are not a monophyletic group and reveals a novel gene family expansion in a symbiont
  Siozios, PeerJ 2019
  • “...Notably, the two proteins also have partial similarities with a large ankyrin repeat containing protein (Aasi_1610) previously identified in A. asiaticus ( Schmitz-Esser et al., 2010 ). Although both c Cpun proteins had their ten top hits assigned to Aedes sequences, the partial similarities to A....”
• Draft genome sequence of the male-killing Wolbachia strain wBol1 reveals recent horizontal gene transfers from diverse sources
  Duplouy, BMC genomics 2013
  • “...into bacteria: one represented by wBol1_1092, and the other by two Candidatus Amoebophilus asiaticus genes, Aasi_1610 and Aasi_1144, which cluster with an Aedes aegypti gene. Unlike wBol1_1092, however, these Candidatus Amoebophilus genes do not have full-length matches to insect secA proteins, with sequence similarity only in...”

Aasi_1144 hypothetical protein from Candidatus Amoebophilus asiaticus 5a2
25% identity, 13% coverage

• Draft genome sequence of the male-killing Wolbachia strain wBol1 reveals recent horizontal gene transfers from diverse sources
  Duplouy, BMC genomics 2013
  • “...one represented by wBol1_1092, and the other by two Candidatus Amoebophilus asiaticus genes, Aasi_1610 and Aasi_1144, which cluster with an Aedes aegypti gene. Unlike wBol1_1092, however, these Candidatus Amoebophilus genes do not have full-length matches to insect secA proteins, with sequence similarity only in the secA...”

XP_001656120 uncharacterized protein LOC5576417 from Aedes aegypti
29% identity, 7% coverage

• The draft genome of strain cCpun from biting midges confirms insect Cardinium are not a monophyletic group and reveals a novel gene family expansion in a symbiont
  Siozios, PeerJ 2019
  • “...felis , ( WP_039595314 ) 2E-155 73 CCPUN_03830 426 Hypothetical protein Aedes aegypti , ( XP_001656120 ) 2E-60 39 CCPUN_08280 1,360 Hypothetical protein Aedes albopictus, ( KXJ68548 ) 5E-72 27 Among the putatively horizontally exchanged gene set were ORFs encoding a carbonic anydrase (CA), an amino...”

LOC110523838 uncharacterized protein LOC110523838 from Oncorhynchus mykiss
33% identity, 6% coverage

• Single-cell atlas of rainbow trout peripheral blood leukocytes and profiling of their early response to infectious pancreatic necrosis virus
  Perdiguero, Frontiers in immunology 2024
  • “...0.023 0 Dendritic cells Macrophage expressed 1 ( mpeg1 ) 5.248 1 0.039 5.5E-136 Uncharacterized LOC110523838 (LOC110523838) 10.442 0.962 0.054 2.5E-92 Ictacalcin-like (LOC110536275) 9.209 0.923 0.077 4.2E-59 Myristoylated alanine-rich C-kinase substrate-like (LOC110529520) 5.509 0.846 0.034 8.4E-112 Ictacalcin-like (LOC110520890) 8.539 0.923 0.122 3.4E-34 Dendritic-like cells Ribonucleoside-diphosphate reductase...”
  • “...the myristoylated alanine-rich C-kinase substrate-like (LOC110529520), two ictacalcin-like (LOC110536275 and LOC110520890), and one uncharacterized gene (LOC110523838). In the other population of DC-like cells, genes encoding reductase subunits (LOC110529451 and rrm1 ) stood up, together with genes mapping topoisomerase DNA II alpha ( top2a ) or tubulin...”

FAY30_11960 SEC-C metal-binding domain-containing protein from Bacillus sp. S3
74% identity, 3% coverage

• Complete genome sequencing and comparative genomic analyses of Bacillus sp. S3, a novel hyper Sb(III)-oxidizing bacterium
  Li, BMC microbiology 2020
  • “...regulatory protein FAY30_09765 cadA Putative cadmium-transporting ATPase FAY30_21075 zupT Zinc transporter FAY30_06055 zosA Zinc-transporting ATPase FAY30_11960 yeiR Zinc-binding GTPase FAY30_17115 zur Zinc uptake regulation protein FAY30_15605 znuA Zinc ABC transporter, substrate-binding protein FAY30_20065 znuB Zinc ABC transporter, permease protein FAY30_08125 znuC Zinc ABC transporter, ATP-binding protein...”

RSc0831 HYPOTHETICAL PROTEIN from Ralstonia solanacearum GMI1000
70% identity, 3% coverage

• A genome-wide scan for genes under balancing selection in the plant pathogen Ralstonia solanacearum
  Castillo, BMC evolutionary biology 2019
  • “...UxuL is organized within an operon with three other genes: garD encodes a D-galactarate dehydratase, RSc0831 a putative NAD-dependent epimerase/dehydratase and pehC a polygalacturonase. PehC is an enzyme related to virulence since it cleaves oligomers of galacturonate, however its exact role is unknown. It was hypothesized...”

PP1114 SEC-C domain protein from Pseudomonas putida KT2440
72% identity, 3% coverage

• UEG Week 2024 Poster Presentations
  , United European gastroenterology journal 2024
• UEG Week 2023 Poster Presentations
  , United European gastroenterology journal 2023

PA1034 hypothetical protein from Pseudomonas aeruginosa PAO1
72% identity, 3% coverage

• Identification of QuiP, the product of gene PA1032, as the second acyl-homoserine lactone acylase of Pseudomonas aeruginosa PAO1
  Huang, Applied and environmental microbiology 2006
  • “...a distant homolog of glutathione S-transferases, and PA1034 and PA1035, which both encode "hypothetical proteins of unknown function" (www.pseudomonas.com). The...”
• V-antigen genotype and phenotype analyses of clinical isolates of Pseudomonas aeruginosa
  Allmond, Journal of clinical microbiology 2004
  • “...PA2009 PA2015 PA1007 PA1010 PA1001 PA1100 PA1019 PA1024 PA1034 PA1052 PA1060 PA1063 PA1064 PA1065 PA1067 PA1069 PA1070 PA1079 PA1080 PcrV phenotype for: Type of...”
  • “...size marker - PA1060 PA1063 - PA1001 PA1019 PA1024 PA1034 PA1052 size marker - PA103 PA1027 PA1111 PA1085 PA2009 PA2015 PA1007 PA1010 - negative control - size...”

STM14_2356 YecA family protein from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
61% identity, 3% coverage

• Role of CsrA in stress responses and metabolism important for Salmonella virulence revealed by integrated transcriptomics
  Potts, PloS one 2019
  • “...average of scaling factors calculated from 11 genes (STM14_0169, STM14_0523, STM14_0577, STM14_0882, STM14_1056, STM14_1594, STM14_2331, STM14_2356, STM14_2422, STM14_2491, and STM14_3077). These genes were chosen to reflect a variety of gene lengths, positions in operons, and RNA stabilities. qRT-PCR RNA decay curves were collected from 4 independent...”

YecA / b1908 UPF0149 family protein YecA from Escherichia coli K-12 substr. MG1655
b1908 conserved metal-binding protein from Escherichia coli str. K-12 substr. MG1655
65% identity, 3% coverage

• Analysis of phage Mu DNA transposition by whole-genome Escherichia coli tiling arrays reveals a complex relationship to distribution of target selection protein B, transcription and chromosome architectural elements
  Ge, Journal of biosciences 2011
  • “...2000275 1.49 fliA b1922 11 2177914 2180627 1.47 yegV b2100 12 1989873 1990138 1.45 leuZ b1908 13 3440478 3441055 1.45 rpmJ b3299 14 3886442 3886611 1.45 tnaL b3707 15 1204622 1204815 1.34 ymfR b1150 16 2151536 2151777 1.3 sibB b2074 17 3305802 3306283 1.3 deaD b3162...”

Q9JZG0 YecA family protein from Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
40% identity, 8% coverage

• Towards New Drug Targets? Function Prediction of Putative Proteins of Neisseria meningitidis MC58 and Their Virulence Characterization
  Shahbaaz, Omics : a journal of integrative biology 2015
  • “...Q9K0X0 36. P67259 37. 38. 39. 40. 41. 42. Q9K194 Q7DDP7 Q9JZG0 P64161 Q9K1K7 Q9JZY3 43. Q9JYT6 44. P63702 45. 46. 47. 48. 49. 50. 51. 52. Q9K1D3 Q9K0W8 Q9JXB7...”

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.