PaperBLAST
PaperBLAST Hits for sp|O50274|CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cysNC PE=3 SV=1 (633 a.a., MSHQSDLISE...)
Show query sequence
>sp|O50274|CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cysNC PE=3 SV=1
MSHQSDLISEDILAYLGQHERKELLRFLTCGNVDDGKSTLIGRLLHDSKMIYEDHLEAIT
RDSKKVGTTGDDVDLALLVDGLQAEREQGITIDVAYRYFSTAKRKFIIADTPGHEQYTRN
MATGASTCDLAIILIDARYGVQTQTRRHSFIASLLGIRHIVVAINKMDLKDFDQGVFEQI
KADYLAFAEKIGLKTSSLHFVPMSALKGDNVVNKSERSPWYAGQSLMEILETVEIAADRN
LDDMRFPVQYVNRPNLNFRGFAGTLASGVVRKGDEVVALPSGKGSKVKSIVTFEGELEQA
GPGQAVTLTLEDEIDVSRGDMLVHADNRPLVTDGFDAMLVWMAEEPMLPGKKYDIKRATS
YVPGSIPSIVHKVDVNTLERTPGSELKLNEIARVKVSLDAPIALDGYEQNRTTGAFIVID
RLTNGTVGAGMIVSAPPAAHGSSAHHGSNAHVTREERAGRFGQQPATVLFSGLSGAGKST
LAYAVERKLFDMGRAVYVLDGQNLRHDLNKGLPQDRAGRTENWLRTAHVAKQFNEAGLIS
LCAFVAPSAEGREQARALIGAERLITVYVQASPQVCRERDPQGLYAAGEDNIPGESFPYD
VPLDADLVIDTQALSVEDGVKQVLDLLRERQAI
Running BLASTp...
Found 250 similar proteins in the literature:
PA4442 binfunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein from Pseudomonas aeruginosa PAO1
100% identity, 100% coverage
- Searching for Biological Function of the Mysterious PA2504 Protein from Pseudomonas aeruginosa
Drabinska, International journal of molecular sciences 2021 - “...PA4195 1.64 Putative amino acid ABC transporter substrate-binding protein/ ABC transporter glutamine-binding protein GlnH precursor PA4442 cysN 1.87 Bifunctional sulphate adenylyltransferase subunit 1/adenylylsulphate kinase PA4443 cysD 2.22 Sulphate adenylyltransferase subunit 2 PA4470 fumC1 0.29 Fumarate hydratase PA4471 PA4471 0.58 Hypothetical protein PA5024 ytnM 0.44 Hypothetical protein/...”
- Cysteamine Inhibits Glycine Utilisation and Disrupts Virulence in Pseudomonas aeruginosa
Fraser-Pitt, Frontiers in cellular and infection microbiology 2021 - “...membrane protein NP_253085.1 nucleotide-binding protein PA4395 yajQ Unknown NP_253132.1 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase PA4442 cysNC hydrogen sulfide biosynthesis NP_250493.1 ATP-dependent protease ATP-binding subunit ClpX PA1802 clpX Protein folding NP_251342.1 chemotaxis transducer PA2652 Cellular response to an organic substance, chemotaxis NP_250759.1 carbamoyl transferase PA2069 Biosynthetic...”
- Traditional Chinese Medicine Tanreqing Inhibits Quorum Sensing Systems in Pseudomonas aeruginosa
Yang, Frontiers in microbiology 2020 - “...phzG1 3.4 3.4 + Probable pyridoxamine 5-phosphate oxidase PA4217 phzS 4.3 3.8 + Flavin-containing monooxygenase PA4442 cysN 1.7 1.9 + ATP sulfurylase GTP-binding subunit/APS kinase PA5220 2.1 1.8 + Hypothetical protein a PA numbers are from http://www.pseudomonas.com ; ORF, open reading frame. b Genes are obtained...”
- “...2.3 1.3 Probable transcarboxylase subunit PA5436 2.7 1.1 Probable biotin carboxylase subunit of a transcarboxylase PA4442 cysN 1.7 1.9 + ATP sulfurylase GTP-binding subunit/APS kinase PA4443 cysD 2.1 1.1 + ATP sulfurylase small subunit PA3181 1.6 + 2-Keto3deoxy-6-phosphogluconate aldolase PA4748 tpiA 1.2 Triosephosphate isomerase PA3562 fruI...”
- Seawater salt-trapped Pseudomonas aeruginosa survives for years and gets primed for salinity tolerance
Elabed, BMC microbiology 2019 - “...ID329 0.0029 Probable cytochrome oxidase subunit (cbb3-type) ccoN2 PA1557* 2.02 ID329 0.0087 Sulfate adenylyltransferase cysN PA4442 2.12 0.0029 NAD-dependent glutamate dehydrogenase gdhB PA3068 2.30 0.0025 Glyceraldehyde 3-phosphate dehydrogenase gapA PA3195 2.08 0.0071 Co-chaperone HscB hscB PA3811 2.62 ID777 0.00063 Ferredoxin (2Fe-2S) fdx2 PA3809 2.40 ID777 0.0016...”
- Molecular mechanism for sphingosine-induced Pseudomonas ceramidase expression through the transcriptional regulator SphR
Okino, Scientific reports 2016 - “...PA1838 cysI sulfite reductase 2.331 0.0097622 PA1984 exaC NAD+ dependent aldehyde dehydrogenase ExaC 2.305 0.0134713 PA4442 cysN ATP sulfurylase GTP-binding subunit/APS kinase 2.294 0.0304196 PA2426 pvdS sigma factor PvdS 2.285 0.0049072 PA1837 hypothetical protein 2.271 0.0095659 PA4351 OlsA 2.238 0.0282751 PA0280 cysA sulfate transport protein CysA...”
- A systems-level approach for investigating Pseudomonas aeruginosa biofilm formation
Xu, PloS one 2013 - “...),PA4411( murC ), PA4412( murG ),PA4414( murD ),PA4415( mraY ),PA4416( murF )PA4417( murE ),PA4425( yraO ),PA4442( cysN ),PA4443( cysD ), PA4450( murA ),PA4457( KdsD ),PA4524( nadC ),PA4529( coaE ), PA4561( ribF ),PA4655( hemH ),PA4666( hemA ),PA4670( prs ), PA4729( panB ),PA4730( panC ),PA4749( glmM ),PA4750( folP...”
- A eukaryotic-type signalling system of Pseudomonas aeruginosa contributes to oxidative stress resistance, intracellular survival and virulence
Goldová, BMC genomics 2011 - “...( tauA ) 5.07 0.025 Pr. periplasmic taurine-binding protein precursor (Transport of small molecules) RpoS PA4442 ( cysN ) b 3.13 0.117 ATP sulfurylase GTP-binding subunit/APS kinase (Amino acid biosynthesis and metabolism; Central intermediary metabolism) QS PA4443 ( cysD ) b 4.86 0.051 ATP sulfurylase small...”
- Indole and 7-hydroxyindole diminish Pseudomonas aeruginosa virulence
Lee, Microbial biotechnology 2009 - “...of the ssu locus PA3446 ssuE 6.5 1.6 1.5 SsuE, part of the ssu locus PA4442 cysN 4.6 2.0 1.1 ATP sulfurylase GTPbinding subunit PA4443 cysD 4.9 1.7 1.2 ATP sulfurylase small subunit PA5025 metY 2.6 1.3 1.1 Homocysteine synthase PA5427 adhA 2.1 2.6 1.1 Alcohol...”
- More
T1E_0566 sulfate adenylyltransferase subunit CysN from Pseudomonas putida DOT-T1E
PP1304 sulfate adenylyltransferase, subunit 1/adenylylsulfate kinase from Pseudomonas putida KT2440
87% identity, 100% coverage
1zunB / Q87WW1 Crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae (see paper)
82% identity, 66% coverage
- Ligand: guanosine-5'-diphosphate (1zunB)
ACIAD1073 ATP-sulfurylase, subunit 1 from Acinetobacter sp. ADP1
67% identity, 74% coverage
CC1482, CC_1482 sulfate adenylate transferase, subunit 1/adenylylsulfate kinase from Caulobacter crescentus CB15
CCNA_01549 sulfate adenylyltransferase subunit 1/adenylylsulfate kinase from Caulobacter crescentus NA1000
54% identity, 99% coverage
- CspC regulates the expression of the glyoxylate cycle genes at stationary phase in Caulobacter
Santos, BMC genomics 2015 - “...periplasmic component 4.43 2.7 d Yes CC_1119 CCNA_01177 sulfite reductase, beta subunit 5.22 2.0 Yes CC_1482 CCNA_01549 sulfate adenylyltransferase subunit 1/ /adenylylsulfate kinase 8.94 0.9 Yes CC_1483 CCNA_01550 sulfate adenylyltransferase, subunit 2 5.36 2.1 Yes Transport CC_1666 CCNA_01738 TonB-dependent receptor 5.41 3.2 d No CC_1991 CCNA_02070...”
- Transcriptional profiling of Caulobacter crescentus during growth on complex and minimal media
Hottes, Journal of bacteriology 2004 - “...reductase, cysH CC1426, cysteine synthase, cysB CC1482, sulfate adenylate transferase, subunit 1/ adenylylsulfate kinase, cysN/C CC1483, sulfate adenylate...”
- CspC regulates the expression of the glyoxylate cycle genes at stationary phase in Caulobacter
Santos, BMC genomics 2015 - “...component 4.43 2.7 d Yes CC_1119 CCNA_01177 sulfite reductase, beta subunit 5.22 2.0 Yes CC_1482 CCNA_01549 sulfate adenylyltransferase subunit 1/ /adenylylsulfate kinase 8.94 0.9 Yes CC_1483 CCNA_01550 sulfate adenylyltransferase, subunit 2 5.36 2.1 Yes Transport CC_1666 CCNA_01738 TonB-dependent receptor 5.41 3.2 d No CC_1991 CCNA_02070 protein...”
ABUW_2895 sulfate adenylyltransferase subunit CysN from Acinetobacter baumannii
67% identity, 74% coverage
ABD05_RS00860 sulfate adenylyltransferase subunit CysN from Burkholderia pyrrocinia
53% identity, 96% coverage
BCAN_A0198 sulfate adenylyltransferase, large subunit from Brucella canis ATCC 23365
52% identity, 96% coverage
BMEI1754 SULFATE ADENYLYLTRANSFERASE / ADENYLYLSULFATE KINASE from Brucella melitensis 16M
52% identity, 96% coverage
SMb21224 putative sulfate adenylyltransferase subunit 1 adenylsulfate kinase protein from Sinorhizobium meliloti 1021
49% identity, 97% coverage
- Transcriptomic Insight in the Control of Legume Root Secondary Infection by the Sinorhizobium meliloti Transcriptional Regulator Clr
Zou, Frontiers in microbiology 2017 - “...Microaerobic Induced genes smb20495 Conserved hypothetical protein 4,585 5,5721 smc04190 Conserved hypothetical protein 4,0758 4,8696 smb21224 NodQ2 sulfate adenylyltransferase protein 2,0767 3,8393 smc01589 Hypothetical protein 2,1773 3,7637 smc02278 Hypothetical transmembrane protein 4,0335 3,523 sma0855 NodP1 ATP sulfurylase 1,453 3,5207 smb21671 Hypothetical protein 2,2859 3,3252 smc03985 CyaF2...”
- The Symbiosis Interactome: a computational approach reveals novel components, functional interactions and modules in Sinorhizobium meliloti
Rodriguez-Llorente, BMC systems biology 2009 - “...these promising results, module 208, for example, includes two nodulation proteins: nodP2 (Smb21223) and nodQ2 (Smb21224); and the novel protein Q92VH5 (SMb21225) [see Additional file 2 ], therefore, being tempting to speculate the participation of the latter in nodulation. The conservation and evolution of the Symbiosis...”
SMa0857 NodQ1 ATP-SULFURYLASE LARGE SUBUNIT)-APS KINASE from Sinorhizobium meliloti 1021
49% identity, 95% coverage
NBC2815_00639 sulfate adenylyltransferase subunit CysN from Xanthomonas fragariae
49% identity, 94% coverage
- Transcriptome analysis of Xanthomonas fragariae in strawberry leaves
Puławska, Scientific reports 2020 - “...was observed. Only three genes, NBC2815_00396, NBC2815_01613 and NBC2815_01676, were upregulated, and four, norM , NBC2815_00639, NBC2815_01397 and NBC2815_02129, were downregulated. Increased expression in strawberry plants was observed for three genes (NBC2815_01235, NBC2815_01669, NBC2815_02506) related to heat shock, which are primarily involved in defence against stress....”
XaFJ1_GM002300 sulfate adenylyltransferase subunit CysN from Xanthomonas albilineans
49% identity, 98% coverage
- Complete Genome Sequence Reveals Evolutionary and Comparative Genomic Features of Xanthomonas albilineans Causing Sugarcane Leaf Scald
Zhang, Microorganisms 2020 - “...of X. oryzae , which is involved in reduction and increase of virulence. XaFJ1_GM002301 and XaFJ1_GM002300 were present in an operon that corresponds to the operon raxP / raxQ of X. oryzae , which is involved in Ax21 tyrosine sulfation. 3.3. Average Nucleotide Identity and Phylogenetic...”
- “...regulatory systems which may sense Ax21 and activate downstream signaling [ 53 ]. XaFJ1_GM002301 and XaFJ1_GM002300 from Xa-FJ1 are two genes corresponding to the operon raxP / raxQ of X. oryzae which is indispensable for the biological activity of Ax21 in the rice bacterial blight pathogen...”
PD0718 ATP sulfurylase large subunit from Xylella fastidiosa Temecula1
49% identity, 97% coverage
XC_0994 ATP sulfurylase/adenylylsulfate kinase from Xanthomonas campestris pv. campestris str. 8004
50% identity, 94% coverage
XAC3328 ATP sulfurylase from Xanthomonas axonopodis pv. citri str. 306
49% identity, 94% coverage
- The sulfur/sulfonates transport systems in Xanthomonas citri pv. citri
Pereira, BMC genomics 2015 - “...with sulfate reduction were also identified and conserved in X. citri . Two genes, nodQ (Xac3328) and cysD (Xac3329) , encode respectively, a fusion protein that consists of the sulfate adenylyltransferase subunit 1/adenylylsulfate kinase or CysNC, as previously has been identified in other microorganisms such as...”
A0KP35 Sulfate adenylyltransferase subunit 1 from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
63% identity, 70% coverage
XOO3396 ATP sulfurylase; adenylylsulfate kinase from Xanthomonas oryzae pv. oryzae KACC10331
48% identity, 95% coverage
VF_0321 sulfate adenylyltransferase subunit 1 from Vibrio fischeri ES114
VF_0321 sulfate adenylyltransferase subunit CysN from Aliivibrio fischeri ES114
64% identity, 67% coverage
AFE_2971 sulfate adenylyltransferase subunit CysN from Acidithiobacillus ferrooxidans ATCC 23270
47% identity, 95% coverage
VSAL_I0421 sulfate adenylyltransferase subunit 1 from Vibrio salmonicida LFI1238
VSAL_I0421 sulfate adenylyltransferase subunit CysN from Aliivibrio salmonicida LFI1238
63% identity, 67% coverage
- Exploring the transcriptome of luxI- and ΔainS mutants and the impact of N-3-oxo-hexanoyl-L- and N-3-hydroxy-decanoyl-L-homoserine lactones on biofilm formation in Aliivibrio salmonicida
Khider, PeerJ 2019 - “...amino acid biosynthesis functional group including the sulfate adenyltransferase subunit 1 and 2 encoded by VSAL_I0421 and VSAL_I0420 , respectively ( Table S6 ). LuxI controls motility in A. salmonicida LFI1238 The flagellum is required for motility of bacteria, mediating their movements toward favorable environments and...”
- Construction of a fur null mutant and RNA-sequencing provide deeper global understanding of the Aliivibrio salmonicida Fur regulon
Thode, PeerJ 2017 - “...superoxide dismutase [Fe] 3.1 RyhB VSAL_II0215 catA catalase 3.4 Metabolism VSAL_I0122 prlC oligopeptidase A 3.2 VSAL_I0421 cysN sulfate adenylyltransferase subunit 1 3.4 RyhB VSAL_I0422 ion transporter superfamily protein 3.8 RyhB VSAL_I0423 cysC adenylylsulfate kinase 4.0 VSAL_I1133 hisG ATP phosphoribosyltransferase 3.4 VSAL_I1769 nrdA ribonucleoside-diphosphate reductase 1 alpha...”
- “...Gottesman, 2005 ; Mey, Craig & Payne, 2005 ). The other identified targets are cysN (VSAL_I0421), VSAL_I0422, tcyP (VSAL_I1813), VSAL_II1026 and VSAL_I0424. Furthermore, we tested other known targets for complementarity to RyhB. Matches were found to gltB and sdhC , which were down-regulated 2.1 and 1.3,...”
K3G22_15145 sulfate adenylyltransferase subunit CysN from Shewanella putrefaciens
64% identity, 66% coverage
A4Y9X2 Sulfate adenylyltransferase subunit 1 from Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
64% identity, 66% coverage
- Comparative Proteomics Reveals the Spoilage-Related Factors of Shewanella putrefaciens Under Refrigerated Condition
Yi, Frontiers in microbiology 2021 - “...A4Y9Z3 Intracellular Up Sulfite reductase [NADPH] flavoprotein alpha-component A4Y9Z4 Intracellular Up Sulfate adenylyltransferase subunit 2 A4Y9X2 Intracellular Up Imidazolonepropionase A4Y1I0 Intracellular Up Sulfate adenylyltransferase A4Y9X3 Intracellular Up Adenylyl-sulfate kinase A4Y9X0 Intracellular Up Histidine ammonia-lyase A4Y1I3 Intracellular Up S-Ribosylhomocysteine lyase A4Y3Y4 Intracellular Up ATP-dependent protease ATPase subunit...”
OCU_15800 adenylyl-sulfate kinase from Mycobacterium intracellulare ATCC 13950
49% identity, 96% coverage
BF1669 sulfate adenylyltransferase subunit 1 from Bacteroides fragilis YCH46
62% identity, 67% coverage
- Human gut bacteria produce ΤΗ17-modulating bile acid metabolites
Paik, Nature 2022 - “...= 2 replicates) ( e ). Western blot of the expression of BF0083, BF0143, BF1060, BF1669, BF2144, and BF3320. Anti-His tag labeling (left). Amido black total protein stain of membrane (right) (n = 2 replicates) ( f ). Western blot of the expression of Bf3538 and...”
Mb1317 PROBABLE BIFUNCTIONAL ENZYME CYSN/CYSC: SULFATE ADENYLTRANSFERASE (SUBUNIT 1) + ADENYLYLSULFATE KINASE from Mycobacterium bovis AF2122/97
49% identity, 95% coverage
SO3726 sulfate adenylyltransferase, subunit 1 from Shewanella oneidensis MR-1
64% identity, 66% coverage
- Cellular response of Shewanella oneidensis to strontium stress
Brown, Applied and environmental microbiology 2006 - “...of California, Berkeley SO3599 SO3723 SO3724 SO3725 SO3726 SO3727 SO3736 SO3737 SO3738 SO3819 SO4026 SO4410 SO4654 SO4655 Mean ratio (SrCl2/control) ata:...”
- “...(SO3599, SO4654, and SO4655), sulfate activation (SO3723, SO3726, and SO3727), and reduction (SO3736, SO3737, and SO3738) Downloaded from http://aem.asm.org/ on...”
- Transcriptome profiling of Shewanella oneidensis gene expression following exposure to acidic and alkaline pH
Leaphart, Journal of bacteriology 2006 - “...so2881 so2903 so3142 so3599 so3600 so3601 so3602 so3723 so3726 so3727 so3728 so3736 so3737 so3738 so3739 so3758 so3764 so3765 so3766 so4652 so4654 so4655 Gene...”
- Global molecular and morphological effects of 24-hour chromium(VI) exposure on Shewanella oneidensis MR-1
Chourey, Applied and environmental microbiology 2006 - “...SO3020 SO3022 SO3061 SO3183 SO3185 SO3189 SO3315 SO3726 SO3727 SO3737 SO3797 SO4265 SO4309 SO4343 SO4686 SOA0003 SOA0004 SOA0160 Alcohol dehydrogenase, zinc...”
DealDRAFT_1193 adenylyl-sulfate kinase from Dethiobacter alkaliphilus AHT 1
46% identity, 96% coverage
CYSNC_MYCTU / P9WNM5 Bifunctional enzyme CysN/CysC; EC 2.7.7.4; EC 2.7.1.25 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
P9WNM5 adenylyl-sulfate kinase (EC 2.7.1.25) from Mycobacterium tuberculosis (see paper)
Rv1286 binfunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein from Mycobacterium tuberculosis H37Rv
MT1324 binfunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein from Mycobacterium tuberculosis CDC1551
49% identity, 95% coverage
- function: With CysD forms the ATP sulfurylase (ATPS) that catalyzes the adenylation of sulfate producing adenosine 5'-phosphosulfate (APS) and diphosphate, the first enzymatic step in sulfur assimilation pathway. APS synthesis involves the formation of a high-energy phosphoric- sulfuric acid anhydride bond driven by GTP hydrolysis by CysN coupled to ATP hydrolysis by CysD.
function: APS kinase catalyzes the synthesis of activated sulfate.
catalytic activity: sulfate + ATP + H(+) = adenosine 5'-phosphosulfate + diphosphate (RHEA:18133)
catalytic activity: adenosine 5'-phosphosulfate + ATP = 3'-phosphoadenylyl sulfate + ADP + H(+) (RHEA:24152)
subunit: Heterodimer composed of CysD, the smaller subunit, and CysNC. - Identification of Mycobacterium tuberculosis Antigens with Vaccine Potential Using a Machine Learning-Based Reverse Vaccinology Approach
Teahan, Vaccines 2021 - “...Mpa (Rv2115c), FtsH (Rv3610c), HtpG (Rv2299c), Tgs4 (Rv3088), Mpt53 (Rv2878c), AccD4 (Rv3799c), UvrB (Rv1633), CysN (Rv1286) Response to starvation halimadienyl diphosphate synthase (Rv3377c), PknD (Rv0931c), CysN (Rv1286) vaccines-09-01098-t003_Table 3 Table 3 Final selection of prospective novel MTB vaccine candidates with sufficiently high Vaxign-ML protegenicity scores, belonging...”
- Implementation of homology based and non-homology based computational methods for the identification and annotation of orphan enzymes: using Mycobacterium tuberculosis H37Rv as a case study
Sinha, BMC bioinformatics 2020 - “...Rv2583c 2.7.6.5 (GTP diphosphokinase) Rv2583c 3.6.2.2 (Phosphoadenylylsulfatase/sulphur metabolism) 3.1.3.7 (3(2),5-biphosphate nucleotidase) Rv2131c 2.7.1.25 (Adenylyl-sulfate kinase) Rv1286 4.1.1.21(Phosphoribosylaminoimidazole carboxylase/purine metabolism) 6.3.4.18 (5-(carboxyamino)imidazole ribonucleotide synthase) Rv3276c 5.4.99.18 (5-(carboxyamino)imidazole ribonucleotide mutase Rv3275c 5.4.99.61(Precorrin isomerase/porphyrin and chlorophyll metabolism) 6.3.5.9 (Hydrogenobyrinic acid a,c-diamide synthase) Rv2847c 2.1.1.132 (Precorrin-6 methyltransferase) Rv2072c 6.2.1.28 (DHCA-CoA...”
- Regulation of the CRISPR-Associated Genes by Rv2837c (CnpB) via an Orn-Like Activity in Tuberculosis Complex Mycobacteria
Zhang, Journal of bacteriology 2018 - “...Rv2010 Rv3174 Rv3615c Rv1130 Rv1554 Rv0384c Rv2025c Rv1286 Rv1805c Rv3614c Rv1552 Rv3616c Rv1809 Rv1639c Rv3824c Rv3171c Rv2006 Rv1757c Rv3000...”
- Integration of Metabolic Modeling with Gene Co-expression Reveals Transcriptionally Programmed Reactions Explaining Robustness in Mycobacterium tuberculosis
Puniya, Scientific reports 2016 - “...top targets for M. tuberculosis persistence 29 . Sulfate adenylyl transferase genes ( Rv1285 and Rv1286 ) are part of stress induced operon 30 . Shi et al. , 2005 has shown that genes of cytochrome oxidase bd are required for adaptation to host immunity 31...”
- “...listed among top targets for M. tuberculosis persistence 29 SADT2 (Sulfate adenyltransferase) ( Rv1285 and Rv1286 ) Purine Metabolism (SADT) CysD and CysN both are part of stress induced operon 30 . Multiple stresses ( GSE10391 ): Up-regulated in 7 samples (out of 28 samples). Hypoxia...”
- Crystal structures of the kinase domain of the sulfate-activating complex in Mycobacterium tuberculosis
Poyraz, PloS one 2015 - “...branching point of sulfur assimilation. The complex consists of two polypeptides, CysD (Rv1285) and CysN (Rv1286). The primary product APS is used in the reductive branch of the APS/PAPS pathway (to the left), which supplies reduced sulfur for the biosynthesis of cysteine. Phosphorylation of APS is...”
- “...on the N-terminus of CysD. The coding sequence for the APS kinase domain of CysN (Rv1286, residues Ser424 to Ser612) was amplified by PCR using Pfu -Turbo DNA polymerase (Stratagene), appropriate primers and the pET-His 6 -CysDN plasmid as template, and cloned into pET28a as a...”
- The Mycobacterium tuberculosis Rv2745c plays an important role in responding to redox stress
McGillivray, PloS one 2014 - “...cysteine synthase Rv1336 4.728 4.767 4.930 4.808 28.013 MT1324 cysN sulfate adenylate transferase, subunit 1 Rv1286 4.620 7.578 6.087 6.095 68.357 MT1323 cysD sulfate adenylate transferase, subunit 2 Rv1285 3.022 3.410 3.629 3.354 10.224 MT1376.1 cysO conserved hypothetical protein Rv1335 4.767 4.635 4.658 4.687 25.825 MT0837...”
- “...MT1377 cysM cysteine synthase Rv1336 ND ND ND MT1324 cysN sulfate adenylate transferase, subunit 1 Rv1286 ND ND ND MT1323 cysD sulfate adenylate transferase, subunit 2 Rv1285 ND ND ND MT1376.1 cysO conserved hypothetical protein Rv1335 ND ND ND MT0837 cysA2 thiosulfate sulfurtransferase Rv0815c ND ND...”
- High-resolution transcriptome and genome-wide dynamics of RNA polymerase and NusA in Mycobacterium tuberculosis
Uplekar, Nucleic acids research 2013 - “...the ATP synthase operon in Exp phase. ( D ) Profile of the rv1285 to rv1286 region in Stat phase. The scale for the number of reads is on the y -axis. Head-to-head comparison of the Exp and Stat data sets was possible by calculation of...”
- Key role for the alternative sigma factor, SigH, in the intracellular life of Mycobacterium avium subsp. paratuberculosis during macrophage stress
Ghosh, Infection and immunity 2013 - “...MAP4225c MAP4224c MAP2599c MAP2058c MAP2485c Rv1127c Rv3464 Rv3465 Rv1286 Rv2131c Rv1285 76.79 95.46 89.28 62.76 69.33 82.37 (Continued on following page) 2252...”
- More
- The Mycobacterium tuberculosis Rv2745c plays an important role in responding to redox stress
McGillivray, PloS one 2014 - “...4.753 4.759 27.069 Sulfate metabolism MT1377 cysM cysteine synthase Rv1336 4.728 4.767 4.930 4.808 28.013 MT1324 cysN sulfate adenylate transferase, subunit 1 Rv1286 4.620 7.578 6.087 6.095 68.357 MT1323 cysD sulfate adenylate transferase, subunit 2 Rv1285 3.022 3.410 3.629 3.354 10.224 MT1376.1 cysO conserved hypothetical protein...”
- “...protein Rv3206c ND ND ND Sulfate metabolism MT1377 cysM cysteine synthase Rv1336 ND ND ND MT1324 cysN sulfate adenylate transferase, subunit 1 Rv1286 ND ND ND MT1323 cysD sulfate adenylate transferase, subunit 2 Rv1285 ND ND ND MT1376.1 cysO conserved hypothetical protein Rv1335 ND ND ND...”
SMDB11_RS00620 sulfate adenylyltransferase subunit CysN from Serratia marcescens subsp. marcescens Db11
60% identity, 68% coverage
- RNA‑seq analyses of antibiotic resistance mechanisms in Serratia marcescens
Li, Molecular medicine reports 2019 - “...respectively. In the IGV screenshot ( Fig. 1A ), we present the locus tags from SMDB11_RS00620 to SMDB11_RS00680. This genomic region was selected picked since most of the samples had a high read coverage. In the IGV plot, the vertical strips (in red, green, blue, or...”
- “...2078.2375 SMDB11_RS00590 0.028280772 SMDB11_RS00595 15 SMDB11_RS14800 2021.148 SMDB11_RS00595 0.028234817 SMDB11_RS04505 14 SMDB11_RS02765 1661.6104 SMDB11_RS14100 0.02822335 SMDB11_RS00620 14 SMDB11_RS16760 1243.2932 SMDB11_RS02545 0.028194726 SMDB11_RS00600 14 SMDB11_RS09335 1066.5082 SMDB11_RS16760 0.028114887 SMDB11_RS09335 13 SMDB11_RS23570 1013.2664 SMDB11_RS23335 0.028103517 SMDB11_RS00625 13 SMDB11_RS21855 1010 SMDB11_RS14910 0.028103517 SMDB11_RS02545 13 SMDB11_RS01845 915.4805 SMDB11_RS02550 0.028097836 SMDB11_RS14100...”
BT0415, BT_0415 sulfate adenylyltransferase subunit 1/adenylylsulfate kinase from Bacteroides thetaiotaomicron VPI-5482
61% identity, 67% coverage
- Characterization of interactions of dietary cholesterol with the murine and human gut microbiome
Le, Nature microbiology 2022 - “...cholesterol sulfotransferase activity in vivo (Fig. 4c ). Analysis of neighbouring genes identified Bt_0411 to Bt_0415 as putative PAPS biosynthetic enzymes. We envision that BT_0412 imports sulfate from the environment, perhaps from the catabolism of sulfated glycans, where BT_0413 to BT_0415 complete PAPS biosynthesis (Fig. 4d...”
- “...cholesterol. Previous work by Bjursell et al. identified that the PAPS synthesis genes Bt_0412 to Bt_0415 were upregulated in suckling mice, suggesting that PAPS biosynthesis could be modulated 51 . To mimic their in vivo results, in vitro analysis of B. thetaiotaomicron was cultured in 10%...”
- A biosynthetic pathway for the selective sulfonation of steroidal metabolites by human gut bacteria
Yao, Nature microbiology 2022 - “...revealed a localized gene cluster containing homologs for adenosine triphosphate (ATP) sulfurylase subunit 1 (CysN, BT0415, E value = 9e-157), ATP sulfurylase subunit 2 (CysD, BT0414, E value = 1e-158), and APS kinase (CysC, BT0413, E value = 2e-58), followed by a hypothetical protein belonging to...”
- “...and btSult homologs in sulfonating bacterial strains Protein query sequences of BT0413 (CysC), BT0414 (CysD), BT0415 (CysN), and BT0416 (BtSult) were aligned against the bacteria selected for activity screening ( Extended Data Figure 3b ) in the NCBI non-redundant protein database 37 , 38 and IMG...”
PXO_02135 CysN/CysC bifunctional enzyme required for AvrXa21 activity Q (raxQ) from Xanthomonas oryzae pv. oryzae PXO99A
48% identity, 94% coverage
- Comparative transcriptome profiling reveals different expression patterns in Xanthomonas oryzae pv. oryzae strains with putative virulence-relevant genes
Zhang, PloS one 2013 - “...0.2518 1.96E-32 True RaxC PXO_02134 0.0819 0.1335 False 0.5034 2.57E-15 True 0.5853 4.15E-23 True RaxP PXO_02135 0.0918 0.0126 False 0.7017 4.51E-56 True 0.7936 1.72E-82 True RaxQ PXO_04479 0.1778 2.23E-07 True 0.9684 8.61E-107 True 1.1462 7.08E-178 True RaxST a The fold change of gene expression is represented...”
- “...and P2 compared with C5. Additionally, raxA (PXO_04478), raxB (PXO_04477), raxC (PXO_02621), raxP (PXO_02134), raxQ (PXO_02135) and raxST (PXO_04479) were also significantly up-regulated ( Table 1 ). However, there was no significant difference in the expression of the phoPQ-regulated protein and the rax genes, except for...”
VP_RS01435 sulfate adenylyltransferase subunit CysN from Vibrio parahaemolyticus RIMD 2210633
62% identity, 67% coverage
CKS_1282 sulfate adenylyltransferase subunit CysN from Pantoea stewartii subsp. stewartii DC283
60% identity, 68% coverage
GM298_06345 sulfate adenylyltransferase subunit CysN from Enterobacter sp. HSTU-ASh6
62% identity, 66% coverage
- Unveiling chlorpyrifos mineralizing and tomato plant-growth activities of Enterobacter sp. strain HSTU-ASh6 using biochemical tests, field experiments, genomics, and in silico analyses
Haque, Frontiers in microbiology 2022 - “...208798.209673 Sulfate/thiosulfate ABC transporter permease CysW cys C GM298_06350 167077.167682 Adenylyl-sulfate kinase 2.7.1.25 cys N GM298_06345 165653.167077 Sulfate adenylyltransferase subunit CysN 2.7.7.4 cys D GM298_06340 164735.165643 Sulfate adenylyltransferase subunit CysD 2.7.7.4 cys H GM298_06325 161245.161979 Phosphoadenosinephosphosulfate reductase 1.8.4.8 cys I GM298_06320 159433.161145 Assimilatory sulfite reductase (NADP)...”
- “...ABC transporter permease CysT Sulfur metabolism cys C GM298_06350 167077.167682 Adenylyl-sulfate kinase 2.7.1.25 cys N GM298_06345 165653.167077 Sulfate adenylyltransferase subunit CysN 2.7.7.4 cys D GM298_06340 164735.165643 Sulfate adenylyltransferase subunit CysD 2.7.7.4 cys H GM298_06325 161245.161979 Phosphoadenosinephosphosulfate reductase 1.8.4.8 cys I GM298_06320 159433.161145 Assimilatory sulfite reductase (NADPH)...”
ESA_RS02420 sulfate adenylyltransferase subunit CysN from Cronobacter sakazakii ATCC BAA-894
61% identity, 66% coverage
- The Global Response of Cronobacter sakazakii Cells to Amino Acid Deficiency
Chen, Frontiers in microbiology 2018 - “...6.78 Adenylyl-sulfate kinase ESA_RS07295 yciW 6.71 Oxidoreductase ESA_RS20880 N/A 6.69 Unknown ESA_RS20875 N/A 6.68 Unknown ESA_RS02420 cysN 6.6 Sulfate adenylyltransferase ESA_RS03740 cysA 6.52 Sulfate ABC transporter ATP-binding protein ESA_RS03675 N/A 6.50 Hypothetical protein ESA_RS11400 artJ 6.46 Arginine ABC transporter substrate-binding protein ESA_RS13095 glnK 6.45 Nitrogen regulatory...”
YPTB0766 ATP-sulfurylase, subunit 1 (ATP:sulfate adenylyltransferase) from Yersinia pseudotuberculosis IP 32953
58% identity, 70% coverage
- IscR is essential for yersinia pseudotuberculosis type III secretion and virulence
Miller, PLoS pathogens 2014 - “...(PAPS) reductase cysH 2.0 YPTB0764 Siroheme synthase cysG 2.4 YPTB0765 ATP-sulfurylase, subunit 2 cysD 4.8 YPTB0766 ATP-sulfurylase, subunit 1 cysN 4.0 YPTB0767 adenosine 5-phosphosulfate kinase cysC 2.7 YPTB2714 cysteine synthase A cysK 3.5 YPTB2732 ABC sulfate transporter, ATP-binding subunit cysA 2.1 YPTB2735 ABC trans, periplasmic thiosulfate-binding...”
ZCP4_1213 sulfate adenylyltransferase subunit CysN from Zymomonas mobilis subsp. mobilis str. CP4 = NRRL B-14023
60% identity, 66% coverage
ZMO0004 sulfate adenylyltransferase subunit 1 from Zymomonas mobilis subsp. mobilis ZM4
60% identity, 66% coverage
E2348C_3021 sulfate adenylyltransferase subunit CysN from Escherichia coli O127:H6 str. E2348/69
60% identity, 68% coverage
ECs_3605 sulfate adenylyltransferase subunit 1 from Escherichia coli O157:H7 str. Sakai
Z4059 ATP-sulfurylase (ATP:sulfate adenylyltransferase), subunit 1, probably a GTPase from Escherichia coli O157:H7 EDL933
ECs3605 ATP-sulfurylase (ATP:sulfate adenylyltransferase), subunit 1, probably a GTPase from Escherichia coli O157:H7 str. Sakai
59% identity, 68% coverage
- Antibacterial efficacy interference of the photocatalytic TiO2 nanoparticle and the lytic bacteriophage vb_EcoS_bov25_1D on the Enterohaemorragic Escherichia coli strain Sakai
Steinbach, Heliyon 2024 - “...synthase complex catalytic subunit protein_coding 914254 2,18786512 ECs_5050 yjcH inner membrane protein protein_coding 914283 2,19153537 ECs_3605 cysN sulfate adenylyltransferase subunit 1 protein_coding 914673 2,19495958 ECs_3999 tdcR threonine dehydratase operon activator protein protein_coding 916156 2,21958706 ECs_4580 escU T3SS structure protein EscU protein_coding 915451 2,2325708 ECs_0340 rclC reactive...”
- Disruption of rcsB by a duplicated sequence in a curli-producing Escherichia coli O157:H7 results in differential gene expression in relation to biofilm formation, stress responses and metabolism
Sharma, BMC microbiology 2017 - “...1.47 0.03 cysA Z3687 Sulfate/thiosulfate transporter +1.50 0.02 cysW Z3688 Sulfate/thiosulfate permease +2.16 3.4E-03 cysN Z4059 Sulfate adenylyltransferase subunit 1 +1.65 0.03 cysJ Z4074 Sulfite reductase subunit alpha +2.12 1.2E-03 Protein metabolism yaeJ Z0203 Peptidyl-tRNA hydrolase domain-containing protein 1.36 0.03 rpmE Z5484 50S ribosomal protein L31...”
- Clonal and antigenic analysis of serogroup A Neisseria meningitidis with particular reference to epidemiological features of epidemic meningitis in the People's Republic of China
Wang, Infection and immunity 1992 - “...Z4742, Z4751, Z4016, Z4017 Z4051, Z4052, Z4053, Z4949 Z4059, Z4077 Z4110 Z4109 Z4018, Z4019, Z4020, Z4021, Z4048, Z4054, Z4058, Z4062, Z4065, Z4066, Z4069,...”
- Physiological Response of Escherichia coli O157:H7 Sakai to Dynamic Changes in Temperature and Water Activity as Experienced during Carcass Chilling
King, Molecular & cellular proteomics : MCP 2016 - “...in nitrogen metabolism ( ECs1321 , ECs1322 , ECs1325 , ECs1327 ), sulfur metabolism ( ECs3605 , cysI / ECs3618 , cysJ / ECs3619 ), and folate biosynthesis ( folA / ECs0051 , moaC / ECs0861 , moaD / ECs0862 , ECs2521 , folB / ECs3941...”
- Global transcriptional response of Escherichia coli O157:H7 to growth transitions in glucose minimal medium
Bergholz, BMC microbiology 2007 - “...ygaM 3.32 2 ECs3022 yohC 6.12 2 ECs3554 alaS -2.20 1 ECs3029 O157 4.04 2 ECs3605 cysN -3.19 1 ECs3030 O157 3.38 2 ECs3617 cysH -2.76 1 ECs3053 yeiJ -2.67 1 ECs3619 cysJ -4.11 1 ECs3055 yeiL 2.38 2 ECs3655 ygdH 2.14 2 ECs3073 yejG 2.91...”
CysN / b2751 sulfate adenylyltransferase subunit 1 (EC 2.7.7.4) from Escherichia coli K-12 substr. MG1655 (see 6 papers)
cysN / P23845 sulfate adenylyltransferase subunit 1 (EC 2.7.7.4) from Escherichia coli (strain K12) (see 4 papers)
CYSN_ECOLI / P23845 Sulfate adenylyltransferase subunit 1; ATP-sulfurylase large subunit; Sulfate adenylate transferase; SAT; EC 2.7.7.4 from Escherichia coli (strain K12) (see 2 papers)
cysN / GB|AAC75793.1 sulfate adenylyltransferase subunit 1; EC 2.7.7.4 from Escherichia coli K12 (see 4 papers)
b2751 sulfate adenylyltransferase subunit 1 from Escherichia coli str. K-12 substr. MG1655
NP_417231 sulfate adenylyltransferase subunit 1 from Escherichia coli str. K-12 substr. MG1655
60% identity, 66% coverage
- function: With CysD forms the ATP sulfurylase (ATPS) that catalyzes the adenylation of sulfate producing adenosine 5'-phosphosulfate (APS) and diphosphate, the first enzymatic step in sulfur assimilation pathway. APS synthesis involves the formation of a high-energy phosphoric- sulfuric acid anhydride bond driven by GTP hydrolysis by CysN coupled to ATP hydrolysis by CysD.
catalytic activity: sulfate + ATP + H(+) = adenosine 5'-phosphosulfate + diphosphate (RHEA:18133)
subunit: Heterodimer composed of CysD, the smaller subunit, and CysN. - Comparative Analysis of Transcriptomic Response of Escherichia coli K-12 MG1655 to Nine Representative Classes of Antibiotics
Bie, Microbiology spectrum 2023 - “...b2750 cysC 6.62 12.11 20.88 11.62 5.31 14.38 13.37 18.23 6.20 Adenylyl-sulfate kinase Sulfur metabolism b2751 cysN 9.37 13.65 10.53 12.43 5.65 13.61 11.04 8.13 5.13 Sulfate adenylyltransferase subunit 1 Sulfur metabolism b2752 cysD 11.02 20.49 39.05 17.08 10.65 21.38 41.75 24.31 16.82 Sulfate adenylyltransferase subunit...”
- A systems approach discovers the role and characteristics of seven LysR type transcription factors in Escherichia coli
Rodionova, Scientific reports 2022 - “...membrane subunit CysU 1.29E05 245 2.0 b1950 fliR Flagellar biosynthesis protein FliR 0.000674 20 2.3 b2751 cysN Sulfate adenylyltransferase subunit 1 2.77E08 297 2.4 b1879 flhA Flagellar biosynthesis protein FlhA 1.37E09 190 2.5 b2752 cysD Sulfate adenylyltransferase subunit 2 2.03E08 249 2.5 b0601 ybdM ParB-like nuclease...”
- An Escherichia coli FdrA Variant Derived from Syntrophic Coculture with a Methanogen Increases Succinate Production Due to Changes in Allantoin Degradation
Kim, mSphere 2021 - “...(R91L) yfjI (b2625) 86.15.0 73.61.4 14.80.4 0 24.11.7 41.51.1 1.10.1 5.90.1 Uncharacterized protein (I384V) cysN (b2751) 82.85.4 77.33.0 14.70.2 0 20.36.4 50.24.2 1.20.1 6.10.1 Sulfate adenylyltransferase subunit 1 (D171E) rob (b4396) 83.95.0 74.77.0 14.12.2 0 16.17.2 51.311.7 1.10.1 6.10.1 Right oriC-binding transcriptional activator (R156S) a The...”
- CysQ of Cryptosporidium parvum, a Protozoa, May Have Been Acquired from Bacteria by Horizontal Gene Transfer
Lee, Genomics & informatics 2012 - “...sequence using TBLASTN with M. tuberculosis CysN (Rv1286) and CysD (Rv1285) and E. coli CysN (b2751), CysD (b2752), and CysC (b2750) proteins as queries. Among class I and II proteins, only CysN showed marginal matches to cgd6_3990 (29% and 33% identities, respectively) to M. tuberculosis and...”
- Gap-filling analysis of the iJO1366 Escherichia coli metabolic network reconstruction for discovery of metabolic functions
Orth, BMC systems biology 2012 - “...R00400 (F) I global orphan R00507 (R) IV yhfW (b3380) 0.47 R00529 (F) IV cysN (b2751) and cysD (b2752) * R00530 (F) IV global orphan R00531 (R) IV global orphan R00695 (R) I global orphan R00709 (F) IV dmlA (b1800) 6.00E-26 icd (b1136) 1.00E-26 leuB (b0073)...”
- OmicsAnalyzer: a Cytoscape plug-in suite for modeling omics data
Xia, Bioinformatics (Oxford, England) 2010 - “...B, two genes tauA (b0365) and tauB (b0366), which might be related to gene cysN (b2751) in the dataset are selected to apply the scatter plotting. User can easily see the expression profile of gene tauB is more related to gene cysN than tauA . More...”
- Genome-scale analysis to the impact of gene deletion on the metabolism of E. coli: constraint-based simulation approach
Xu, BMC bioinformatics 2009 - “...b2600 b3389 SS AAM FM ACM HM CM genes b0928 b1415 b1415 b2019, b2020 b2750, b2751 b3941 b3608 b2021, b2022 b2752, b2762 b2023, b2024 b2763, b2764 b2025, b2026 b3607 SS IITM OP U genes b3040 b3731, b3732 s0001 b3196 b3733, b3734 s0001 b3735, b3736 b3737, b3738...”
- The Crp-activated small noncoding regulatory RNA CyaR (RyeE) links nutritional status to group behavior
De, Journal of bacteriology 2009 - “...286.7 11.3 2,304.7 390.2 5.91 8.6 luxS cysN b2687 b2751 6,105.7 2,528.7 1,961.7 211.1 3.11 12.0 5,417.7 127.3 1,589.3 24 3.41 5.30 3.3 8.6 cysH b2762 2,125.2...”
- More
- The DNA sequence of the sulfate activation locus from Escherichia coli K-12.
Leyh, The Journal of biological chemistry 1992 (PubMed)- GeneRIF: N-terminus verified by Edman degradation on complete protein
- A comprehensive spectral assay library to quantify the Escherichia coli proteome by DIA/SWATH-MS
Midha, Scientific data 2020 - “...56 . An example of an up-regulated protein is Sulfate adenylyltransferase subunit 1 (cysN) (UniProt P23845), a component of the enzyme ATP sulfurylase, which is known to play an important role in sulfur metabolism in E. coli 57 , 58 ( Supplementary Fig. 7f ). It...”
SF5M90T_2675 sulfate adenylyltransferase subunit CysN from Shigella flexneri 5a str. M90T
59% identity, 68% coverage
- RNA-seq analysis of the influence of anaerobiosis and FNR on Shigella flexneri
Vergara-Irigaray, BMC genomics 2014 - “...permease 1.69 SF5M90T_1185 iron ABC transporter ATP-binding protein 1.52 SF5M90T_4057 yjcE predicted cation/proton antiporter 1.49 SF5M90T_2675 cysN ATP-sulfurylase (ATP:sulfate adenylyltransferase), subunit 1 1.08 -2.08 -2.05 SF5M90T_448 ybaL putative transport protein -1.01 -0.50 SF5M90T_2386 mntH divalent metal cation transporter -1.93 1.61 1.68 SF5M90T_330 tauC taurine transport system...”
AEX15_22530 sulfate adenylyltransferase subunit CysN from Salmonella enterica subsp. enterica serovar Kentucky
60% identity, 66% coverage
SENTW_3021 sulfate adenylyltransferase subunit CysN from Salmonella enterica subsp. enterica serovar Weltevreden str.
60% identity, 66% coverage
SeKA_A2451 sulfate adenylyltransferase subunit CysN from Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188
60% identity, 66% coverage
SEN2773 Sulfate adenylyltransferase subunit 1 from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
60% identity, 66% coverage
STM2934 ATP-sulfurylase, subunit 1 (ATP:sulfate adenylyltransferase) from Salmonella typhimurium LT2
60% identity, 66% coverage
SPC_2977 sulfate adenylyltransferase subunit 1 from Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
58% identity, 70% coverage
- Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
Liu, Plants (Basel, Switzerland) 2023 - “...0.151 Xanthine phosphoribosyltransferase SPC_1145 0.173 Bifunctional GMP synthase/glutamine amidotransferase protein SPC_4706 0.279 Purine nucleoside phosphorylase SPC_2977 0.281 Sulfate adenylyltransferase subunit 1 SPC_2978 0.281 Sulfate adenylyltransferase subunit 2 SPC_1144 0.295 Inositol-5-monophosphate dehydrogenase SPC_0502 0.454 Adenylate kinase SPC_1952 0.483 Ribose-phosphate pyrophosphokinase SPC_4695 2.018 Nucleotidase SPC_4513 2.067 Adenylosuccinate synthetase...”
BDOA9_0203370 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase from Bradyrhizobium sp. DOA9
46% identity, 89% coverage
- Genome analysis of a novel Bradyrhizobium sp. DOA9 carrying a symbiotic plasmid
Okazaki, PloS one 2015 - “...sp. BH72 (42%) nodW BDOA9_0203310 B . japonicum USDA110 (67%), Azoarcus sp. BH72 (57%) nodQ BDOA9_0203370 Bradyrhizobium sp. ORS278 (53%), Mesorhizobium loti MAFF303099 (48%), Sinorhizobium fredii NGR234 (48%) nodP BDOA9_0203380 Bradyrhizobium sp. ORS278 (73%), Azospirillum sp. B510 (71%), Bradyrhizobium sp. BTAi1 (70%) noeE BDOA9_0203390 S ....”
ZPR_0541 Sulfate adenylyltransferase, large subunit from Zunongwangia profunda SM-A87
56% identity, 65% coverage
cysN / Q9L9U8 sulfate adenylyltransferase large subunit (EC 2.7.7.4) from Allochromatium vinosum (see paper)
Alvin_2449 sulfate adenylyltransferase, large subunit from Allochromatium vinosum DSM 180
55% identity, 65% coverage
CjjRM3420_1436 sulfate adenylyltransferase subunit CysN from Campylobacter jejuni subsp. jejuni str. RM3420
50% identity, 67% coverage
- Biomolecule sulphation and novel methylations related to Guillain-Barré syndrome-associated Campylobacter jejuni serotype HS:19
Heikema, Microbial genomics 2021 - “...ST-403/HS:23-mix, radom CjjRM3420_1435, cysD sulphate adenylyltransferase subunit 2 100 8 ST-508/HS:4, ST-460/HS:4, ST-206/HS:4, ST-1435/HS: 1437 CjjRM3420_1436, cysN sulphate adenylyltransferase subunit 1 sialylation / sulphation 100 8 CjjRM3420_1437 a anion permase, putative sodium/sulphate cotransporter, E 2.8e-24 100 8 CjjRM3420_1438, cysC adenylylsulphate kinase 100 8 CjjRM3420_1439 b putative...”
LIMLP_17220 sulfate adenylyltransferase subunit 1 from Leptospira interrogans serovar Manilae
55% identity, 65% coverage
AFE_3125 sulfate adenylyltransferase subunit 1 from Acidithiobacillus ferrooxidans ATCC 23270
50% identity, 65% coverage
Bamb_2520 sulfate adenylyltransferase, large subunit from Burkholderia cepacia AMMD
50% identity, 65% coverage
- Identification of quorum sensing-controlled genes in Burkholderia ambifaria
Chapalain, MicrobiologyOpen 2013 - “...29 R Spermidine synthase-like protein (SpeE) 1 Bamb_2404 + 131 4 M Hypothetical protein 1 Bamb_2520 235 5/6 30 R Sulfate adenylyltransferase, large subunit (cysN) 1 Bamb_3128 + 170 22 I Hypothetical protein 2 Bamb_3350 + 572 (2) 6/6 30 R Tryptophan synthase subunit alpha (trpA)...”
- “...Fig. 5 A). For instance, the mutant in which the transposon has interrupted the gene Bamb_2520 (renamed trBamb_2520 to avoid confusion with the gene itself) displayed an activity nearly four times lower that the one of the control following C 8 -HSL addition. On the other...”
NGR_c06940 sulfate adenylyltransferase, subunit 1 from Rhizobium sp. NGR234
49% identity, 71% coverage
C3R74_06340 sulfate adenylyltransferase subunit 1 from Acidithiobacillus ferridurans
49% identity, 65% coverage
SAMCCGM7_Ch0999 sulfate adenylyltransferase subunit CysN from Sinorhizobium americanum CCGM7
49% identity, 71% coverage
BB3447 sulfate adenylyltransferase subunit 1 from Bordetella bronchiseptica RB50
51% identity, 65% coverage
BM43_2813 sulfate adenylyltransferase subunit 1 from Burkholderia gladioli
48% identity, 66% coverage
BMA0667 sulfate adenylyltransferase, subunit 1 from Burkholderia mallei ATCC 23344
49% identity, 66% coverage
cysN / P56893 sulfate adenylyltransferase α subunit (EC 2.7.7.4) from Rhizobium meliloti (strain 1021) (see paper)
P56893 Sulfate adenylyltransferase subunit 1 from Rhizobium meliloti (strain 1021)
SMc00090 PUTATIVE SULFATE ADENYLATE TRANSFERASE CYSTEINE BIOSYNTHESIS PROTEIN from Sinorhizobium meliloti 1021
47% identity, 75% coverage
CLP_2257 sulfate adenylyltransferase subunit 1 from Clostridium butyricum E4 str. BoNT E BL5262
48% identity, 65% coverage
Bphy_2231 sulfate adenylyltransferase, large subunit from Burkholderia phymatum STM815
Bphy_2231 sulfate adenylyltransferase subunit 1 from Paraburkholderia phymatum STM815
49% identity, 66% coverage
- Metabolomics and Transcriptomics Identify Multiple Downstream Targets of Paraburkholderia phymatum σ54 During Symbiosis with Phaseolus vulgaris
Lardi, International journal of molecular sciences 2018 - “...sulfate-binding protein 1.7 Bphy_1647 ABC transporter-like protein 2.9 Bphy_1648 transport systems inner membrane component 2.7 Bphy_2231 sulfate adenylyltransferase large subunit 2.2 Bphy_2235 sulfite reductase 2.0 Bphy_3602 ABC transporter related 1.7 Bphy_3603 ABC transporter periplasmic ligand-binding protein 2.4 Bphy_5040 NlpA lipoprotein 4.0 Bphy_5227 ABC-type glycine betaine transport...”
- Transcriptome Analysis of Paraburkholderia phymatum under Nitrogen Starvation and during Symbiosis with Phaseolus Vulgaris
Lardi, Genes 2017 - “...ABC transporter, periplasmic protein 5.2 Bphy_1647 ABC transporter-like protein 5.9 Bphy_1648 binding-protein-dependent transport systems 3.3 Bphy_2231 sulfate adenylyltransferase large subunit 2.3 Bphy_2521 catalase 4.9 Bphy_3120 phosphate ABC transporter, periplasmic protein 4.2 Bphy_3602 ABC transporter related 4.0 Bphy_3603 nitrate/sulfonate/bicarbonate ABC transporter, periplasmic protein 2.6 Bphy_3854 phosphate transporter...”
- Metabolomics and Dual RNA-Sequencing on Root Nodules Revealed New Cellular Functions Controlled by Paraburkholderia phymatum NifA
Bellés-Sancho, Metabolites 2021 - “...complex SoxCD (Bphy_7230-31), a potential taurine transporter (Bphy_6080/81), the sulfurtransferase Bphy_6245 converting thiosulfate into sulfite, Bphy_2231 coding for a sulfate adenylyltransferase, Bphy_3604 encoding a TauD/TfdA family dioxygenase, which potentially converts taurine into sulfite, and Bphy_7479 potentially involved in producing cysteine from sulfide. Additionally, cysN (Bphy_2231), coding...”
SACE_1473 sulfate adenylyltransferase subunit 1 / adenylylsulfate kinase from Saccharopolyspora erythraea NRRL 2338
48% identity, 64% coverage
- Temporal dynamics of the Saccharopolyspora erythraea phosphoproteome
Licona-Cassani, Molecular & cellular proteomics : MCP 2014 - “...IV & VII Profile C SACE_1449 SACE_1473 SACE_2177-2 SACE_6385-2 SACE_0195-1 SACE_3899 SACE_3448 SACE_4140-2 SACE_6118 SACE_5364 SACE_6385-1 SACE_4660 SACE_6838-2...”
- “...-0.6 -0.5 30 -0.4 0.8 8 50 100 1.4 log PA o o 14 40 90 SACE_1473 1.6 0.8 30 80 8 20 ) SACE_3899 -0.2 20 -0.2 6 o 50 0 log PA 40 10 12 log PA 30 14 log PA 10 12...”
RSUY_25000, RSUY_RS12245 sulfate adenylyltransferase subunit 1 from Ralstonia solanacearum
48% identity, 66% coverage
- Transcriptomes of Ralstonia solanacearum during Root Colonization of Solanum commersonii
Puigvert, Frontiers in plant science 2017 - “...2.23 nifS Cysteine desulfurase IscS RSUY_RS12250 RSUY_25010 RSc2422 2.14 cysD Sulfate adenylyltransferase small subunit RSUY_RS12245 RSUY_25000 RSc2421 1.89 cysN Sulfate adenylyltransferase RSUY_RS07025 RSUY_14400 RSc1020 1.60 nifU Iron-sulfur cluster scaffold-like protein RSUY_RS17845 RSUY_36540 RSp1519 3.36 Membrane protein Cofactor metabolism and transport RSUY_RS11705 RSUY_23850 RSc2077 1.85 ilvI acetolactate...”
- “...RSc1019 2.23 nifS Cysteine desulfurase IscS RSUY_RS12250 RSUY_25010 RSc2422 2.14 cysD Sulfate adenylyltransferase small subunit RSUY_RS12245 RSUY_25000 RSc2421 1.89 cysN Sulfate adenylyltransferase RSUY_RS07025 RSUY_14400 RSc1020 1.60 nifU Iron-sulfur cluster scaffold-like protein RSUY_RS17845 RSUY_36540 RSp1519 3.36 Membrane protein Cofactor metabolism and transport RSUY_RS11705 RSUY_23850 RSc2077 1.85 ilvI...”
Q9ADG6 sulfate adenylyltransferase from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
SCO6097 sulfate adenylyltransferase subunit 1 from Streptomyces coelicolor A3(2)
48% identity, 66% coverage
- Functional genomics and expression analysis of the Corynebacterium glutamicum fpr2-cysIXHDNYZ gene cluster involved in assimilatory sulphate reduction
Rückert, BMC genomics 2005 - “...Cg3114 (CysN) 433 5.08 46.9 Q8FM67 C. efficiens Putative sulphate adenylyltransferase SU 1 0.0 84/90% Q9ADG6 S. coelicolor Sulphate adenylyltransferase SU 1 3e-lll 55/67% Q10600 M. tuberculosis Sulphate adenylyltransferase SU 1 1e-104 50/69% Cg3115 (CysD) 304 5.09 34.3 Q8FM66 C. efficiens Putative sulphate adenylyltransferase 7e-168 95/96%...”
- Deciphering the Transcriptional Response Mediated by the Redox-Sensing System HbpS-SenS-SenR from Streptomycetes
Busche, PloS one 2016 - “...3.19 9.13 SCO6095 ssuB ABC transporter ATP-binding protein 3.81 14.03 SCO6096 ssuA lipoprotein 4.05 16.56 SCO6097 cysN sulfate adenylyltransferase subunit 1 3.91 15.03 SCO6098 cysD sulfate adenylyltransferase subunit 2 3.4 10.56 SCO6099 cysC adenylylsulfate kinase 3.51 11.39 SCO6100 cysH phosphoadenosine phosphosulfate reductase 4.09 17.03 SCO6101 hypothetical...”
- “...then converted to 3-phosphoadenylyl sulfate (PAPS) by the concerted action of enzymes encoded by cysN (SCO6097), cysD (SCO6098) and cysC (SCO6099). The gene product of cysH (SCO6100) converts PAPS to sulfite. cysA (SCO4164) and cysI (SCO6102) encode sulfite reductase and thiosulfate sulfurtransferase, which catalyze the formation...”
- Genome-scale analysis reveals a role for NdgR in the thiol oxidative stress response in Streptomyces coelicolor
Kim, BMC genomics 2015 - “...Leucine SCO5562 thiL Thiamin monophosphate kinase 3.2.14 Thiamine * SCO5563 thiD Phosphomethylpyrimidine kinase 3.3.14 Thiamine SCO6097 cysN Sulfate adenylyltransferase subunit 1 3.3.19 Sulfur metabolism SCO6098 cysD Sulfate adenylyltransferase subunit 2 3.3.19 Sulfur metabolism SCO6099 cysC Adenylylsulphate kinase 3.3.19 Sulfur metabolism SCO6100 cysH Phosphoadenosine phosphosulfate reductase 3.3.19...”
- “...has been suggested in previous reports [ 28 , 29 ]. The genes, including cysN (SCO6097), cysD (SCO6098), and cysC (SCO6099), participate in 3-phosphoadenylyl sulfate (PAPS) formation from sulfate. PAPS reductase encoded by cysH (SCO6100) converts PAPS to sulfite. The serial reactions are followed by two...”
- Genome-wide transcriptome analysis reveals that a pleiotropic antibiotic regulator, AfsS, modulates nutritional stress response in Streptomyces coelicolor A3(2)
Lian, BMC genomics 2008 - “...( ssuB ) 0.08 SCO6096 Aliphatic sulfonate ABC transporter, binding lipoprotein ( ssuA ) 0.18 SCO6097 Sulfate adenylyltransferase subunit 1 ( cysN ) 0.27 SCO6098 Sulfate adenylyltransferase subunit 2 ( cysD ) 0.25 SCO6099 Adenylylsulfate kinase ( cysC ) 0.19 SCO6100 Phosphoadenosine phosphosulfate reductase ( cysH...”
RSc2421 PROBABLE SULFATE ADENYLYLTRANSFERASE SUBUNIT 1 PROTEIN from Ralstonia solanacearum GMI1000
46% identity, 66% coverage
- Transcriptomes of Ralstonia solanacearum during Root Colonization of Solanum commersonii
Puigvert, Frontiers in plant science 2017 - “...nifS Cysteine desulfurase IscS RSUY_RS12250 RSUY_25010 RSc2422 2.14 cysD Sulfate adenylyltransferase small subunit RSUY_RS12245 RSUY_25000 RSc2421 1.89 cysN Sulfate adenylyltransferase RSUY_RS07025 RSUY_14400 RSc1020 1.60 nifU Iron-sulfur cluster scaffold-like protein RSUY_RS17845 RSUY_36540 RSp1519 3.36 Membrane protein Cofactor metabolism and transport RSUY_RS11705 RSUY_23850 RSc2077 1.85 ilvI acetolactate synthase...”
XNR_0715 sulfate adenylyltransferase subunit 1 from Streptomyces albidoflavus
48% identity, 64% coverage
NMBNZ0533_1164 sulfate adenylyltransferase subunit 1 from Neisseria meningitidis NZ-05/33
48% identity, 66% coverage
NMV_1236 sulfate adenylyltransferase subunit 1 from Neisseria meningitidis 8013
48% identity, 66% coverage
NCgl2715 GTP-binding protein from Corynebacterium glutamicum ATCC 13032
cg3114 Sulfate adenyltransferase subunit 1 from Corynebacterium glutamicum ATCC 13032
44% identity, 65% coverage
- Understanding the high L-valine production in Corynebacterium glutamicum VWB-1 using transcriptomics and proteomics
Zhang, Scientific reports 2018 - “...and metal homeostasis 37 NCgl0120 cg0156 Crp family regulatory proteins 5.29/40102.42 566.47 0.00 2.0 48 NCgl2715 cg3114 cysN Sulfate adenyltransferase subunit 1 5.08/46871.63 1150.85 0.00 1.6 58 NCgl2943 cg3375 Predicted nucleoside-diphosphate-sugar epimerase 5.19/22803.57 1811.41 357.77 4.6 89 NCgl1875 cg2136 gluA Glutamate uptake system ATP-binding protein 5.67/26537.86...”
- Regulation of L-lactate utilization by the FadR-type regulator LldR of Corynebacterium glutamicum
Georgi, Journal of bacteriology 2008 - “...lldR led to twofold decreases in the mRNA levels of NCgl2715 and ldhA, as well as to strongly decreased mRNA levels of lldD and NCgl2816 (25- and 11-fold...”
- “...mRNA level relative to WT(pVWEx1) Annotation NCgl2715 NCgl2737 NCgl2810 (ldhA) NCgl2814 (lldR) NCgl2816 NCgl2817 (lldD) Sulfate adenyltransferase subunit...”
- Adaptation of Corynebacterium glutamicum to ammonium limitation: a global analysis using transcriptome and proteome techniques
Silberbach, Applied and environmental microbiology 2005 - “...betP 2.13 Choline-glycine-betaine transporter Nitrogen metabolism NCgl2715 NCgl2716 NCgl2717 NCgl2718 NCgl2719 cg3114 cg3115 cg3116 cg3118 cg3119 cysN cysD...”
- Functional Genomics Uncovers Pleiotropic Role of Rhomboids in Corynebacterium glutamicum
Luenenschloss, Frontiers in microbiology 2022 - “...protein TerC (Cg2157) were much less abundant at 40C; concerning sulfur metabolism, sulfate adenylate transferase (Cg3114) was less abundant in the MF at 40C, sulfite Reductase (Cg3118) more abundant in the CF, and sulfate permease (Cg1195) in the MF at 30C. Amounts of periplasmic component of...”
- Physiology and Transcriptional Analysis of (p)ppGpp-Related Regulatory Effects in Corynebacterium glutamicum
Ruwe, Frontiers in microbiology 2019 - “...C4-dicarboxylate transporter, tripartite ATP-independent transporter (TRAP-T) family 1.46 1.04406E29 cg3113 cysY sirohydrochlorin ferrochelatase 1.01 5.6237E07 cg3114 cysN sulfate adenylyltransferase subunit 1 1.03 4.76049E11 cg3116 cysH adenosine phosphosulfate reductase 1.16 2.57338E11 cg3117 cysX ferredoxin-like protein, involved in electron-transfer 1.06 4.3445E08 cg3118 cysI ferredoxin-sulfite reductase 1.10 2.31364E15 cg0507...”
- “...8.00 9.74E72 0.52 0.526895 R A R cg3116 cysH 7.96 9.12E64 0.24 R A R cg3114 cysN 7.93 6.7E109 -1.1 0.145052 R A R cg3399 6.34 0 0.6 0.435792 cg3391 idhA1 5.90 7.57E91 4.84 1.22E24 cg0762 prpC2 5.76 0 1.58 A cg0760 prpB2 5.66 1.3E118 1.65...”
- Understanding the high L-valine production in Corynebacterium glutamicum VWB-1 using transcriptomics and proteomics
Zhang, Scientific reports 2018 - “...metal homeostasis 37 NCgl0120 cg0156 Crp family regulatory proteins 5.29/40102.42 566.47 0.00 2.0 48 NCgl2715 cg3114 cysN Sulfate adenyltransferase subunit 1 5.08/46871.63 1150.85 0.00 1.6 58 NCgl2943 cg3375 Predicted nucleoside-diphosphate-sugar epimerase 5.19/22803.57 1811.41 357.77 4.6 89 NCgl1875 cg2136 gluA Glutamate uptake system ATP-binding protein 5.67/26537.86 0.00...”
- Quinone-dependent D-lactate dehydrogenase Dld (Cg1027) is essential for growth of Corynebacterium glutamicum on D-lactate
Kato, BMC microbiology 2010 - “...1,0 cg2937 ABC-type transporter, periplasmic component 4,6 0,9 cg2938 ABC-type transporter, permease component 4,1 1,5 cg3114 sulfate adenylate transferase subunit 1 2,2 0,2 cg3116 phosphoadenosine phosphosulfate reductase 2,2 0,1 cg3118 putative nitrite reductase 2,3 0,2 cg3303 hypothetical protein 4,0 1,5 a Gene identifiers and annotations are...”
- Functional genomics of pH homeostasis in Corynebacterium glutamicum revealed novel links between pH response, oxidative stress, iron homeostasis and methionine synthesis
Follmann, BMC genomics 2009 - “...3.31 n.d. - - - - - - - - - DtxR, McbR*, CysR* 75 cg3114 ah cysN GTPases-Sulfate adenylate transferase subunit 1 0 3.42 0.48 4.4 1.4 3.2 6.2 4.1 4.0 4.6 3.1 1.0 DtxR, McbR*, CysR* 76 cg3115 ah cysD 3-phosphoadenosine 5-phosphosulfate sulfotransferase (PAPS...”
- Global gene expression during stringent response in Corynebacterium glutamicum in presence and absence of the rel gene encoding (p)ppGpp synthase
Brockmann-Gretza, BMC genomics 2006 - “...1.83 2.93 clpP2 ATP-dependent Clp protease, proteolytic subunit OU cg2732 1.68 2.41 gntV gluconokinase G cg3114 1.55 2.90 cysN sulfate adenyltransferase subunit 1 P cg3327 3.03 2.89 dps starvation-induced DNA protecting protein P a L ocus tag according to [50] b COG class according to [11]...”
- Functional genomics and expression analysis of the Corynebacterium glutamicum fpr2-cysIXHDNYZ gene cluster involved in assimilatory sulphate reduction
Rückert, BMC genomics 2005 - “...to the identification of a cluster of four CDS ( cg3118, cg3116, cg3115 , and cg3114 ) in C. glutamicum which might be the orthologues of the E. coli genes cysI, cysH, cysD , and cysN (Table 1 and Figure 1 ), while no genes with...”
- “...B. megaterium Sirohydrochlorin ferrochelatase SirB 5e-16 28/45% Q93RW8 S. coelicolor Hypothetical protein SC01858 2e-13 31/43% Cg3114 (CysN) 433 5.08 46.9 Q8FM67 C. efficiens Putative sulphate adenylyltransferase SU 1 0.0 84/90% Q9ADG6 S. coelicolor Sulphate adenylyltransferase SU 1 3e-lll 55/67% Q10600 M. tuberculosis Sulphate adenylyltransferase SU 1...”
- Adaptation of Corynebacterium glutamicum to ammonium limitation: a global analysis using transcriptome and proteome techniques
Silberbach, Applied and environmental microbiology 2005 - “...transporter Nitrogen metabolism NCgl2715 NCgl2716 NCgl2717 NCgl2718 NCgl2719 cg3114 cg3115 cg3116 cg3118 cg3119 cysN cysD cysH cysI cysJ 0.43 0.40 0.55 0.42...”
Q8FM67 sulfate adenylyltransferase from Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
44% identity, 65% coverage
bll1475 NodQ bifunctional enzyme from Bradyrhizobium japonicum USDA 110
33% identity, 95% coverage
MPNT_10355 adenylyl-sulfate kinase from Candidatus Methylacidithermus pantelleriae
34% identity, 95% coverage
A9H0W3 Adenylyl-sulfate kinase from Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
35% identity, 93% coverage
BDOA9_0121760 adenylyl-sulfate kinase from Bradyrhizobium sp. DOA9
33% identity, 95% coverage
VZ55_RS06350 adenylyl-sulfate kinase from Gluconobacter oxydans
34% identity, 92% coverage
- Osmotic stress tolerance and transcriptome analysis of Gluconobacter oxydans to extra-high titers of glucose
Liu, Frontiers in microbiology 2022 - “...reductase and subsequently transferred onto O-acetylserine to yield cysteine. Four DEGs involved in first route (VZ55_RS06350, VZ55_RS06345, VZ55_RS06340, and VZ55_RS09905), 10 DEGs involved in the second route (VZ55_RS12750, VZ55_RS12775, VZ55_RS12825, VZ55_RS13290, VZ55_RS13365, VZ55_RS12795, VZ55_RS13385, VZ55_RS12790, VZ55_RS13275, and VZ55_RS12785), and 3 DEGs associated with the conversion of...”
CAC0110 GTPase, sulfate adenylate transferase subunit 1 from Clostridium acetobutylicum ATCC 824
35% identity, 76% coverage
GSU1718 GTPases - Sulfate adenylate transferase subunit 1 from Geobacter sulfurreducens PCA
40% identity, 65% coverage
DSY2951 adenylylsulfate kinase/sulfate adenylyltransferase subunit 1 from Desulfitobacterium hafniense Y51
31% identity, 88% coverage
WS1008 GTPASE, SULFATE ADENYLATE TRANSFERASE SUBUNIT 1 from Wolinella succinogenes DSM 1740
35% identity, 65% coverage
- Protein thiocarboxylate-dependent methionine biosynthesis in Wolinella succinogenes
Krishnamoorthy, Journal of the American Chemical Society 2011 - “...The putative thiocarboxylate forming protein, WS1007 (shown in green), clustered with sulfate assimilation proteins WS1004, WS1008, WS1009 and WS1010, and homocysteine biosynthetic proteins, WS1012 and WS1015 in Wolinella succinogenes . Hypothetical functions for these genes are given in Table 1 . Figure 3 The three well-characterized...”
- “...to sulfur transfer * WS1007, NP_907209 (hcyS-ala) Sulfur transfer protein involved in methionine biosynthesis * WS1008 and WS1009, NP_907210 and NP_907211 (cysD and cysN) Sulfate adenylyltransferase, subunits 1 and 2 WS1010, NP_907212 (cysH) Phosphoadenylyl-sulfate reductase/Adenylyl-sulfate reductase WS1011, NP_907213 Conserved hypothetical protein probably involved in assimilatory sulfate...”
A3MV69 Elongation factor 1-alpha from Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Pcal_1111 translation elongation factor EF-1, subunit alpha from Pyrobaculum calidifontis JCM 11548
35% identity, 66% coverage
MJ0324 translation elongation factor EF-1, subunit alpha from Methanocaldococcus jannaschii DSM 2661
35% identity, 65% coverage
AF0937 translation elongation factor EF-1, subunit alpha (tuf) from Archaeoglobus fulgidus DSM 4304
35% identity, 66% coverage
aEF-1alpha / CAA54162.1 elongation factor 1 from Saccharolobus solfataricus (see paper)
34% identity, 66% coverage
SiRe_1776 translation elongation factor EF-1 subunit alpha from Saccharolobus islandicus REY15A
34% identity, 66% coverage
- Phosphoproteomic Analysis Reveals Rio1-Related Protein Phosphorylation Changes in Response to UV Irradiation in Sulfolobus islandicus REY15A
Huang, Frontiers in microbiology 2020 - “...0.494, 0.691, 0.661 Y303, T351 0.637, 0.645 SiRe_1010 FHA domain containing protein (FHA) T97 0.660 SiRe_1776 Elongation factor 1- (EF1-) T281 0.740 1.801 2.048 T284 1.742 1.947 S196, S244 1.333, 1.505 T327 1.385 SiRe_1281 Elongation factor 2 (EF2) S662 1.887 SiRe_0668 DNA-binding 7 kDa protein (Sis7d)...”
- “...S472 1.481 Glycosylated S-layer protein, SlaA SiRe_1716 Y310 1.417, 1.526 Thermosome SiRe_1716 S325 0.524 Thermosome SiRe_1776 T281 0.740 Elongation factor 1-alpha SiRe_1776 S196, S244 1.333, 1.505 Elongation factor 1-alpha SiRe_1800 S97 0.632 Phosphoglucosamine mutase SiRe_1800 S97 1.390 Phosphoglucosamine mutase SiRe_1851 T204 0.703 Lysine biosynthesis enzyme LysX...”
P35021 protein-synthesizing GTPase (EC 3.6.5.3) from Saccharolobus solfataricus (see 2 papers)
WP_010922916 translation elongation factor EF-1 subunit alpha from Saccharolobus solfataricus P2
SSO0216 Elongation factor 1-alpha (elongation factor tu) (EF-tu) (tuF-1) from Sulfolobus solfataricus P2
34% identity, 66% coverage
- Stability against temperature of Sulfolobus solfataricus elongation factor 1 alpha, a multi-domain protein.
Granata, Biochimica et biophysica acta 2008 (PubMed)- GeneRIF: Data indicate that the unfolding process is cooperative with no intermediate species and that the few inter-domain contacts identified in the crystal structure of SsEF-1 alpha play a role also at high temperatures.
- Multiple molecular dynamics simulation of the isoforms of human translation elongation factor 1A reveals reversible fluctuations between "open" and "closed" conformations and suggests specific for eEF1A1 affinity for Ca2+-calmodulin.
Kanibolotsky, BMC structural biology 2008 - “...Q05639 ], Yeast yeast eEF1A [Swiss-Prot: P02994 ], S. Solfataricus aEF1A of Sulfolobus solfataricus [Swiss-Prot: P35021 ], T. Aquaticus EF-Tu of Termus Aquaticus [Swiss-Prot: Q01698 ]. Replacements and deletion in eEF1A1 and eEF1A2 are marked in red. Higher eukaryotic eEF1A has so far been resistant to...”
- Novel insights into gene regulation of the rudivirus SIRV2 infecting Sulfolobus cells
Okutan, RNA biology 2013 - “...as well as translational elongation factor IA (eEF1A, sso0216 ), were also downregulated on SIRV2 infection. Rubrerythrin (Rbrs) is predominantly found in...”
- “...), thermosome subunit (sso0862), elongation factor 1alpha (sso0216 ), a protein containing a fork-head-associated domain (sso1088) and a hypothetical protein...”
- Something old, something new, something borrowed; how the thermoacidophilic archaeon Sulfolobus solfataricus responds to oxidative stress
Maaty, PloS one 2009 - “...16504 7.82 163 1.27E-03 6.29E-02 3.20E-02 2.35 25 COG1958 Y Translation elongation factor EF-1alpha * SSO0216 48573 8.93 540 3.00E-02 1.64E-01 8.32E-02 2.03 22 COG0050 Y Peroxiredoxin (putative) SSO2121 24786 6.85 119 2.21E-02 1.50E-01 7.61E-02 1.93 26 COG0450 Y Superoxide dismutase [Fe] (sod) SSO0316 24228 6.71...”
- “...oxidative stress is Translation Elongation Factor 1A (eEF1A), which is also up-regulated in this study (SSO0216). In the H9c2 rat embryonic cell line, EF-1 protein levels undergo rapid increase upon treatment with H 2 O 2 [77] . It is worth noting that mouse eEF1A-2 interacts...”
Igni_1150 translation elongation factor 1A (EF-1A/EF-Tu) from Ignicoccus hospitalis KIN4/I
33% identity, 66% coverage
- Insight into the proteome of the hyperthermophilic Crenarchaeon Ignicoccus hospitalis: the major cytosolic and membrane proteins
Burghardt, Archives of microbiology 2008 - “...0 0 2/1 Igni_1080 MS-MS/MS MA 208 23.7543 25 5.21 94/37 / 0 0 1b Igni_1150 MS-MS/MS Cyt 442 49.2645 50 9.17 267/61 / 0 0 2/5 Igni_1201 Edman b MS-MS/MS MA (P) 784 87.7122 53 5.19 223/29 +/ 0 1 2/3 Igni_1266 Edman b M...”
- “...E subunit c vATP-synt_E/PF01991.9 1st hit: H + -transporting two-sector ATPase, E subunit [Pars_2318] 5e-06/29% Igni_1150 Annotation: translation elongation factor 1A (EF-1A/EF-Tu) Elongation factor 1-alpha 5.3e-27/100% GTP_EFTU/PF00009.18 1st hit: elongation factor 1-alpha [Hbut_1581] 0.0/81% Igni_1201 Annotation: solute binding protein-like protein Oligopeptide-binding protein 1.2e-22/100% SBP_bac_5/PF00496.13 1st hit:...”
P19486 Elongation factor 1-alpha from Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
35% identity, 65% coverage
Ta0444 probable translation elongation factor aEF-1, alpha chain from Thermoplasma acidophilum DSM 1728
35% identity, 65% coverage
P07810 Elongation factor 1-alpha from Methanococcus vannielii
33% identity, 65% coverage
- The heterotrimeric protein Go is required for the formation of heart epithelium in Drosophila.
Frémion, The Journal of cell biology 1999 - “...P-element (5-CGACGGGACCACCTTATGTTATTTCATCATG-3) and bkh specific primers: ( bkh 6 : 5-CAGCCCATTGTGGTTGGG-3; bkh 3 : 5-AAGTCCTCAGCAGTGAAGCCGCTCTCG-3). P07810 was localized 1.5 kb upstream of the class II cDNA ATG and the 1.5-kb PCR fragment obtained was sequenced by Genome Express. P06915 and P11003 were localized 800 bp upstream...”
- “...to identify transcription units. The bkh 007 mutation was generated by P-element mobilization in the P07810 line and a cross with flies bearing (2-3) as a source of transposase and of w; Sp/Cyo; (2-3),Sb/TM6B genotype. P-Elementmediated Transformation Germline transformation was performed using standard procedures as described...”
MM2264 protein translation elongation factor 1A from Methanosarcina mazei Goe1
33% identity, 65% coverage
MTH1058 translation elongation factor, EF-1 alpha from Methanothermobacter thermautotrophicus str. Delta H
O27132 Elongation factor 1-alpha from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
34% identity, 66% coverage
AMET1_0579 translation elongation factor EF-1 subunit alpha from Methanonatronarchaeum thermophilum
33% identity, 66% coverage
VNG_RS10385 translation elongation factor EF-1 subunit alpha from Halobacterium salinarum NRC-1
33% identity, 64% coverage
WP_010866631 translation elongation factor EF-1 subunit alpha from Aeropyrum pernix K1
33% identity, 66% coverage
6ji2A / Q9YAV0 Crystal structure of archaeal ribosomal protein ap1, apelota, and gtp- bound aef1a complex (see paper)
33% identity, 66% coverage
- Ligands: peptide; guanosine-5'-triphosphate; magnesium ion (6ji2A)
MMP1370 translation elongation factor EF-1, subunit alpha from Methanococcus maripaludis S2
32% identity, 65% coverage
- The archaeal RNA chaperone TRAM0076 shapes the transcriptome and optimizes the growth of Methanococcus maripaludis
Li, PLoS genetics 2019 - “...and MMP1347 ), translation initiation factors ( MMP1406 ), elongation factor 1 and subunits ( MMP1370 and MMP1401 ), RNA polymerase subunits RpoN and RpoF ( MMP1326 and MMP0092 ), ribosomal proteins (rpl40e, MMP0151 ; rps27e, MMP1708 ; and rplX, MMP0060 ), some methanogenesis genes (...”
- Evolution of the archaeal and mammalian information processing systems: towards an archaeal model for human disease
Lyu, Cellular and molecular life sciences : CMLS 2017 - “...NP_001406.1 NP_065123.1 NP_002203.1 MMP0061 aIF6 Elongation and termination MMP1370 aEF1A MMP1401 aEF1Ba (?) EIF6 80 3E-21 ? EEF1A1 99 2E-157 51 34 BAD96766.1 ?...”
D4GWR0 Elongation factor 1-alpha from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
HVO_2413 translation elongation factor aEF-1 alpha subunit from Haloferax volcanii DS2
32% identity, 64% coverage
FVRRES_13282 uncharacterized protein from Fusarium venenatum
33% identity, 53% coverage
- Identification of neutral genome integration sites with high expression and high integration efficiency in Fusarium venenatum TB01
Tong, Synthetic and systems biotechnology 2023 - “...To construct the GFP expression library in F. venenatum TB01, the promoter sequence of tef (FVRRES_13282) and the fragment containing the ORF of GFP and terminator T trpc were amplified with the corresponding primer pairs Ptef-1/2 and GFPT-1/2, respectively. The obtained promoter P tef and GFP...”
- Establishment of High-Efficiency Screening System for Gene Deletion in Fusarium venenatum TB01
Tong, Journal of fungi (Basel, Switzerland) 2022 - “...GFP and the terminator Ttrpc, and promoter sequences of gpdA (FVRRES_09878), gla (FVRRES_01380), and tef (FVRRES_13282) were amplified with the corresponding primers. The obtained GFP -Ttrpc and promoter fragment were cloned into the Eco RI site of the pK2- neo vector by seamless cloning (Vazyme, Nanjing,...”
HQ_RS12180 translation elongation factor EF-1 subunit alpha from Haloquadratum walsbyi DSM 16790
32% identity, 64% coverage
ANIA_02063 hypothetical protein from Aspergillus nidulans FGSC A4
32% identity, 67% coverage
- Modular Synthetic Biology Toolkit for Filamentous Fungi
Mózsik, ACS synthetic biology 2021 - “...ANIA_04218 promoter pICH41295 pFC334 (Addgene ID 87846) ( 32 ) pFTK006 171278 P1 Ptef EF1-subunit ANIA_02063 promoter pICH41295 A nidulans FGSC A4 ( 33 ) pFTK007 171279 P1 PfraA An16g04690 promoter pICH41295 A. niger N402 ( 5 ) pFTK008 171280 P1 Poat1 Pc18g03600 promoter pICH41295 P....”
1skqA / P35021 The crystal structure of sulfolobus solfataricus elongation factor 1- alpha in complex with magnesium and gdp (see paper)
33% identity, 66% coverage
- Ligand: guanosine-5'-diphosphate (1skqA)
WP_010885563 translation elongation factor EF-1 subunit alpha from Pyrococcus horikoshii
34% identity, 66% coverage
D4GZY6 Elongation factor 1-alpha from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
HVO_0359 translation elongation factor aEF-1 alpha subunit from Haloferax volcanii DS2
32% identity, 64% coverage
- Multiplex quantitative SILAC for analysis of archaeal proteomes: a case study of oxidative stress responses
McMillan, Environmental microbiology 2018 - “...1005 3316 0.303 a Conversion calculated based on the top three most abundant proteins (UniProt: D4GZY6, D4GXX8, and D4GWB2), as determined by emPAI value. Data used to support these calculations are listed in Supplemental Table S1 . Table 2 Strains, plasmids, and oligonucleotide primers used in...”
- Archaeal Tuc1/Ncs6 homolog required for wobble uridine tRNA thiolation is associated with ubiquitin-proteasome, translation, and RNA processing system homologs
Chavarria, PloS one 2014 - “...42 aCPSF1 D4GUM1 HVO_0874 72 Archaeal cleavage and polyadenylation specificity factor 1 65% 64 aEF-1 D4GZY6 HVO_0359 46 Translation elongation factor aEF-1 subunit (GTPase) 51% 43 a MS-identified proteins with coverage above 25% are reported according to the Hfx. volcanii gene locus tag from the National...”
- Comprehensive glycoproteomics shines new light on the complexity and extent of glycosylation in archaea
Schulze, PLoS biology 2021 - “...PXD021874 13 Sec (SPI) HVO_0349 RpoA1 DNA-directed RNA polymerase subunit A 1 PXD006877 3 Cyt HVO_0359 Tef1a1 Translation elongation factor aEF-1 alpha/peptide chain release factor aRF-3 1 PXD006877 7 Cyt HVO_0654 Rpl43e 50S ribosomal protein L43e 1 PXD006877 4 Cyt HVO_0677 AspS AspartatetRNA(Asp/Asn) ligase 1 PXD011056...”
- Multiplex quantitative SILAC for analysis of archaeal proteomes: a case study of oxidative stress responses
McMillan, Environmental microbiology 2018 - “...Halobacterium salinarum (sp. NRC-1) by 2D-PAGE ( Shukla, 2006 ), the translation elongation factor 1 (HVO_0359, Eef1A), type I glyceraldehyde-3-phosphate dehydrogenase (HVO_0481, GapB), peptidyl-prolyl cis-trans isomerase (HVO_2222, PpiA), a riboflavin/purine nucleoside binding protein (HVO_1401, YufN) (3D structural homolog of PDB:4IIL and 2FQX), and proteins of the...”
- Internal RNAs overlapping coding sequences can drive the production of alternative proteins in archaea
Ten-Caten, RNA biology 2018 - “...synthase ( locus HVO_2419); and tef1a1 , which encodes for elongation factor 1-alpha/Tu ( locus HVO_0359). Our re-analysis of H. volcanii dRNA-Seq data shows an iTSS inside hmgB gene locus (TSS_026134) that would translate a predicted 11.0 kDa isoform (14.7 kDa corrected MW) consistent with the...”
- Archaeal Tuc1/Ncs6 homolog required for wobble uridine tRNA thiolation is associated with ubiquitin-proteasome, translation, and RNA processing system homologs
Chavarria, PloS one 2014 - “...proteasome-activating nucleotidase A/1 (PAN-A/1). In addition, NcsA was found associated with translation elongation factor aEF-1 (HVO_0359) and archaeal cleavage and polyadenylation specificity factor 1 group of the -CASP ribonuclease family of proteins (aCPSF1; HVO_0874) [28] . We note that our previous MS/MS studies readily detect SAMP13...”
- “...aCPSF1 D4GUM1 HVO_0874 72 Archaeal cleavage and polyadenylation specificity factor 1 65% 64 aEF-1 D4GZY6 HVO_0359 46 Translation elongation factor aEF-1 subunit (GTPase) 51% 43 a MS-identified proteins with coverage above 25% are reported according to the Hfx. volcanii gene locus tag from the National Center...”
- Archaeal ubiquitin-like SAMP3 is isopeptide-linked to proteins via a UbaA-dependent mechanism
Miranda, Molecular & cellular proteomics : MCP 2014 - “...- - - - - - SAMP1 associated, HVO_0359 protein accumulates after clastolactacystin--lactone treatment - SAMP2 associated - HVO_0861 (SufB homolog) associated...”
- “...associated with SAMP1/2 are indicated by "-." e HVO_0359, homolog of eukaryotic EF-1 with reported ubiquitin isopeptidase activity (65). f HVO_0966, homolog of...”
- Ubiquitin-like small archaeal modifier proteins (SAMPs) in Haloferax volcanii
Humbard, Nature 2010 - “...and RNA processing: HVO_1727 TATA-box binding protein E + HVO_1478 TFB, transcription initiation factor + HVO_0359 EF-1, translation elongation factor + accumulates in HVO after cLL treatment 36 , putative isopeptidase 26 , 27 HVO_0966 aIF2ba, archaeal translation initiation factor + + HVO_1921 SerS, seryl-tRNA synthetase...”
- Proteomic analysis of Haloferax volcanii reveals salinity-mediated regulation of the stress response protein PspA
Bidle, Microbiology (Reading, England) 2008 - “...2.1 Amidohydrolase HVO_A0095 267 6 2.1 Translation elongation HVO_0359 294 8 3.5 factor 1 Acetolactate synthase, HVO_1507 279 5 3.5 small subunit (ilvN)...”
- Genetic and proteomic analyses of a proteasome-activating nucleotidase A mutant of the haloarchaeon Haloferax volcanii
Kirkland, Journal of bacteriology 2008 - “...HVO_0350 HVO_0348 HVO_0861 HVO_0806 HVO_2941 HVO_0859 HVO_2700 HVO_0359 VOL. 190, 2008 ARCHAEL PROTEASE-ACTIVATING NUCLEOTIDASE A MUTANT 201 (ppa). Components...”
P16018 Elongation factor 1-alpha from Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
32% identity, 64% coverage
- Characterization of Shigella flexneri in northern Vietnam in 2012-2016.
Nguyen, Access microbiology 2023 - “...BSCA01000000 P16001 2016 Yen Bai 1a F BSCB01000000 P16002 2016 Yen Bai 1a F BSCC01000000 P16018 2016 Cao Bang 2a G BSCD01000000 P16020 2016 Cao Bang 2a G BSCE01000000 P16026 2016 Son La 1a H BSCF01000000 Reference * Year Country Serotype PG Accession IB0719 1982 Korea...”
- “...+ P16002 F 1a 1 + + + + + + + + + + P16018 G 2a 2 + + + + + P16020 G 2a 2 + + + + + P16026 H 1a 1 + + + + + + + *Plus and...”
PAB0465 translation elongation factor EF-1, subunit alpha from Pyrococcus abyssi GE5
33% identity, 66% coverage
PF1375 translation elongation factor eF-1, subunit alpha (tuf) from Pyrococcus furiosus DSM 3638
33% identity, 65% coverage
- Intact functional fourteen-subunit respiratory membrane-bound [NiFe]-hydrogenase complex of the hyperthermophilic archaeon Pyrococcus furiosus
McTernan, The Journal of biological chemistry 2014 - “...the gel and was identified as elongation factor 1 (PF1375; Fig. 3). Purified MBH was also analyzed using a calibrated Superose 6 gel filtration column and gave...”
- Experimental and computational analysis of the secretome of the hyperthermophilic archaeon Pyrococcus furiosus
Schmid, Extremophiles : life under extreme conditions 2013 - “...18894134 Putative sugar transport inner membrane protein (malg-like) 45 4 12 6 Translation and transcription PF1375 18893486 Translation elongation factor eF-1, subunit alpha 48 8 24 No PF1803 18893984 LSU ribosomal protein L30P 18 4 22 No PF1881 18978253 Chromatin protein 10 2 30 No Protein...”
- Identification of a new endogenous metabolite and the characterization of its protein interactions through an immobilization approach
Kalisiak, Journal of the American Chemical Society 2009 - “...proteins identified for spermidine immobilization are involved in translation such as translation elongation faction ef1 (PF1375), LSU ribosomal protein L7AE (PF1367), translation elongation factor eIF-5a (PF1264). Spermidine is a well characterized polyamine and is known to play a critical role for eukaryotic organisms in translation, ribosomal...”
- Novel multiprotein complexes identified in the hyperthermophilic archaeon Pyrococcus furiosus by non-denaturing fractionation of the native proteome
Menon, Molecular & cellular proteomics : MCP 2009 - “...PF0982 PF0983 PF1115 PF1116 PF1189 PF1190 PF1242 PF1243 PF1375 PF1376 PF1379 PF1380 PF1385 PF1386 PF1454 PF1455 PF1482 PF1483 PF1556 PF1557 PF1614 PF1615 PF1716...”
- Noncoding RNA genes identified in AT-rich hyperthermophiles
Klein, Proceedings of the National Academy of Sciences of the United States of America 2002 - “...that sscA is cotranscribed with either sR44 or ORF PF1375, which is the translation elongation factor eF-1 -subunit (Fig. 3). We have no evidence to either...”
EHI_102170 elongation factor 1-alpha 1 from Entamoeba histolytica HM-1:IMSS
EHI_052400 elongation factor 1-alpha 1 from Entamoeba histolytica HM-1:IMSS
32% identity, 67% coverage
- Entamoeba histolytica: Proteomics Bioinformatics Reveal Predictive Functions and Protein-Protein Interactions of Differentially Abundant Membrane and Cytosolic Proteins
Azmi, Membranes 2021 - “...- 2.2277 EHI_120360 Grainin putative - 2.1083 EHI_006980 Gal galnac lectin subunit igl1 - 2.5152 EHI_102170 Elongation factor 1-alpha Yes 2.0661 EHI_024350 Uncharacterized protein - 2.0284 EHI_107290 Actin - 2.6989 EHI_047800 Uncharacterized protein Yes 2.5246 EHI_076870 3-oxo 5 alpha-steroid 4-dehydrogenase domain-containing Yes 2.9713 EHI_054830 Calcium-transporting ATPase...”
- Fumagillin inhibits growth of the enteric protozoan parasite Entamoeba histolytica by covalently binding to and selectively inhibiting methionine aminopeptidase 2
Watanabe, Antimicrobial agents and chemotherapy 2023 - “...11.859 12.243 0.96 Actin EHI_107290 42 kDa 10.277 10.883 0.94 Cluster of Elongation factor 1-alpha EHI_052400 48 kDa 10.277 9.5226 1.07 Aldehyde-alcohol dehydrogenase EHI_150490 96 kDa 10.277 6.8019 1.51 Elongation factor 1-alpha EHI_052400 48 kDa 9.4868 9.5226 0.99 Peroxiredoxin EHI_122310 27 kDa 9.4868 6.8019 1.39 a...”
- Comparative genomics and interactomics of polyadenylation factors for the prediction of new parasite targets: Entamoeba histolytica as a working model
Avila-Bonilla, Bioscience reports 2023 - “...phosphate dikinase activity EHI_146560 Ribosomal protein S24_ putative TSGFALIYDTLSALK 10.71 2.3713E-01 Structural constituent of ribosome EHI_052400 Elongation factor 1-alpha 1 THINIVVIGHVDSGK FEELLSK YYFTIIDAPGHR STTTGHLIYK QERYEEIK 8.37 2.9991E-01 Nucleocytoplasmic transport EHI_158100 NEDD4-binding protein 2 ATIAIFEEVNIYMVDEDAIDLHGLQIDGALDMVK ELTWPIEDSIIYKK SIVKVQCGMGHHNTVGFSK 6.90 6.3809E-02 Transcription corepressor Discussion It has been demonstrated that...”
- Identification of the virulence landscape essential for Entamoeba histolytica invasion of the human colon
Thibeaux, PLoS pathogens 2013 - “...serine-rich 25 kDa antigen protein 2,1 2,00E-09 Translation-Protein Maturation EHI_170330 RIO1 family protein 2,91 1,40E-02 EHI_052400 translation elongation factor EF-1 alpha 2,05 1,30E-03 EHI_153840 midasin, putative 2,4 5,20E-12 EHI_030610 HECT domain and RCC1-like protein 2,15 1,00E-14 Stress EHI_101120 heat shock protein 70, mitochondrial 2,12 1,30E-10 DNA-RNA...”
S0AWG4 Elongation factor 1-alpha from Entamoeba histolytica
32% identity, 67% coverage
EDI_134610 elongation factor 1-alpha from Entamoeba dispar SAW760
31% identity, 67% coverage
- Evolutionary genomics and population structure of Entamoeba histolytica
Das, Computational and structural biotechnology journal 2014 - “...protein (EDI_207850) present in E. dispar SAW760 strain. Homologous gene for elongation factor alpha 1 (EDI_134610) also contains a total of 90 SNPs. A total of 254 SNPs have also been identified in the homologous gene for inositol polyphosphate-5-phosphatase (EDI_159070). Another important virulence factor of E....”
- “...precursor, putative a a EMO_050130 Galactose-inhibitable lectin 35kDa subunit precursor EHI_011210 Elongation factor alpha 1 EDI_134610 Elongation factor 1-alpha EIN_146970 Elongation factor 1-alpha, putative EMO_123750 Elongation factor 1-alpha 1 EHI_139430 Leucine rich repeat protein BspA family EDI_284090 Hypothetical protein, conserved EIN_054420 Hypothetical protein, conserved EMO_007680 Leucine...”
PTO0415 protein translation elongation factor Tu from Picrophilus torridus DSM 9790
Q6L202 Elongation factor 1-alpha from Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
31% identity, 65% coverage
- Efficacy of signal peptide predictors in identifying signal peptides in the experimental secretome of Picrophilous torridus, a thermoacidophilic archaeon
Singhal, PloS one 2021 - “...Quinoprotein dehydrogenase/membrane protein PTO0197 7 Q6L202 Elongation factor 1-alpha (EF-1-alpha) (Elongation factor Tu) (EF-Tu)/Protein biosynthesis PTO0415 8 Q6L0B7 2-oxoglutarate synthase, alpha chain (EC 1.2.7.3) PTO1000 9 Q6L0Y1 Oligosaccharyl transferase STT3 subunit PTO0786 10 Q6KZA7 Pyruvate ferredoxin oxidoreductase, alpha chain/pyruvate synthesis PTO1360 11 Q6L2C8 Uncharacterized protein PTO0289...”
- Biophysical and Biochemical Characterization of Nascent Polypeptide-Associated Complex of Picrophilus torridus and Elucidation of Its Interacting Partners
Singhal, Frontiers in microbiology 2020 - “...the pull down assay. S. No. Gene accession number Protein accession number Protein name 1 PTO0415 Q6L202 Elongation factor 1-alpha 2 PTO0409 Q6L208 Protein secretion chaperonin CsaA 3 PTO0369 Q6L248 Glutaredoxin related protein 4 PTO1195 Q6KZS2 Thermosome subunit 5 PTO0433 Q6L1Y4 Uncharacterized protein 6 PTO0440 Q6L1X7...”
- Identification of Binding Partners of CsaA - An Archaeal Chaperonic Protein of Picrophilus torridus
Singhal, Protein and peptide letters 2021 (PubMed)- “...These were thermosome subunits (Q6KZS2 and Q6L132), nascent polypeptide-associated complex protein (Q6L1N3), elongation factor 1-alpha (Q6L202), uncharacterized protein (Q6L0Y6), citrate synthase (Q6L0M8), asparaginyl- tRNA synthetase (Q6L0M5), succinyl-CoA synthetase beta chain (Q6L0B4), pyruvate ferredoxin oxidoreductase alpha and beta chain proteins (Q6KZA7 and Q6KZA6, respectively), malate dehydrogenase (Q6L0C3)...”
- Efficacy of signal peptide predictors in identifying signal peptides in the experimental secretome of Picrophilous torridus, a thermoacidophilic archaeon
Singhal, PloS one 2021 - “...PTO1315 5 Q6L2N6 Extracellular solute-binding protein/membrane protein PTO0181 6 Q6L2M0 Quinoprotein dehydrogenase/membrane protein PTO0197 7 Q6L202 Elongation factor 1-alpha (EF-1-alpha) (Elongation factor Tu) (EF-Tu)/Protein biosynthesis PTO0415 8 Q6L0B7 2-oxoglutarate synthase, alpha chain (EC 1.2.7.3) PTO1000 9 Q6L0Y1 Oligosaccharyl transferase STT3 subunit PTO0786 10 Q6KZA7 Pyruvate ferredoxin...”
- Biophysical and Biochemical Characterization of Nascent Polypeptide-Associated Complex of Picrophilus torridus and Elucidation of Its Interacting Partners
Singhal, Frontiers in microbiology 2020 - “...as the binding partners of PtNAC ( Table 1 ). These were elongation factor 1-alpha (Q6L202), protein secretion chaperonin CsaA (Q6L208), glutaredoxin (Q6L248)-related protein, thermosome subunit (Q6KZS2), 50S ribosomal protein L12 (Q6L1X7), thermosome subunit (Q6L132), hypothetical aldo-keto reductase (Q6L0H6), succinyl-CoA synthetase beta chain (Q6L0B4), DNA-binding protein...”
- “...pull down assay. S. No. Gene accession number Protein accession number Protein name 1 PTO0415 Q6L202 Elongation factor 1-alpha 2 PTO0409 Q6L208 Protein secretion chaperonin CsaA 3 PTO0369 Q6L248 Glutaredoxin related protein 4 PTO1195 Q6KZS2 Thermosome subunit 5 PTO0433 Q6L1Y4 Uncharacterized protein 6 PTO0440 Q6L1X7 50S...”
EF1A_ENTH1 / P31018 Elongation factor 1-alpha; EF-1-alpha from Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) (see paper)
EHI_011210 elongation factor 1-alpha 1 from Entamoeba histolytica HM-1:IMSS
31% identity, 67% coverage
- function: This protein promotes the GTP-dependent binding of aminoacyl- tRNA to the A-site of ribosomes during protein biosynthesis
- Entamoeba histolytica: EhADH, an Alix Protein, Participates in Several Virulence Events through Its Different Domains
Zanatta, International journal of molecular sciences 2024 - “...Enzyme [ 22 , 56 ] EHI_098570 Fructose-1,6-bisphosphate aldolase Enzyme [ 30 , 31 ] EHI_011210 Elongation factor 1-Alpha 1 Enzyme [ 30 , 31 ] EHI_024240 Aldehyde-alcohol dehydrogenase 2 Enzyme [ 22 , 57 ] EHI_051940 Poly (ADP-ribose) glucohydrolase Enzyme [ 30 , 31 ]...”
- EhVps23, an ESCRT-I Member, Is a Key Factor in Secretion, Motility, Phagocytosis and Tissue Invasion by Entamoeba histolytica
Galindo, Frontiers in cellular and infection microbiology 2022 - “...Clathrin heavy chain EHI_201940 Table2 Proteins associated with phagocytosis*. Protein Access number Elongation factor 1-alpha EHI_011210 Uncharacterized protein EHI_016130 Cysteine proteinase 2 EHI_033710 Ras family GTPase EHI_058090 Uncharacterized protein EHI_069560 Rho family GTPase EHI_070730 Cysteine proteinase 1 EHI_074180 EhUbI1 EHI_083270 LIM zinc finger domain containing protein...”
- “...Pyruvate, phosphate dikinase EHI_009530 40S ribosomal protein S8 EHI_009870 Xaa-Pro dipeptidase EHI_010070 Elongation factor 1-alpha EHI_011210 Leucine rich repeat protein EHI_015120 Calmodulin EHI_023500 Cysteine synthase A EHI_024230 GTP-binding protein EHI_031410 Polyadenylate-binding protein EHI_033250 Cysteine proteinase 2 EHI_033710 GOLD domain-containing protein EHI_038590 Vacuolar protein sorting 35 EHI_041950...”
- Unraveling the relevance of the polyadenylation factor EhCFIm25 in Entamoeba histolytica through proteomic analysis
Salgado-Martínez, FEBS open bio 2021 - “...(e.g., EHI_050130, EHI_183480, EHI_006860), aminoacyltRNA synthetases (such as EHI_126920 and EHI_073460), elongation factors (EHI_166810, EHI_ EHI_011210), and among others (Fig. 5 ). Finally, manual annotation of E.histolytica proteins and retrieving of published literature allowed us to cluster modulated proteins into three large biological processes, that is,...”
- “...synthetase_ putative 3.438382911 2.571822649 0.866560262 EHI_166810 B1N306 XP_001913572.1 Elongation factor 2 (EF2) 2.301951732 1.132943057 1.169008675 EHI_011210 C4M7D4 XP_651869.1 Elongation factor 1 alpha (EF1) EHI_090400 B1N2Z3 XP_001913560.1 60S acidic ribosomal protein P0 2.115985101 1.731688644 0.384296458 EHI_008380 C4M0L4 XP_652558.1 Aminopeptidase 6.89523807 2.603764161 4.291473908 EHI_153640 B1N2E5 XP_001913371.1 Protein kinase...”
- Evolutionary genomics and population structure of Entamoeba histolytica
Das, Computational and structural biotechnology journal 2014 - “...2.55 EHI_035690 Galactose inhibitable lectin 35kDa subunit precursor 8 4 4 0 0 1 8.57 EHI_011210 Elongation factor alpha 1 8 0 8 0 0 0 5.99 EHI_139430 Leucine rich repeat protein BspA family 8 3 5 0 0 0.6 3.96 EHI_023430 Glycosyl hydrolase family 31...”
- “...EDI_023210 Galactose-inhibitable lectin 35kDa subunit precursor, putative a a EMO_050130 Galactose-inhibitable lectin 35kDa subunit precursor EHI_011210 Elongation factor alpha 1 EDI_134610 Elongation factor 1-alpha EIN_146970 Elongation factor 1-alpha, putative EMO_123750 Elongation factor 1-alpha 1 EHI_139430 Leucine rich repeat protein BspA family EDI_284090 Hypothetical protein, conserved EIN_054420...”
S0B0R7 Elongation factor 1-alpha from Entamoeba histolytica
31% identity, 67% coverage
3wy9A / O59153 Crystal structure of a complex of the archaeal ribosomal stalk protein ap1 and the gdp-bound archaeal elongation factor aef1alpha (see paper)
33% identity, 65% coverage
- Ligands: peptide; guanosine-5'-diphosphate (3wy9A)
NEQ082 NEQ082 from Nanoarchaeum equitans Kin4-M
33% identity, 63% coverage
TK0308 translation elongation factor EF-1, alpha subunit from Thermococcus kodakaraensis KOD1
Q5JFZ4 Elongation factor 1-alpha from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
33% identity, 66% coverage
- Different Proteins Mediate Step-Wise Chromosome Architectures in Thermoplasma acidophilum and Pyrobaculum calidifontis
Maruyama, Frontiers in microbiology 2020 - “...Q5JIR2 V-type ATP synthase beta chain 52.4 atpB TK1603 Q5JFZ4 Elongation factor 1-alpha 47.5 tuf TK0308 Q5JE34 DNA-directed RNA polymerase subunit A 43.7 rpoA2 TK1081 Q5JGA2 Uncharacterized protein 40.8 TK0462 TK0462 Q5JDJ0 50S ribosomal protein L3 39 rpl3 TK1542 Q5JHG6 Uncharacterized protein 36.7 TK2157 TK2157 Q5JHT2...”
- Engineering of the Hyperthermophilic Archaeon Thermococcus kodakarensis for Chitin-Dependent Hydrogen Production
Aslam, Applied and environmental microbiology 2017 - “...the archaeal elongation factor 1 subunit gene (TK0308), and the glutamate dehydrogenase gene (gdh; TK1431) promoter (Pgdh), respectively. Gene replacements were...”
- Primary transcriptome map of the hyperthermophilic archaeon Thermococcus kodakarensis
Jäger, BMC genomics 2014 - “...Transcripts of sscA [ 24 , 57 ] present in the 5 ' -UTR of TK0308. (D) Transcripts of tRNA Lys (Tkt03) present within the 5 ' -UTR of TK0306. An antisense RNA is also transcribed from the TK0306 region. The numbers of cDNA reads from...”
- “...the presence of a regulatory RNA, designated the sscA RNA, located upstream of the gene (TK0308) that encodes the translation elongation factor 1 (aEF1). Our results confirm that the sscA RNA is present and abundant in growing T. kodakarensis cells and that it is located within...”
- Association of a multi-synthetase complex with translating ribosomes in the archaeon Thermococcus kodakarensis
Raina, FEBS letters 2012 - “...TK0978 glycyl-tRNA synthetase TK0550 prolyl-tRNA synthetase TK1461 leucyl-tRNA synthetase TK0444 cysteinyl-tRNA synthetase TK1049 methionyl-tRNA synthetase TK0308 elongation factor 1A TK0556 translation initiation factor 2B subunit beta TK1305 translation initiation factor 2 TK0309 elongation factor 2 TK0506 translation-associated GTPase TK1254 30S ribosomal protein S3Ae TK1529 30S ribosomal...”
- An archaeal histone is required for transformation of Thermococcus kodakarensis
Čuboňováa, Journal of bacteriology 2012 - “...TK2035 TK1539 TK0878 TK1500 TK0465 TK1534 TK1295 TK0308 TK1469 TK1174 Fold difference Proline dehydrogenase, gamma subunit (4Fe-4S cluster-binding component)...”
- Thermococcus kodakarensis mutants deficient in di-myo-inositol phosphate use aspartate to cope with heat stress
Borges, Journal of bacteriology 2010 - “...(RT-IPCT-F/RT-DIPPS-R) and the elongation factor 1-alpha (EF-1-alpha, tk0308) gene (RT-EF-F/RT-EF-R) are shown in Table 1. The T. kodakarensis EF-1-alpha gene,...”
- Different Proteins Mediate Step-Wise Chromosome Architectures in Thermoplasma acidophilum and Pyrobaculum calidifontis
Maruyama, Frontiers in microbiology 2020 - “...Q5JCX3 AMP phosphorylase 53.7 deoA TK0352 Q5JIR2 V-type ATP synthase beta chain 52.4 atpB TK1603 Q5JFZ4 Elongation factor 1-alpha 47.5 tuf TK0308 Q5JE34 DNA-directed RNA polymerase subunit A 43.7 rpoA2 TK1081 Q5JGA2 Uncharacterized protein 40.8 TK0462 TK0462 Q5JDJ0 50S ribosomal protein L3 39 rpl3 TK1542 Q5JHG6...”
AFUA_2G04630 translation elongation factor EF-1 subunit, putative from Aspergillus fumigatus Af293
30% identity, 52% coverage
- Conservation of nucleosome positions in duplicated and orthologous gene pairs
Nishida, TheScientificWorldJournal 2012 - “...AFUA_7G02560 0.193117882 YJL221C AFUA_8G07070 0.187015236 YGR054W AFUA_3G05970 0.181434929 YPR176C AFUA_7G04460 0.180215936 YML003W AFUA_1G09870 0.173517378 YKR084C AFUA_2G04630 0.171646807 YDR270W AFUA_4G12620 0.171601357 YOR336W AFUA_2G02360 0.164107564 YFL058W AFUA_5G02470 0.160695353 YNL301C AFUA_2G07380 0.151927636 YJL221C AFUA_7G06380 0.150927464 YGR280C AFUA_7G03690 0.150422383 YOL089C AFUA_6G01960 0.149731857 YGR193C AFUA_3G08270 0.14875632 YDR328C AFUA_5G06060 0.143711765 YPL254W AFUA_2G06060...”
EF1A1_TRYB2 / P86934 Elongation factor 1-alpha 1; EF-1-alpha 1 from Trypanosoma brucei brucei (strain 927/4 GUTat10.1) (see paper)
EF1A2_TRYB2 / P86939 Elongation factor 1-alpha 2; EF-1-alpha 2 from Trypanosoma brucei brucei (strain 927/4 GUTat10.1) (see paper)
31% identity, 64% coverage
- function: This protein promotes the GTP-dependent binding of aminoacyl- tRNA to the A-site of ribosomes during protein biosynthesis.
- function: This protein promotes the GTP-dependent binding of aminoacyl- tRNA to the A-site of ribosomes during protein biosynthesis.
- Protein Lactylation Critically Regulates Energy Metabolism in the Protozoan Parasite Trypanosoma brucei
Zhang, Frontiers in cell and developmental biology 2021 - “...and most of the latter were elongation factors, including elongation factor 1 alpha 2 (EF1A2; P86939) with five Kla sites ( Supplementary Table 5 ). Lactylated proteins widely participate in trans -splicing, cap-binding, and RNA export, translation, and degradation ( Figure 3B ). Additionally, Kla sites...”
- Eukaryotic translation elongation factor 1A (eEF1A) domain I from S. cerevisiae is required but not sufficient for inter-species complementation
Eltschinger, PloS one 2012 - “...orange and domain III underlined in red. Protein accession numbers for eEF1A sequences: T. brucei, P86934; L. major , Q4QEI8; S. cerevisiae, P50522; C. albicans, Q59K68; H. sapiens, P68104; A. thaliana, P1390. (DOC) Click here for additional data file. Table S1 Primers used for experiments with...”
cgd6_3990 elongation factor 1 alpha from Cryptosporidium parvum Iowa II
29% identity, 66% coverage
- Dual Transcriptomics To Determine Gamma Interferon-Independent Host Response to Intestinal Cryptosporidium parvum Infection
Gallego-Lopez, Infection and immunity 2022 - “...Glycoprotein gp40 50,954 20891 34483 97488 2 cgd2_1373 Unspecified product 23,847 17477 15032 39033 3 cgd6_3990 Elongation factor 1-alpha 22,218 9455 15754 41446 4 cgd8_3520 Uncharacterized secreted protein 21,677 9928 16857 38247 5 cgd5_1470 Nucleoside diphosphate kinase 17,366 7388 12296 32415 6 cgd7_4020 Cryptosporidial mucin 16,472...”
- Cryptosporidium parvum Elongation Factor 1α Participates in the Formation of Base Structure at the Infection Site During Invasion
Yu, The Journal of infectious diseases 2020 - “...oocysts by transcriptomics Rank in sporozoites by proteomics cgd6_3990 (CpEF1) 106 (top 5.5%) 23 (top 2.1%) cgd2_2070 (CpERF3) 839 (top 43.6%) 391 (top 34.9%)...”
- “...Gene ID B 100 Relative mRNA level (vs. median) CpEF1 (cgd6_3990) CpERF3 (cgd2_2070) 10 CpEF (cgd2_3950) CpEF (cgd7_4450) 1 CpLDH (cgd7_480) 0.1 or oz oi te s Sp...”
- Heparin interacts with elongation factor 1α of Cryptosporidium parvum and inhibits invasion
Inomata, Scientific reports 2015 - “...proteins was translational elongation ( P value=4.110 3 ), including elongation factor 1 alpha (EF1, cgd6_3990) and translation elongation factor 2 (EF2, cgd8_2930). Thus, we identified 31 parasite proteins with the potential to interact with heparin that are involved in diverse biological processes. C. parvum elongation...”
- CysQ of Cryptosporidium parvum, a Protozoa, May Have Been Acquired from Bacteria by Horizontal Gene Transfer
Lee, Genomics & informatics 2012 - “...proteins as queries. Among class I and II proteins, only CysN showed marginal matches to cgd6_3990 (29% and 33% identities, respectively) to M. tuberculosis and E. coli sequences. Interestingly, this C. parvum protein was reported as elongation factor 1 alpha, not a sulfate adenylyltransferase. This protein...”
B8LEI9 Elongation factor 1-alpha from Thalassiosira pseudonana
29% identity, 69% coverage
- Silicon enhances the growth of Phaeodactylum tricornutum Bohlin under green light and low temperature.
Zhao, Scientific reports 2014 - “...photosynthetic efficiency. Protein metabolism and chromosome integration Expression of two translation elongation factors (B5Y4J2 and B8LEI9) was down-regulated when silicon was unavailable. Three predicted proteins (B7G715, B7FQU7, and B7G9G2) that function as structural constituents of ribosomes were regulated in two ways: two were up-regulated and one...”
- “...3 Up B7G715 Predicted protein Down K0ST15 Hypothetical protein THAOC_10275 Down B7FQU7 Predicted protein Down B8LEI9 Hypothetical protein THAPSDRAFT_bd1861 Down B7G9G2 Predicted protein Up K0RCF5 Hypothetical protein THAOC_29407 Up B7FWT8 Predicted protein Up Signal transduction B5Y5D4 Annexin Down Q1EFP9 Polyubiquitin Down B7FYL2 Iron starvation induced protein...”
VDAG_05517 elongation factor 1-alpha from Verticillium dahliae VdLs.17
31% identity, 50% coverage
LMJF_17_0080 elongation factor 1-alpha from Leishmania major strain Friedlin
Q4QEI9 Elongation factor 1-alpha from Leishmania major
29% identity, 68% coverage
- Identification of protein profile in metacyclic and amastigote-like stages of Leishmania tropica: a proteomic approach
Ashrafmansouri, AMB Express 2022 - “...18.71 Q4QAX6 Putative 60S ribosomal protein L17 LMJF_24_0040 HVQVDQAAR, SVVAMMSLLK 2.0 Q4QEI9 Elongation factor 1-alpha LMJF_17_0080 IGGIGTVPVGR, GITIDIALWK, FESPKSVFTIIDAPGHR, SVFTIIDAPGHR, EHALLAFTLGVK, STATGHLIYK 7.48 Q4QEM2 Paraflagellar rod protein 2C LMJF_16_1425 AQLLEHLVELVADKFR, TLGQLVYK 14.07 Q4QEX4 Putative 60S ribosomal protein L21 LMJF_16_0460 GVGVIINKPVR, TGIVWNVTPR, VGDYVDVVADSAVR 33.52 Q4QF62 60S acidic...”
- Identification of protein profile in metacyclic and amastigote-like stages of Leishmania tropica: a proteomic approach
Ashrafmansouri, AMB Express 2022 - “...AITMEILAGR, LGANSLLDIVVFGK, GEGGYLVNSEGER, SPVWNSNLIEALELR 18.71 Q4QAX6 Putative 60S ribosomal protein L17 LMJF_24_0040 HVQVDQAAR, SVVAMMSLLK 2.0 Q4QEI9 Elongation factor 1-alpha LMJF_17_0080 IGGIGTVPVGR, GITIDIALWK, FESPKSVFTIIDAPGHR, SVFTIIDAPGHR, EHALLAFTLGVK, STATGHLIYK 7.48 Q4QEM2 Paraflagellar rod protein 2C LMJF_16_1425 AQLLEHLVELVADKFR, TLGQLVYK 14.07 Q4QEX4 Putative 60S ribosomal protein L21 LMJF_16_0460 GVGVIINKPVR, TGIVWNVTPR, VGDYVDVVADSAVR...”
- Comparative Proteomic Profiling of Leishmania tropica: Investigation of a Case Infected with Simultaneous Cutaneous and Viscerotropic Leishmaniasis by 2-Dimentional Electrophoresis and Mass Spectrometry
Hajjaran, Iranian journal of parasitology 2015 - “...protein) * Q4Q6E8 4.86/20 10.6/121 72 0.000 0.000 0.107 0.021 DS 81 elongation factor 1-alpha Q4QEI9 4.96/18 9.0/49 167 0.000 0.000 0.222 0.031 DS 82 40S ribosomal protein S12, putative Q4QG97 4.79/19 4.8/16 106 0.038 0.010 0.079 0.016 2.08 95 p21 antigen protein Q9U8C2 5.1/24 5.2/21...”
- “...SLX1 homolog Q4Q9W0 6.52/57 8.7/75 29 0.061 0.012 0.029 0.007 0.48 428 elongation factor 1-alpha Q4QEI9 6.14/47 9.0/49 202 0.058 0.005 0.009 0.002 0.16 436 succinyl-CoA ligase [GDP-forming] beta-chain, putative Q4Q1C4 5.56/33 6.5/44 345 0.000 0.000 0.047 0.012 DS 438 hypothetical protein, conserved O97202 4.1/36 9.6/46...”
A0A6L0X791 Elongation factor 1-alpha from Leishmania infantum
29% identity, 68% coverage
Q95VF2 Elongation factor 1-alpha (Fragment) from Leishmania donovani
A4HX73 Elongation factor 1-alpha from Leishmania infantum
LINJ_17_0190 elongation factor 1-alpha from Leishmania infantum JPCM5
LDBPK_170170 elongation factor 1-alpha from Leishmania donovani
29% identity, 68% coverage
- Stabilizing additives added during cell lysis aid in the solubilization of recombinant proteins
Leibly, PloS one 2012 - “...Trehalose Issatchenkia orientalis Lanosterol 14-alpha-demethylas * Q874Q6 Solubilized Xylitol Leishmania donovani Elongation factor 1-alpha * Q95VF2 Solubilized Trehalose & Glycine betaine Mycobacterium tuberculosis FADE29 P71858 Screen failed to yield soluble Mycobacterium tuberculosis LPPN Rv2270 * Q50693 Solubilized Trehalose, L-Arginine Mycobacterium tuberculosis Hypothetical protein Rv3172c O53322 Failed...”
- Proteomic approach for characterization of immunodominant membrane-associated 30- to 36-kiloDalton fraction antigens of Leishmania infantum promastigotes, reacting with sera from Mediterranean visceral leishmaniasis patients
Kamoun-Essghaier, Clinical and diagnostic laboratory immunology 2005 - “...Sequence coverage Elongation factor 1 (L. donovani) 49.097/9.03 Q95VF2 140 8 32 Elongation factor 1 (L. donovani) 49.097/9.03 Q95VF2 315 23 7.3 31.5 Elongation...”
- “...12 g 6.9 50 Elongation factor 1 (L. donovani) 49.097/9.03 Q95VF2 90 21 h1 7.45 50 Elongation factor 1 (L. donovani) 49.097/9.03 Q95VF2 725 53 h2 7.5 50...”
- Potential selection of antimony and methotrexate cross-resistance in Leishmania infantum circulating strains
Bernardo, PLoS neglected tropical diseases 2024 - “...Putative translation initiation factor 48.53 47.67 0.86 A4I5F6 LINF 300018100 Pyridoxal kinase 47.5 46.64 0.86 A4HX73 LINF 170005900 Elongation factor 1-alpha 47.64 46.8 0.84 A4HUX3 LINF 110012000 Aminopeptidaseputative 50.57 49.74 0.83 A4IE56 LINF 360050900 Oxidoreductaseputative 45.04 44.22 0.82 A4I154 LINF 250006300 Electron transfer flavoprotein subunit beta...”
- “...340031400 Uncharacterized protein 45.92 45.46 0.46 A4HU72 LINF 090022600 Cytochrome b5-like protein 45.92 45.46 0.46 A4HX73 LINF 170007200 Elongation factor 1-alpha 44.91 44.49 0.42 A4HX65 LINF 170005000 Uncharacterized protein 42.89 42.49 0.39 A4I7I7 LINF 320007400 Putative dynein light chain. flagellar outer arm 44.95 44.57 0.38 A4I9B4...”
- Exploring direct and indirect targets of current antileishmanial drugs using a novel thermal proteomics profiling approach
Ibarra-Meneses, Frontiers in cellular and infection microbiology 2022 - “...4.41 No 0 A4HZS1 LINF_220009800 Putative 40S ribosomal protein S15 48.32 43.98 4.34 No 0 A4HX73 LINF_170007200 Elongation factor 1-alpha 49.59 45.45 4.14 No 0 A4HVQ1 LINF_130017300 Putative 40s ribosomal protein s4 49.24 45.19 4.05 No 0 A4HY10 LINF_180019400 Putative 60S ribosomal protein L34 50.47 46.46...”
- The Eukaryotic Elongation Factor 1 Alpha (eEF1α) from the Parasite Leishmania infantum Is Modified with the Immunomodulatory Substituent Phosphorylcholine (PC)
Timm, Molecules (Basel, Switzerland) 2017 - “...Leishmaniinae database extracted from Uniprot. The database search presented only one protein hit (accession no A4HX73) with statistical significance ( p < 0.05) and with a MOWSE score of 187, the elongation factor 1 alpha (eEF1; see Figure 3 B). The matched peptides (highlighted in red...”
- Unravelling the proteomic signature of extracellular vesicles released by drug-resistant Leishmania infantum parasites
Douanne, PLoS neglected tropical diseases 2020 - “...89.7 (0.94) 9.7 (0.10) LINJ_17_0180 Elongation factor 1-alpha 75.3 65.7 (0.87) 115.7 (1.54) 47.0 (0.62) LINJ_17_0190 Elongation factor 1-alpha 112.3 92.0 (0.82) 148.3 (1.32) 66.3 (0.59) LINJ_36_0190 Elongation factor 2 21.3 5.0 (0.23) 16.7 (0.78) 6.7 (0.31) LINJ_14_1240 Enolase 37.0 43.3 (1.17) 45.0 (1.22) 21.7 (0.59)...”
- Comprehensive proteomic analysis of autophagosomes derived from Leishmania-infected macrophages
Nandan, PloS one 2023 - “...proteins associated with host-cell autophagosomes. Gene Name Protein ID Protein Name LDBPK_211170 E9BFA3 Histone H2A LDBPK_170170 A0A0R4J963 Elongation factor 1-alpha LDBPK_050510 E9B8E1 ATPase alpha subunit LDBPK_051190 E9B8K9 Prefoldin subunit, putative LDBPK_071340 E9B9C1 Amino acid transporter, putative LDBPK_100960 E9BAE1 Small GTP-binding protein Rab11, putative LDBPK_130330 E9BBA8 Tubulin...”
- Immunoproteomic Identification and Characterization of Leishmania Membrane Proteins as Non-Invasive Diagnostic Candidates for Clinical Visceral Leishmaniasis
Ejazi, Scientific reports 2018 - “...donovani amastigotes. Proteins name GP63, leishmanolysin Alpha tubulin Elongation factor 1alpha Gene names LDBPK_100510 LDBPK_130330 LDBPK_170170 Base mean avirulent 206.55 17918.23 21886.93 Base mean virulent 296.65 14252.97 20677.37 Fold change 1.43 0.79 0.94 Regulation up down down Functions Metallo endopeptidase activity GTPase activity; structural constituent of...”
Q4QEI8 Elongation factor 1-alpha from Leishmania major
29% identity, 68% coverage
LPMP_170080 elongation factor 1-alpha from Leishmania panamensis
30% identity, 64% coverage
- Environmental Conditions May Shape the Patterns of Genomic Variations in Leishmania panamensis
Restrepo, Genes 2019 - “...LPMP_080680 (tuzin), LPMP_090170/LPMP_190790 (autophagy-related protein 8), LPMP_100410/ LPMP_100440 (leishmanolysin), LPMP_130280 ( tubulin), LPMP_330860 ( tubulin), LPMP_170080 (elongation factor 1-), LPMP_330370 (heat shock protein 83), and LPMP_331700 (peptidase M20/M25/M40). However, the number of copies estimated for some of these genes in the clinical isolates seems to be...”
- “...24 LPMP_160880 Flagellar calcium-binding protein 3 2 2 2 2 2 2 2 2 2 LPMP_170080 Elongation factor 1- 15 21 21 21 21 22 20 20 33 34 LPMP_190790 Autophagy-related protein 8 (ATG8) 10 15 15 16 14 16 14 14 11 16 LPMP_311770 Ubiquitin-fusion...”
EF1A1_DICDI / P0CT31 Elongation factor 1-alpha; EF-1-alpha; 50 kDa actin-binding protein; ABP-50; EC 3.6.5.- from Dictyostelium discoideum (Social amoeba) (see paper)
DDB_G0269136 elongation factor 1 alpha from Dictyostelium discoideum AX4
30% identity, 67% coverage
- function: Translation elongation factor that catalyzes the GTP- dependent binding of aminoacyl-tRNA (aa-tRNA) to the A-site of ribosomes during the elongation phase of protein synthesis. Base pairing between the mRNA codon and the aa-tRNA anticodon promotes GTP hydrolysis, releasing the aa-tRNA from EEF1A1 and allowing its accommodation into the ribosome. The growing protein chain is subsequently transferred from the P-site peptidyl tRNA to the A-site aa-tRNA, extending it by one amino acid through ribosome-catalyzed peptide bond formation.
catalytic activity: GTP + H2O = GDP + phosphate + H(+) (RHEA:19669)
subunit: Binds to actin. - Recent Insights into NCL Protein Function Using the Model Organism Dictyostelium discoideum
McLaren, Cells 2019 - “...DDB0191134 Elongation factor 1-alpha (EF-1-alpha) (50 kDa actin-binding protein) (ABP-50) eef1a2 , efaa2 , efaAII DDB_G0269136 DDB0233663 Luminal-binding protein (BiP 2) bip2 DDB_G0276445 DDB0349243 Uncharacterized protein DDB_G0288563 DDB0233868 Uncharacterized protein, member of the peptidase S28 family of serine proteases, a group containing lysosomal Pro-X carboxypeptidase, dipeptidyl-peptidase...”
- Uncovering a role for the tail of the Dictyostelium discoideum SadA protein in cell-substrate adhesion
Kowal, Eukaryotic cell 2011 - “...6 7 8 9 10 DDB_G0269134 DDB_G0269136 DDB_G0288613 DDB_G0267426 DDB_G0290693 DDB_G0292410 DDB_G0282483 DDB_G0289483 DDB_G0294012 DDB_G0291283 DDB_G0295755 EfaAI...”
EF1-II / CAA39442.1 elongation factor 1 alpha, partial from Dictyostelium discoideum (see paper)
30% identity, 67% coverage
EAH_00032440 elongation factor 1-alpha, putative from Eimeria acervulina
29% identity, 65% coverage
EF1-I / CAA39443.1 elongation factor 1 alpha, partial from Dictyostelium discoideum (see paper)
30% identity, 67% coverage
A2DSF6 Elongation factor 1-alpha from Trichomonas vaginalis (strain ATCC PRA-98 / G3)
31% identity, 66% coverage
CNB04740 hypothetical protein from Cryptococcus neoformans var. neoformans JEC21
30% identity, 45% coverage
Q4CXI2 Elongation factor 1-alpha (Fragment) from Trypanosoma cruzi (strain CL Brener)
33% identity, 48% coverage
- Secretome analysis of Trypanosoma cruzi by proteomics studies
Brossas, PloS one 2017 - “...Cysteine peptidase C Q4DQB0 36.7 Dynein light chain, putative Q4E4N7 10.4 Elongation factor 1-alpha (Fragment) Q4CXI2 42.8 Elongation factor 2, putative Q4D3T1 94.1 Enolase, putative Q4DZ98 46.4 Glucose-regulated protein 78, putative Q4D620 71.3 Glutamate dehydrogenase Q4D5C2 45 Glutathione peroxidase Q4DEJ5 19.7 Glyceraldehyde 3-phosphate dehydrogenase, putative Q4D3Y9...”
A4H8V4 Elongation factor 1-alpha from Leishmania braziliensis
30% identity, 64% coverage
ETH_00010290 Elongation factor 1-alpha, related from Eimeria tenella
29% identity, 65% coverage
- Phosphoproteomic Comparison of Four Eimeria tenella Life Cycle Stages
Ma, International journal of molecular sciences 2021 - “...0.001), including actin ( ETH_00009555 ), myosin F ( ETH_00011990 ), elongation factor 1 ( ETH_00010290 ) and Sec7 domain-containing protein ( ETH_00019375 ), cell division ( p value = 0.004), positive regulation of transport ( p value = 0.014), and the cellular amide metabolic process...”
- “...organization ( p value = 0.039) (actin ( ETH_00009555 ) and elongation factor 1 ( ETH_00010290 )) ( Figure 2 D). KEGG pathway analysis of DEPPs is shown in Figure 2 BD. For SO7h vs. USO, DEPPs were involved in phagosome ( p value = 0.019),...”
Q96WZ1 Elongation factor 1-alpha from Coccidioides immitis (strain RS)
29% identity, 66% coverage
B8C995 Translation elongation factor alpha from Thalassiosira pseudonana
30% identity, 63% coverage
Q01765 Elongation factor 1-alpha from Pseudoechria curvicolla
29% identity, 67% coverage
- Effect of Amino Acids on Fusarium oxysporum Growth and Pathogenicity Regulated by TORC1-Tap42 Gene and Related Interaction Protein Analysis.
Deng, Foods (Basel, Switzerland) 2023 - “...Plasma membrane ATPase 99,393 554 Q6RG04 ENO1 Enolase 47,388 553 Q76KF9 enoA Enolase 47,264 545 Q01765 TEF Elongation factor 1-alpha 50,215 500 P23704 atp-2 ATP synthase subunit beta 55,556 464 A0A075DVI9 FPRO05_10296 Transaldolase 35,571 389 P10592 SSA2 Heat shock protein SSA2 69,599 368 P37211 atp-1 ATP...”
- iTRAQ-Based Quantitative Proteomic Analysis Reveals Proteomic Changes in Mycelium of Pleurotus ostreatus in Response to Heat Stress and Subsequent Recovery.
Zou, Frontiers in microbiology 2018 - “...pullulans 21.57 1 0.495 0.670 A5DPE3 Elongation factor 1-alpha Meyerozyma guilliermondii 14.63 1 1.183 1.948 Q01765 Elongation factor 1-alpha Podospora curvicolla 16.7 1 1.746 0.057 Q96X45 Elongation factor 2 Neurospora crassa 2.49 1 0.814 0.605 A8PZS4 Eukaryotic translation initiation factor 3 subunit F Malassezia globosa 3...”
TA06720 elongation factor 1 alpha, putative from Theileria annulata
28% identity, 67% coverage
PAAG_11418 elongation factor 1-alpha from Paracoccidioides lutzii Pb01
29% identity, 66% coverage
PODANS_1_19720 uncharacterized protein from Podospora anserina S mat+
29% identity, 67% coverage
- A Robust Phylogenomic Time Tree for Biotechnologically and Medically Important Fungi in the Genera Aspergillus and Penicillium
Steenwyk, mBio 2019 - “...on NCBIs webserver. We found the top three hits were to Podospora anserina (class Sordariomycetes, PODANS_1_19720; E value, 0.0; maximum score, 1,753; percent identity, 91%), Scedosporium apiospermum (class Sordariomycetes, SAPIO_CDS5137; E value, 0.0; maximum score, 1,742; percent identity,: 92%), and Isaria fumosorosea (class Sordariomycetes, ISF_05984; E...”
C1G1F2 Elongation factor 1-alpha from Paracoccidioides brasiliensis (strain Pb18)
PADG_00692 elongation factor 1-alpha from Paracoccidioides brasiliensis Pb18
29% identity, 66% coverage
PITG_06722 translation elongation factor 1-alpha, putative from Phytophthora infestans T30-4
30% identity, 65% coverage
- Evidence for a synergistic effect of post-translational modifications and genomic composition of eEF-1α on the adaptation of Phytophthora infestans
Wang, Ecology and evolution 2021 - “...Results from STRING analysis showed that I1 and I2 sequences were highly similar (>99%) to PITG_06722, a P. infestans elongation factor 1alpha protein that promotes the GTPdependent binding of aminoacyltRNA to the Asite of ribosome during protein biosynthesis. A 6node network varying in strength of connectivity...”
- “...by STRING using the information extracted from public databases. P. infestans eEF1 protein (Gene symbol: PITG_06722) is a highly identical to I1 and I2. PITG_10979, PITG_10974, PITG_06237, PITG_11766, and PITG_13500 are candidate elongation factor 1 and ribosomal protein of P. infestans (Table 1 ) TABLE 2...”
PF3D7_1357000 elongation factor 1-alpha from Plasmodium falciparum 3D7
Q8I0P6 Elongation factor 1-alpha from Plasmodium falciparum (isolate 3D7)
PF3D7_1357100 elongation factor 1-alpha from Plasmodium falciparum 3D7
28% identity, 66% coverage
- Photoaffinity probe-based antimalarial target identification of artemisinin in the intraerythrocytic developmental cycle of Plasmodium falciparum
Gao, iMeta 2024 - “...with reduced synthesis rate. (C) Fluorescence labeling of recombinant Plasmodium falciparum elongation factor 1 (PfEGF1) (PF3D7_1357000) with artemisinin photoaffinity probe (APP) in a dosedependent manner. (D) Preincubation with excess ATS (10M) and iodoacetamide (10M) competes with APP labeling of recombinant proteins. (E) Pulldown Western blot analysis...”
- “...NaVc, sodium ascorbate; TAMRA, tetramethyl6carboxyrhodamine; UV, ultraviolet. P. falciparum elongation factor 1 ( PfEGF1 , PF3D7_1357000) was identified as a potential target at all three stages of the IDC (Supporting Information S1: Table S1 ). We then expressed and purified the recombinant PfEGF1 protein and verified...”
- Chemoproteomics-based profiling reveals potential antimalarial mechanism of Celastrol by disrupting spermidine and protein synthesis
Gao, Cell communication and signaling : CCS 2024 - “...extensively studied [ 37 , 38 ]. P. falciparum elongation factor 1- ( Pf EGF1-, PF3D7_1357000) is a high-abundance protein primarily involved in the translation process, which binds to ribosomes and plays an indispensable role in P. falciparum protein synthesis [ 36 , 39 ]. In...”
- “...and others (Fig. S 4 ). Fig. 5 Validation of Cel binding to Pf EGF1- (PF3D7_1357000). A-J Similar validations as performed in Fig. 4 (A-J). K The decrease in fluorescence of AHA-labeling after the treatment with Cel. CHX (cycloheximide) serves as a positive control for the...”
- tRNA modification reprogramming contributes to artemisinin resistance in Plasmodium falciparum
Small-Saunders, Nature microbiology 2024 - “...4 PF3D7_1368100 26S proteasome regulatory subunit RPN11, putative 0.55 1.71 0.45 Asp GAT Yes 16 PF3D7_1357000 Elongation factor 1-alpha 0.52 1.54 n.d. His CAC , Asp GAC Probably yes 5 PF3D7_1208600 Mitochondrial import inner membrane translocase subunit TIM10, putative 0.55 2.26 0.92 His CAT Probably yes...”
- Identification of sulfenylation patterns in trophozoite stage Plasmodium falciparum using a non-dimedone based probe
Schipper, Molecular and biochemical parasitology 2021 - “...PF3D7_1338300 Elongation factor 1-gamma, putative 47.8 46.0% / 55.2% / 54.3% C70 + + 92 PF3D7_1357000 / PF3D7_1357100 Elongation factor 1-alpha 49.0 68.8% / 63.9% / 67.5% C356 + + 93 PF3D7_1434600 Methionine aminopeptidase 2 71.7 33.9% / 30.4% / 25.3% C447 94 PF3D7_1438000 Eukaryotic translation...”
- Protein Modification Characteristics of the Malaria Parasite Plasmodium falciparum and the Infected Erythrocytes
Wang, Molecular & cellular proteomics : MCP 2021 - “...addition, extensive modification, including phosphorylation, acetylation, crotonylation, 2-hydroxyisobutyrylation, and ubiquitination of elongation factor 1 ( PF3D7_1357000 ) associated with mRNA translation ( 34 ) was observed ( supplemental Dataset S24 ). Furthermore, the translation elongation factor 2, responsible for the GTP-dependent translocation of the ribosome along...”
- Generation of Novel Plasmodium falciparum NF135 and NF54 Lines Expressing Fluorescent Reporter Proteins Under the Control of Strong and Constitutive Promoters
Miyazaki, Frontiers in cellular and infection microbiology 2020 - “...pLf0123, and pLf0128 that contain the mCherry-luciferase (mCherry-Luc) fusion gene under control of the ef1 (PF3D7_1357000) , 40s (PF3D7_0219200), and sui1 (PF3D7_1243600) promoters respectively (see below). In addition, two DNA donor constructs were generated, pLf0116 and pLf0127 that contain the GFP gene under control of the...”
- “...levels are similar or higher in comparison with the housekeeping genes ef1 (elongation factor 1-alpha; PF3D7_1357000) and hsp70 (heat shock protein 70; PF3D7_0818900). Promoters of these latter two genes have been used previously to drive reporter expression in P. falciparum (Pf); however, reporter expression with the...”
- Role of Plasmodium falciparum Kelch 13 Protein Mutations in P. falciparum Populations from Northeastern Myanmar in Mediating Artemisinin Resistance
Siddiqui, mBio 2020 - “...complex assembly 26S protease regulatory subunit 6B PF3D7_0413600 Transcription preinitiation complex assembly Elongation factor 1-alpha PF3D7_1357000 Translation elongation factor/RNA binding Elongation factor 2 PF3D7_1451100 Translation elongation factor/RNA binding Eukaryotic initiation factor 4A PF3D7_1468700 Translation initiation/mRNA binding 40S ribosomal protein S3a PF3D7_0322900 Translation/structural constituent of ribosome 40S...”
- Generation of Transmission-Competent Human Malaria Parasites with Chromosomally-Integrated Fluorescent Reporters
McLean, Scientific reports 2019 - “...studies have generated fluorescent P . falciparum lines using the constitutively expressed elongation factor eEF1 (PF3D7_1357000) promoter and GFP variants 2 , 3 . While useful, the low intensity of fluorescence of these parasites during sporozoite and exoerythrocytic stages has limited their utility, particularly when imaging...”
- More
- Chemoproteomics-based profiling reveals potential antimalarial mechanism of Celastrol by disrupting spermidine and protein synthesis
Gao, Cell communication and signaling : CCS 2024 - “...the protein 3D structure of Pf Spdsyn from PDB (2PT9) and Pf EGF1- from Alphafold (Q8I0P6). The docking simulation was performed by MOE (2019.0102) [ 17 ]. Cysteine in the protein was selected as a potential site and the default method of the software was used...”
- A nuclear redox sensor modulates gene activation and var switching in Plasmodium falciparum
Heinberg, Proceedings of the National Academy of Sciences of the United States of America 2022 - “...* PF3D7_0517000 60S ribosomal protein L12, putative * * PF3D7_0913200 Elongation factor 1- * * PF3D7_1357100 Elongation factor 1- 22-fold 12-fold PF3D7_1451100 Elongation factor 2 * * Conserved unknown function PF3D7_0721100 Conserved protein, unknown function * * PF3D7_0813300 Conserved protein, unknown function * * PF3D7_1115800 Conserved...”
- The search for molecular mimicry in proteins carried by extracellular vesicles secreted by cells infected with Plasmodium falciparum
Armijos-Jaramillo, Communicative & integrative biology 2021 - “...comparison through RMSD is unreliable. We focused on the candidates with crystallized structures and on PF3D7_1357100 and PF3D7_0818200, the latter of which does not use human proteins as templates for the tertiary reconstruction ( Figure 2 ). With the remaining sequences of P. falciparum (PF3D7_1462800, PF3D7_1357100,...”
- “...humans % of identity RMSD Glyceraldehyde-3-phosphate dehydrogenase PF3D7_1462800 1YWG 6YND 64 0.8 Elongation factor 1-alpha PF3D7_1357100 Predicted structure 3J5Y 37 5.5 Actin-1 PF3D7_1246200 6I4K 4FO0 22 2.0 Proteasome subunit alpha type PF3D7_0727400 6MUW 6RGQ 46 1.5 Heat shock protein 90 PF3D7_0708400 3K60 6CEO 72 1.7 14-3-3...”
- Identification of sulfenylation patterns in trophozoite stage Plasmodium falciparum using a non-dimedone based probe
Schipper, Molecular and biochemical parasitology 2021 - “...factor 1-gamma, putative 47.8 46.0% / 55.2% / 54.3% C70 + + 92 PF3D7_1357000 / PF3D7_1357100 Elongation factor 1-alpha 49.0 68.8% / 63.9% / 67.5% C356 + + 93 PF3D7_1434600 Methionine aminopeptidase 2 71.7 33.9% / 30.4% / 25.3% C447 94 PF3D7_1438000 Eukaryotic translation initiation factor...”
- Artemisinin-Based Antimalarial Drug Therapy: Molecular Pharmacology and Evolving Resistance
Heller, Tropical medicine and infectious disease 2019 - “...Actin I Actin Filament/Cytoskeleton PF3D7_1311900 Vacuolar ATP synthase subunit a DV PF3D7_1324900 L-lactate dehydrogenase Cytosol PF3D7_1357100 Elongation factor 1-alpha Cytosol PF3D7_1407900 Plasmepsin I DV PF3D7_1408000 Plasmepsin II DV PF3D7_1444800 Fructose-bisphosphate aldolase Cytosol tropicalmed-04-00089-t002_Table 2 Table 2 Top hits for up- or down-regulated genes found in all...”
- Transcriptome analysis based detection of Plasmodium falciparum development in Anopheles stephensi mosquitoes
Oakley, Scientific reports 2018 - “...PF3D7_1338300 Day 4, 6, and 8 Elongation factor 2 PF3D7_1451100 Day 8 Elongation factor-1 alpha PF3D7_1357100 Day 4 and 8 Eukaryotic translation initiation factor 5a PF3D7_1204300 Day 4, 6 and 8 Eukaryotic translation initiation factor 2 subunit alpha PF3D7_0728000 Day 8 Eukaryotic translation initiation factor 3...”
- Proteogenomic analysis of the total and surface-exposed proteomes of Plasmodium vivax salivary gland sporozoites
Swearingen, PLoS neglected tropical diseases 2017 - “...thioredoxin-like protein 1, putative PF3D7_0919300 17 10 PVP01_1114800, PVP01_1114900 null elongation factor 1-alpha, putative PF3D7_1357000, PF3D7_1357100 7 11 PVP01_1258000 GEST gamete egress and sporozoite traversal protein, putative PF3D7_1449000 12 12 PVP01_0517100 14-3-3I 14-3-3 protein, putative PF3D7_0818200 14 13 PVP01_1311000 PfpUB polyubiquitin 5, putative PF3D7_1211800 N/A d...”
- Widespread occurrence of lysine methylation in Plasmodium falciparum proteins at asexual blood stages
Kaur, Scientific reports 2016 - “...putative (ARK3) K9(Trimethyl); K13(Dimethyl) IP SQAAGqAYLEAk PF3D7_1356800 serine/threonine protein kinase, putative (ARK3) K12(Dimethyl) IP NVSVkEIK PF3D7_1357100 elongation factor 1-alpha K5(Trimethyl) IP NVSVkEIK PF3D7_1357100 elongation factor 1-alpha K5(Trimethyl) IP TYHTLNNLSLNSnnNNk PF3D7_1359300 exosome complex exonuclease RRP44 (DIS3) K17(Trimethyl) IP ILEALLVCISILLLTFGVYYEkNknMIDICTHFCSNPYLSINNLDHMNISCLCk PF3D7_1360500 guanylyl cyclase beta (GCbeta) K22(Dimethyl); K24(Dimethyl); C-Term(Methyl)...”
- Rapid Generation of Marker-Free P. falciparum Fluorescent Reporter Lines Using Modified CRISPR/Cas9 Constructs and Selection Protocol
Mogollon, PloS one 2016 - “...values) that were similar or higher than that of the constitutively expressed elongation factor 1 (PF3D7_1357100), the promoter of this gene has been previously used in both P . falciparum and rodent models of malaria to drive the expression of reporter proteins [ 30 ]. These...”
PBANKA_113330, PBANKA_1133300 elongation factor 1-alpha from Plasmodium berghei ANKA
PBANKA_113340, PBANKA_1133400 elongation factor 1-alpha from Plasmodium berghei ANKA
PY17X_1134900 elongation factor 1-alpha, putative from Plasmodium yoelii
PCHAS_113280 elongation factor 1-alpha, putative from Plasmodium chabaudi chabaudi
PCHAS_113290 elongation factor 1-alpha, putative from Plasmodium chabaudi chabaudi
28% identity, 66% coverage
- Drug Interaction Studies of Cabamiquine:Ganaplacide Combination against Hepatic <i>Plasmodium berghei</i>
Gal, ACS infectious diseases 2025 - “...line (mCherry hsp70 Luc ef1 ), which expresses luciferase under the control of the eef1 (PBANKA_113330) promoter and, in addition, mCherry under the control of the hsp70 (PBANKA_071190) promoter, allowing the quantification of the parasite load in the liver and potentially ensuing blood stages ( Figure...”
- Rhoptry neck protein 4 plays important roles during Plasmodium sporozoite infection of the mammalian liver
Baba, mSphere 2023 - “...Table S1 ; Pb RON4 RT-F and R). Relative gene expressions were normalized by ef1 (PBANKA_1133300; Table S1 ; Pb EF1a RT-F and R) mRNA levels and were compared using the comparative Ct method ( 19 , 20 , 28 ). Indirect immunofluorescence assay (IFA) Sporozoites...”
- The claudin-like apicomplexan microneme protein is required for gliding motility and infectivity of Plasmodium sporozoites
Loubens, PLoS pathogens 2023 - “...thrombospondin-related anonymous protein (TRAP, PBANKA_1349800), a putative pantothenate transporter (PAT, PBANKA_0303900), the elongation factor 1-alpha (PBANKA_1133300), the tubulin beta chain (PBANKA_1206900), actin I (PBANKA_1459300), and a conserved protein of unknown function (PBANKA_0403700) ( Fig 5A and S1 Table ). The co-purification of TRAP with CLAMP was...”
- Streamlining sporozoite isolation from mosquitoes by leveraging the dynamics of migration to the salivary glands
Pathak, Malaria journal 2022 - “...plasmid pL1308 that contains the two gfp-luc fusion genes under the control of the eef1a (PBANKA_1133300) promoter or the ama1 (PBANKA_0915000) promoter, respectively, and contains the two 5 and 3 p230p target regions (TR). The construct was linearized using SacII restriction sites outside of the 5...”
- Highly efficient CRISPR/Cas9 system in Plasmodium falciparum using Cas9-expressing parasites and a linear donor template
Nishi, Scientific reports 2021 - “..., a drug-selectable marker gene, which is driven by the P. berghei elongation factor 1 (PBANKA_1133300 and PBANKA_1133400) promoter. The centromere of P. falciparum chromosome 5 was excised from the pCen_cas9 plasmid 21 by Bam HI and Not I digestion and then cloned into pf-gRNA, resulting...”
- Absence of PEXEL-Dependent Protein Export in Plasmodium Liver Stages Cannot Be Restored by Gain of the HSP101 Protein Translocon ATPase
Kreutzfeld, Frontiers in genetics 2021 - “...ANKA_0931200) under the control of the constitutive promoter of elongation factor 1 ( ef1 , PBANKA_113330) either as a fusion protein with a triple Myc tag only ( ef1:HSP101-myc ) or an additional mCherry tag ( ef1:HSP101-mCherry ) ( Supplementary Figure S3A ). Upon transfection and...”
- “...to the mCherry/3xMyc tag. For the plasmids EF1:HSP101-mCherry and EF1:HSP101-myc the 5 region of EF1 (PbANKA_113330) was amplified using primers EF1for and EF1rev ( Supplementary Table S2 ). The fragment was inserted via BssH II and Xba I 5 next to the HSP101 open reading frame....”
- Definition of constitutive and stage-enriched promoters in the rodent malaria parasite, Plasmodium yoelii
Bowman, Malaria journal 2020 - “...(PY17X_1402200), pydd (PY17X_0418900), pylap4 (PY17X_1323300), pytrap (PY17X_1354800), pyuis4 (PY17X_0502200), pylisp2 (PY17X_1004400), pybip (PY17X_0822200), and pbeef1a (PBANKA_1133300) From the literature, promoters that have been described to be strong and constitutive or stage specific as observed in other Plasmodium species were selected for study. To produce as diverse...”
- Expression and Localization Profiles of Rhoptry Proteins in Plasmodium berghei Sporozoites
Tokunaga, Frontiers in cellular and infection microbiology 2019 - “...a TaKaRa PCR Thermal Cycler Dice (Takara Bio). Relative gene expressions were normalized by ef1 (PBANKA_1133300) mRNA levels and were compared using the delta, delta-Ct method (Pfaffl, 2001 ; Ishino et al., 2019 ). Generation of c-Myc-Tagged Rhoptry Protein Expressing Transgenic Parasites To generate transgenic parasites...”
- More
- Roles and Cellular Localization of GBP2 and NAB2 During the Blood Stage of Malaria Parasites
Niikura, Frontiers in cellular and infection microbiology 2021 - “...3 flanking regions of target genes. hDHFR expression was controlled by the elongation factor-1 promoter (PBANKA_113340). Arrows denote primers specific for the 5 and 3 regions of target genes. (A) Introduction of the hDHFR-expressing cassette into the nab2 locus of wild-type (WT) P. berghei ANKA. (B)...”
- “...control of native promoters. hdhfr and hdhfs were under the control of the elongation factor-1 (PBANKA_113340) promoter. Arrows denote primers specific for the 5 and 3 regions of gene-targeting vectors. (A) Introduction of the gbp2::mCherry cassette into the 3 region of the gbp2 locus of wild-type...”
- Highly efficient CRISPR/Cas9 system in Plasmodium falciparum using Cas9-expressing parasites and a linear donor template
Nishi, Scientific reports 2021 - “...drug-selectable marker gene, which is driven by the P. berghei elongation factor 1 (PBANKA_1133300 and PBANKA_1133400) promoter. The centromere of P. falciparum chromosome 5 was excised from the pCen_cas9 plasmid 21 by Bam HI and Not I digestion and then cloned into pf-gRNA, resulting in the...”
- Insights into the intracellular localization, protein associations and artemisinin resistance properties of Plasmodium falciparum K13
Gnädig, PLoS pathogens 2020 - “...the K13 C580Y coding sequence was used instead, and the P . berghei ef1 promotor (PBANKA_1133400) was used as a 5 regulatory element. The N-terminal GFP tag was replaced with an N-terminal 3HA tag at the AvrII and BglII sites. The 3HA sequence was synthetically engineered...”
- IFNGR1 signaling is associated with adverse pregnancy outcomes during infection with malaria parasites
Niikura, PloS one 2017 - “...]. The expression of gfp and hdhfr is controlled by hsp70 (PBANKA_071190) and elongation factor-1 (PBANKA_113340) promoters, respectively. Plasmid containing luciferase gene (pLG4.10[ luc2 ]) was purchased from Promega (Madison, WI, USA). To generate the luciferase-expressing cassette, luciferase gene ( luc2 ) in the plasmid was...”
- Suppression of experimental cerebral malaria by disruption of malate:quinone oxidoreductase
Niikura, Malaria journal 2017 - “...expression of gfp and hdhfr is controlled by hsp70 (PBANKA_071190) and elongation factor - 1 (PBANKA_113340) promoters, respectively. Plasmid (pLG4.10[ luc2 ]) containing luciferase gene ( luc2 ) was purchased from Promega (Madison, WI, USA). To generate luciferase-expressing cassette, luc2 was amplified by PCR using specific...”
- A rapid and robust selection procedure for generating drug-selectable marker-free recombinant malaria parasites
Manzoni, Scientific reports 2014 - “...are placed under control of a single bidirectional promoter of Pb e EF1 (PBANKA_113330 and PBANKA_113340). The GFP (or GFP-LUC) and mCherry reporter genes are followed by an identical 1kb fragment corresponding to the 3 untranslated region (UTR) of P. berghei DHFR-TS , placed in the...”
- ALBA4 modulates its stage-specific interactions and specific mRNA fates during Plasmodium yoelii growth and transmission
Muñoz, Molecular microbiology 2017 - “...Y PY17X_0817500 EF1beta 2|2|2 0.88 PY17X_1318600 EF2 2|6|4 0.86 PY17X_0415700 eIF4E 2|1|3 0.81 Y Y PY17X_1134900 EF1alpha 2|24|12 0.78 Y PY17X_0521000 conserved Plasmodium protein, unknown function 5|2|3 0.72 Y mRNA export PY17X_1213400 PREBP 8|12|11 0.99 PY17X_1035100 Bruno/HoBo/CELF2* 9|12|7 0.99 Y Y PY17X_1235500 SR1 4|9|7 0.97 PY17X_0932300...”
- “...member 2, putative (CELF2) 0|1|6 0.4351 PY17X_0712100 heat shock protein 70, putative (HSP70) 8|14|20 0.3762 PY17X_1134900 elongation factor 1-alpha, putative 17|21|49 0.3265 Cell Periphery PY17X_1037800 glideosome associated protein with multiple membrane spans 3, putative (GAPM3) 5|4|6 0.9847 PY17X_1315100 inner membrane complex protein, putative 3|2|2 0.942 PY17X_0404800...”
- PlasmoSEP: Predicting surface-exposed proteins on the malaria parasite using semisupervised self-training and expert-annotated data
El-Manzalawy, Proteomics 2016 - “...1, putative (RAP1) 0.00 0.62 0.22 0.62 PY17X_0910400 Carbonic anhydrase, putative 0.20 0.54 0.61 0.61 PY17X_1134900 Elongation factor 1-alpha, putative 0.60 0.12 0.45 0.60 PY17X_0703100 Protein disulfide isomerase, putative 0.10 0.59 0.49 0.59 PY17X_0404900 Membrane skeletal protein, putative 0.10 0.10 0.55 0.55 PY17X_0525300 Glideosome associated protein...”
- Vector transmission regulates immune control of Plasmodium virulence
Spence, Nature 2013 - “...20% unique coding sequence (kmer = 100) were excluded from the analysis (PCHAS_073210; PCHAS_083750; PCHAS_100020; PCHAS_113280; PCHAS_113290; PCHAS_130130). Differential gene expression between SBP and MT P.c. chabaudi AS was determined using DESeq 29 ; the three SBP P.c. chabaudi AS replicates were compared against the two...”
- Vector transmission regulates immune control of Plasmodium virulence
Spence, Nature 2013 - “...unique coding sequence (kmer = 100) were excluded from the analysis (PCHAS_073210; PCHAS_083750; PCHAS_100020; PCHAS_113280; PCHAS_113290; PCHAS_130130). Differential gene expression between SBP and MT P.c. chabaudi AS was determined using DESeq 29 ; the three SBP P.c. chabaudi AS replicates were compared against the two MT...”
AO090120000080 No description from Aspergillus oryzae RIB40
28% identity, 67% coverage
TEF1 elongation factor 1-alpha from Candida albicans (see 4 papers)
28% identity, 66% coverage
- CharProtDB CGD description: Translation elongation factor 1-alpha, detected at the cell surface; binds human plasminogen; macrophage/pseudohyphal-induced; upregulated in RHE model of oral candidiasis and in clinical oral candidiasis isolates; possibly essential gene
PVX_114832 Elongation factor 1 alpha, putative from Plasmodium vivax
PVX_114830 elongation factor 1 alpha, putative from Plasmodium vivax
28% identity, 65% coverage
- Characterization of P. vivax blood stage transcriptomes from field isolates reveals similarities among infections and complex gene isoforms
Kim, Scientific reports 2017 - “...putative 31.70 PVX_088870 early transcribed membrane protein (ETRAMP) 2.48 PVX_097583 skeleton-binding protein 1 putative 19.89 PVX_114832 elongation factor 1-alpha putative 28.31 PVX_114015 histone H2A putative 30.97 PVX_122910 hypothetical protein conserved 2.29 PVX_096020 Plasmodium exported protein unknown function 19.34 PVX_090930 histone H4 putative 27.93 PVX_083045 phosphoethanolamine N-methyltransferase...”
- “...putative 23.49 PVX_080040 hypothetical protein conserved 1.44 PVX_113235 Pv-fam-d protein 13.87 PVX_090935 histone 2B 20.88 PVX_114832 elongation factor 1-alpha putative 23.24 PVX_093500 gamete release protein putative 1.39 PVX_114832 elongation factor 1-alpha putative 13.54 PVX_097583 skeleton-binding protein 1 putative 20.66 PVX_093680 Phist protein (Pf-fam-b) 20.55 PVX_118040 gamete...”
- Clinical proteomics of the neglected human malarial parasite Plasmodium vivax
Acharya, PloS one 2011 - “...study with two transcriptome datasets we found no transcript evidence for three proteins. These are PVX_114832 (Elongation factor 1 alpha, putative), PVX_250300 (ADP/ATP transporter on adenylate translocase, putative) and PVX_220290 (putative cyclophilin). This observation is intriguing as the previous two studies have used parasite materials from...”
- Characterization of P. vivax blood stage transcriptomes from field isolates reveals similarities among infections and complex gene isoforms
Kim, Scientific reports 2017 - “...40.06 PVX_089425 heat shock 70kDa protein putative 3.53 PVX_000010 Plasmodium exported protein unknown function 20.98 PVX_114830 elongation factor 1-alpha putative 30.20 PVX_090930 histone H4 putative 31.70 PVX_088870 early transcribed membrane protein (ETRAMP) 2.48 PVX_097583 skeleton-binding protein 1 putative 19.89 PVX_114832 elongation factor 1-alpha putative 28.31 PVX_114015...”
- “...inhibitor of cysteine proteases putative 1.68 PVX_112670 unspecified product 16.62 PVX_114015 histone H2A putative 26.75 PVX_114830 elongation factor 1-alpha putative 24.47 PVX_119355 circumsporozoite (CS) protein 1.65 PVX_090930 histone H4 putative 16.20 PVX_093680 Phist protein (Pf-fam-b) 22.81 PVX_090935 histone 2B 24.37 PVX_096315 hypothetical protein conserved 1.45 PVX_114830...”
- Plasmodium vivax Tryptophan Rich Antigen PvTRAg36.6 Interacts with PvETRAMP and PvTRAg56.6 Interacts with PvMSP7 during Erythrocytic Stages of the Parasite
Tyagi, PloS one 2016 - “...domain, ubiquitination Hypothetical protein PVX_095205 Unknown Conserved protein PVX_089515 DUF1777domain, unknown function Elongation factor alpha PVX_114830 Translation/Cytoplasm Basic transcription factor 3b PVX_085220 Transcription/Nucleus a PVM-Parasitophorous vacuole membrane b MC-maurers cleft. To further confirm the specificity of the identified interactions, we performed yeast two hybrid analysis. For...”
- Plasmodium vivax trophozoite-stage proteomes
Anderson, Journal of proteomics 2015 - “...) 30 met(O) Hexokinase PVX_114315 7.9 met(O 2 ) 22.5 Translation Elongation factor 1 alpha PVX_114830 26.4 met(O 2 ), cys(O 3 ), lys(O,O 2 ), leu(O 2 ) 37 met(O) Elongation factor 1 gamma PVX_082845 5.1 phe(O,O 2 ) 12.7 Elongation factor 2 PVX_117925 8.3...”
Q9Y713 Elongation factor 1-alpha from Aspergillus oryzae (strain ATCC 42149 / RIB 40)
28% identity, 67% coverage
TP01_0726, TpMuguga_01g00726 translation elongation factor EF-1 subunit alpha from Theileria parva strain Muguga
28% identity, 67% coverage
- Development of a stable transgenic Theileria equi parasite expressing an enhanced green fluorescent protein/blasticidin S deaminase
Tuvshintulga, Scientific reports 2021 - “...in T . annulata , T . parva and T . orientalis (Gene IDs: TA06720, TP01_0726, TOT_010000685, respectively; https://piroplasmadb.org/piro/ ) 33 , 34 . Thus, generating transgenic parasites by integrating exogenous genes into the ef-1 gene locus is impossible in the aforementioned bovine Theileria parasites. In...”
- Capture-based enrichment of Theileria parva DNA enables full genome assembly of first buffalo-derived strain and reveals exceptional intra-specific genetic diversity
Palmateer, PLoS neglected tropical diseases 2020 - “...Prohibitin 1104 100 100 0 3387 TpMuguga_01g00320 11E Glutaredoxin-like protein 956 100 100 0.3 2769 TpMuguga_01g00726 Tp16 translation elongation factor EF-1 subunit alpha 1316 100 100 1.3 1008 TpMuguga_01g00868 Tp3 Hypothetical protein 856 100 100 1.2 1120 TpMuguga_01g00939 gp34 Schizont surface protein 1067 100 100 0.7...”
- Characterization of the Theileria parva sporozoite proteome
Nyagwange, International journal for parasitology 2018 - “...67.36 TpMuguga_02g00903 Actin 42,270 60.62 TpMuguga_04g00322 Histone H2A 13,498 60.26 TpMuguga_03g00067 Hypothetical protein 11,572 54.06 TpMuguga_01g00726 elF-Tu GTP binding domain 49,779 52.64 TpMuguga_01g00541 Hypothetical protein 24,796 52.36 TpMuguga_04g00383 GAPDH NAD binding domain 36,883 51.37 TpMuguga_01g00701 RAP-1 70,441 47.73 TpMuguga_02g00148 Heat shock 70kDa protein 71,445 42.22 TpMuguga_04g00179...”
PKH_111400 elongation factor 1-alpha from Plasmodium knowlesi strain H
28% identity, 65% coverage
FGSG_08811 elongation factor 1-alpha from Fusarium graminearum PH-1
28% identity, 65% coverage
- Functional Analysis of Genes Specifically Expressed during Aerial Hyphae Collapse as a Potential Signal for Perithecium Formation Induction in Fusarium graminearum
Choi, The plant pathology journal 2024 - “...Real-Time PCR Master Mix from BIOFACT (Daejeon, Korea). To ensure data normalization, the EF1 gene (FGSG_08811) was employed as a control, as previously described ( Shin et al., 2022 ). The primers used for assessing the expression patterns of the selected genes are detailed in Supplementary...”
- Epistatic Relationship between MGV1 and TRI6 in the Regulation of Biosynthetic Gene Clusters in Fusarium graminearum
Shostak, Journal of fungi (Basel, Switzerland) 2023 - “...Fisher, Nepean, ON, Canada). The relative expression was calculated using the Pfaffl method with EF1 (FGSG_08811) and -tubulin (FGSG_09530) as reference genes [ 27 ]. Significance was determined using the Students t -test at p 0.05. The primers used for the amplification are listed in Table...”
- “...Mgv1 expression in MGV1Oex strains. Relative expression was calculated using the Pfaffl method with EF1 (FGSG_08811) and -tubulin (FGSG_09530) as reference genes. Bars represent a mean of three biological replicates with error bars representing standard error. Significance was determined by Students t -test at p 0.05;...”
- Low Molecular Weight and High Deacetylation Degree Chitosan Batch Alleviates Pathogenesis, Toxin Accumulation, and Fusarium Gene Regulation in Barley Leaf Pathosystem
Poznanski, International journal of molecular sciences 2023 - “...DNase-treated RNA was subjected to a polymerase chain reaction (PCR) with Fg -Elongation Factor 1 (FGSG_08811; [ 52 ]) gene primers ( Supplementary Table S1 ) for possible genomic amplification. The lack of any template product after 37 cycles of amplification confirmed the purity of DNA-free...”
- “...the following Fg housekeeping genes were analyzed: Gamma-actin (FGSG_07335) [ 54 ], GAPDH (FGSG_06257), EF1A (FGSG_08811), and B-tubulin (FGSG_09530) [ 52 , 55 ]. The transcript reads of each selected housekeeping gene, based on featureCounts, were compared between Fg inoculated barley leaves not treated with CS_10...”
- Identifying transcription factors associated with Fusarium graminearum virus 2 accumulation in Fusarium graminearum by phenome-based investigation
Kwon, Virus research 2023 - “...curve was generated by raising the temperature from 55 to 95C. Two reference genes, EF1 (FGSG_08811) and UBH (FGSG_01231), were used as internal controls ( Kimand Yun,2011 ; Sonetal., 2013 ). The experiment was conducted with 3 biological replicates. The obtained data were analyzed using Bio-Rad...”
- “...micrograms of total RNA samples extracted after 5 days of incubation. Two reference genes, EF1 (FGSG_08811) and UBH (FGSG_01231), were used as internal controls. The experiment was conducted with three biological replicates. Asterisk means the value significantly differed ( P <0.05) compared to the value of...”
- Identification of reference genes and their validation for gene expression analysis in phytopathogenic fungus Macrophomina phaseolina
Orrego, PloS one 2022 - “...MPH_03132 66.5 UBC Ubiquitin conjugating enzyme FGSG_10805 MPH_13012 97.3 EF1 Eukaryotic translation elongation factor 1 FGSG_08811 MPH_05497 87.5 -TUB -tubulin FGSG_09530 MPH_11587 92.6 CYP1 Cyclophilin 1 FGSG_07439 MPH_07956 71.2 CYP2 Cyclophilin 2 FGSG_00777 MPH_09910 72.9 a Homology search based on BLASTp algorithm at the MycoCosm web...”
- The Antioxidant Guaiacol Exerts Fungicidal Activity Against Fungal Growth and Deoxynivalenol Production in Fusarium graminearum
Gao, Frontiers in microbiology 2021 - “...Table 1 . To standardize the results, the relative abundance of elongation factor 1- (EF1-, FGSG_08811) was also determined and used as the internal standard. Quantification of Deoxynivalenol Production and Tri5 and Tri6 Expression Levels To quantify DON production in vitro , conidia (10 5 )...”
- Fusarium graminearum DICER-like-dependent sRNAs are required for the suppression of host immune genes and full virulence
Werner, PloS one 2021 - “...target transcript to the amount of the reference transcript Elongation factor 1-alpha ( EF1-a , FGSG_08811) gene ( S2 Table ). Plant transcript analysis Leaves were shock frozen at 5 dpi and RT-qPCR was performed as for fungal transcript analysis. Reference genes were Ubiquitin-40S ribosomal protein...”
- A Phenome-Wide Association Study of the Effects of Fusarium graminearum Transcription Factors on Fusarium Graminearum Virus 1 Infection
Yu, Frontiers in microbiology 2021 - “...C-terminal hydrolase ( UBH , locus FGSG_01231) and elongation factor 1 ( EF1 , locus FGSG_08811), were used as internal controls to normalize qRT-PCR results. Data were analyzed using the Bio-Rad CFX Manager V1.6.541.1028 software (Bio-Rad). RNA samples were extracted from at least two independent, biologically...”
- More
C4YDJ3 Elongation factor 1-alpha from Candida albicans (strain WO-1)
P0CY35 Elongation factor 1-alpha 1 from Candida albicans (strain SC5314 / ATCC MYA-2876)
Q59QD6 Elongation factor 1-alpha 2 from Candida albicans (strain SC5314 / ATCC MYA-2876)
28% identity, 66% coverage
- The characterization of RNA-binding proteins and RNA metabolism-related proteins in fungal extracellular vesicles
Dallastella, Frontiers in cellular and infection microbiology 2023 - “...Similarity Species Elongation factor 1-alpha Seryl-tRNA synthetase B0XPK2 * A. fumigatus B0Y360 68.14% A. fumigatus C4YDJ3 88.43% C. albicans Q9HGT6 57.79% C. albicans A0A095DDT6 85.19% C. deuterogattii A0A095DHL3 50.11% C. deuterogattii J9W2J0 84.78% C. neoformans J9VKD0 50.33% C. neoformans A6RGN1 89.57% H. capsulatum C0NE91 * H....”
- Physical Features of Intracellular Proteins that Moonlight on the Cell Surface
Amblee, PloS one 2015 - “...Adhesion Mycobacterium tuberculosis H8F202 [ 97 ] Transcription elongation factor (TEF1) plasminogen binding Candida albicans C4YDJ3 [ 26 ] Triose phosphate isomerase adhesin Paracoccidioides brasiliensis Q96VN5 [ 98 ] Triose phosphate isomerase adhesin Staphylococcus aureus D9RMW0 [ 99 ] Triose phosphate isomerase plasminogen binding Streptococcus anginosus...”
- Adhesive protein-mediated cross-talk between Candida albicans and Porphyromonas gingivalis in dual species biofilm protects the anaerobic bacterium in unfavorable oxic environment
Bartnicka, Scientific reports 2019 - “...Glucan 1,3--glucosidase (Bgl2) nd 3.9 nd nd Q9UWF6 Lysophospholipase 1 (Plb1) nd 3.1 nd nd P0CY35 Elongation factor 1- 1 (Tef1) nd nd nd 2.7 510 8 C. albicans cells were grown with 510 9 P. gingivalis W83 or KRAB cells in RPMI 1640 medium for...”
- iTRAQ-Based Quantitative Proteomic Analysis Reveals Proteomic Changes in Mycelium of Pleurotus ostreatus in Response to Heat Stress and Subsequent Recovery
Zou, Frontiers in microbiology 2018 - “...4.79 1 1.729 1.817 Q1E5R1 ATP-dependent RNA helicase DHH1 Coccidioides immitis 11.72 1 0.000 2.639 P0CY35 Elongation factor 1-alpha 1 Candida albicans 19 1 1.161 0.195 Q00251 Elongation factor 1-alpha Aureobasidium pullulans 21.57 1 0.495 0.670 A5DPE3 Elongation factor 1-alpha Meyerozyma guilliermondii 14.63 1 1.183 1.948...”
- Effect of the Ethyl Acetate Fraction of Eugenia uniflora on Proteins Global Expression during Morphogenesis in Candida albicans
Silva-Rocha, Frontiers in microbiology 2017 - “...YET2 Protein transport Q04210 19,178 10.21 Decrease 45 Elongation factor 1-alpha 1 TEF1 Protein syntesis P0CY35 50,012 9.47 46 Protein MTH1 MTH1 Glucose transport. signal transduction P35198 49,060 9.49 Decrease 47 Nucleoside diphosphate kinase NDK1 ATP synthesis. Nucleotide metabolism Q9UR66 2,379 4.75 Decrease 49 ATP-dependent RNA...”
- Delicate Metabolic Control and Coordinated Stress Response Critically Determine Antifungal Tolerance of Candida albicans Biofilm Persisters
Li, Antimicrobial agents and chemotherapy 2015 - “...elongation factor Cam1p Putative uncharacterized protein EFB1 P0CY35 Q59K68 Q59QD6 Q5A0M4 P25997 Q5ABC3 Q59QS2 Q5A652 TEF1 0.80 6.06E-06 EFT2 CEF3 TUF1...”
- Delicate Metabolic Control and Coordinated Stress Response Critically Determine Antifungal Tolerance of Candida albicans Biofilm Persisters
Li, Antimicrobial agents and chemotherapy 2015 - “...factor Cam1p Putative uncharacterized protein EFB1 P0CY35 Q59K68 Q59QD6 Q5A0M4 P25997 Q5ABC3 Q59QS2 Q5A652 TEF1 0.80 6.06E-06 EFT2 CEF3 TUF1 CAM1-1 EFB1 1.55...”
EMWEY_00058460 elongation factor 1-alpha, putative from Eimeria maxima
28% identity, 65% coverage
FPSE_11980 EF1A from Fusarium pseudograminearum CS3096
28% identity, 65% coverage
Q01372 Elongation factor 1-alpha from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
NCU02003 elongation factor 1 alpha from Neurospora crassa OR74A
29% identity, 67% coverage
- Effect of Amino Acids on Fusarium oxysporum Growth and Pathogenicity Regulated by TORC1-Tap42 Gene and Related Interaction Protein Analysis.
Deng, Foods (Basel, Switzerland) 2023 - “...P35143 GPDA Glyceraldehyde-3-phosphate dehydrogenase 36,500 712 Q01233 hsps-1 Heat shock 70 kDa protein 70,738 683 Q01372 tef-1 Elongation factor 1-alpha 49,983 612 Q6TCF2 ACT Actin 41,809 604 Q07421 PMA1 Plasma membrane ATPase 99,393 554 Q6RG04 ENO1 Enolase 47,388 553 Q76KF9 enoA Enolase 47,264 545 Q01765 TEF...”
- The transcriptional factor Clr-5 is involved in cellulose degradation through regulation of amino acid metabolism in Neurospora crassa
Xue, BMC biotechnology 2023 - “...clr-5 , the ORF region of clr-5 under the control of the strong constitutive tef1 (NCU02003) promoter of N. crassa was inserted into between Bgl II and Bam HI sites of plasmid pAN52-bar, generating the plasmid pAN52-OE-clr-5. The constructed recombinant plasmid linearized were separately transformed into...”
- F-actin dynamics in Neurospora crassa
Berepiki, Eukaryotic cell 2010 (secret)
BBA_02388 translation elongation factor 1 alpha from Beauveria bassiana ARSEF 2860
28% identity, 69% coverage
BKCO1_4100086 elongation factor 1-alpha from Diplodia corticola
28% identity, 66% coverage
- Five Fungal Pathogens Are Responsible for Bayberry Twig Blight and Fungicides Were Screened for Disease Control
Li, Microorganisms 2020 - “...and 100% coverage values, respectively; whereas, it was 97.19% and 99.70%, similar to Diplodia corticola BKCO1_4100086 in tef 1- sequence and N. ribis AFTOL-ID 1232 in the LSU sequence with 100% and 97% coverage values, respectively. Phylogenetic analysis of isolate F7 based on the joint ITS...”
- “...83%, 43% and 100% coverage values, respectively; 96.49% identical (100% coverage value) to D. corticola BKCO1_4100086 in tef1- sequence. Phylogenetic analysis of isolate L3 based on the joint ITS + tub2 sequences indicated that it was grouped in the same branch of L . theobromae and...”
G8BCR8 Elongation factor 1-alpha from Candida parapsilosis (strain CDC 317 / ATCC MYA-4646)
CPAR2_207060 uncharacterized protein from Candida parapsilosis
28% identity, 66% coverage
- Proteomics Readjustment of the Yarrowia lipolytica Yeast in Response to Increased Temperature and Alkaline Stress
Sekova, Microorganisms 2021 - “...20/9.5 23.1/9.7 56 CPCR1, Carbonyl reductase H9DXW0 92/3/15 14/8.7 37.1/6.3 57 CPAR2_207060, Elongation factor 1-alpha G8BCR8 125/3/7 14/8.5 50/9.1 58 CPCR1, Carbonyl reductase H9DXW0 99/6/16 12/8.7 37.1/6.3 59 CPAR2_101390, Nucleoside diphosphate kinase G8B6L9 142/9/39 13/7 16.8/8.6 60 CPAR2_808670, Glyceraldehyde-3-phosphate dehydrogenase G8BB94 114/7/30 13/6.5 36.1/6.2 61 CPAR2_500390,...”
- Proteomics Readjustment of the Yarrowia lipolytica Yeast in Response to Increased Temperature and Alkaline Stress
Sekova, Microorganisms 2021 - “...under heat stress, it was the Q0ZIC1_CANPA protein, while under combined stress, it was the CPAR2_207060 protein fragment. We detected no common proteins for the alkaline and combined stresses. Of note, SSA4, revealed under both thermal and alkaline stress, was not detected under the conditions of...”
- “...subunit 5 G8BGX1 141/3/27 20/9.5 23.1/9.7 56 CPCR1, Carbonyl reductase H9DXW0 92/3/15 14/8.7 37.1/6.3 57 CPAR2_207060, Elongation factor 1-alpha G8BCR8 125/3/7 14/8.5 50/9.1 58 CPCR1, Carbonyl reductase H9DXW0 99/6/16 12/8.7 37.1/6.3 59 CPAR2_101390, Nucleoside diphosphate kinase G8B6L9 142/9/39 13/7 16.8/8.6 60 CPAR2_808670, Glyceraldehyde-3-phosphate dehydrogenase G8BB94 114/7/30...”
5o8wA / P02994 Crystal structure analysis of the yeast elongation factor complex eef1a:eef1ba (see paper)
29% identity, 66% coverage
- Ligand: glutamine (5o8wA)
EF1A_YEAST / P02994 Elongation factor 1-alpha; EF-1-alpha; Eukaryotic elongation factor 1A; eEF1A; Translation elongation factor 1A from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 19 papers)
NP_009676 translation elongation factor EF-1 alpha from Saccharomyces cerevisiae S288C
NP_015405 translation elongation factor EF-1 alpha from Saccharomyces cerevisiae S288C
YBR118W Tef2p from Saccharomyces cerevisiae
YPR080W Tef1p from Saccharomyces cerevisiae
29% identity, 66% coverage
- function: GTP-binding component of the eukaryotic elongation factor 1 complex (eEF1). In its active GTP-bound form, binds to and delivers aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. In the presence of a correct codon-anticodon match between the aminoacyl-tRNA and the A-site codon of the ribosome-bound mRNA, the ribosome acts as a GTPase activator and the GTP is hydrolyzed. The inactive GDP-bound form leaves the ribosome and must be recycled by its guanine nucleotide exchange factor (GEF) (eEF1B subcomplex) before binding another molecule of aminoacyl-tRNA. Required for nuclear export of aminoacyl-tRNAs. May also be involved in translational quality control by targeting cotranslationally damaged proteins to the proteasome. Also exhibits actin filament-binding and -bundling activities and is involved in cytoskeleton organization. Plays a role as a negative regulator of GCN2 kinase activity by inhibiting GCN2- mediated eIF-2-alpha phosphorylation in amino acid-repleted cells (PubMed:21849502).
subunit: The eukaryotic elongation factor 1 complex (eEF1) is probably a heterohexamer. Two trimeric complexes, each composed of eEF1A (TEF1 or TEF2), eEF1Balpha (EFB1) and eEF1Bgamma (CAM1 or TEF4), are probably dimerized via the eF1Bgamma subunits (PubMed:11106763, PubMed:11373622). Interacts with eEF1Balpha; the interaction is direct (PubMed:11106763, PubMed:11373622). Interacts with GCN2 (via C- terminus); this interaction is direct, occurs in amino acid-repleted cells, may be stabilized in a ribosome-dependent manner, reduces GCN2- mediated eIF-2-alpha phosphorylation and is lost in amino acid-starved cells and by uncharged tRNAs (PubMed:21849502). Interacts with CEX1 (PubMed:17203074). Interacts with elongation factor 3 (YEF3 or HEF3) (PubMed:9990316). Interacts with NAP1 (PubMed:18086883). Interacts with SRV2 (PubMed:9125210). Interacts with chaperone ZPR1; the interaction is required for its proper folding (PubMed:36630955, PubMed:9852145). Binds to actin and forms a ternary complex with BNI1 and profilin (PubMed:11290701, PubMed:9591785). Interacts with the proteasome, probably via RPT1 (PubMed:15601860). Associates with ribosomes (PubMed:21849502). - Chp1 is a dedicated chaperone at the ribosome that safeguards eEF1A biogenesis
Minoia, Nature communications 2024 - “...chain length), for the complexes Chp1:Egd2:Egd1 (Uniprot accessions; Q0897:P38879:Q02642), NAC:NAC:PBDC1 (Q13765:P20290:Q9BVG4) and eEF1A domain I:Chp1 (P02994 residues 1 to 250:Q0897) are supplied as Supplementary Data 2 and 3 , respectively together with sequence coverage, predicted lDDT per position, predicted aligned error (PAE) and javascript object notation...”
- Cadmium Sulfide Quantum Dots Adversely Affect Gametogenesis in Saccharomyces cerevisiae
Rossi, Nanomaterials (Basel, Switzerland) 2022 - “...guanyltransferase (P41940) 73.16 37% 40 6.3 Metabolic process EF-1 (Tef1/2) Translational elongation factor EF-1 alpha (P02994) 93.01 44% 50 9.1 Translation 1 The probability that the observed match is not a random event. 2 The ratio (%) between the number of amino-acid residues covered in the...”
- Electroporation and Mass Spectrometry: A New Paradigm for In Situ Analysis of Intact Proteins Direct from Living Yeast Colonies
Kocurek, Analytical chemistry 2020 - “...14 2.4 10 08 A5Z2X5 YPR010C-A 1004.56 5 5017.78 3.5 10 60 1.0 10 51 P02994 EF1A 1042.05 12 12492.50 3.1 10 33 8.9 10 28 Q08245 ZEO1 1046.52 7 7318.62 7.2 10 71 2.1 10 62 Q12497 FMP16 1069.78 5 5343.88 9.2 10 52 2.7...”
- Molecular and Macromolecular Changes in Bottle-Aged White Wines Reflect Oxidative Evolution-Impact of Must Clarification and Bottle Closure
Coelho, Frontiers in chemistry 2018 - “...maintenance of chromosomes protein 4 isoform X2 1 0.5 731421658 Uncharacterized protein LOC100263595 0.67 0 P02994 Elongation Factor 1-alpha 1 0.5 Bold values represent the highest mean values of matched peptides between low and medium oxidation level . Eight of them presented on average more peptides...”
- Protein glutaminylation is a yeast-specific posttranslational modification of elongation factor 1A
Jank, The Journal of biological chemistry 2017 - “...ClustalW with eEF1A from S. cerevisiae (accession no. P02994), S. pombe (accession no. P0CT53), M. musculus (accession no. P10126), B. taurus (accession no....”
- Integrated analysis of individual codon contribution to protein biosynthesis reveals a new approach to improving the basis of rational gene design
Villada, DNA research : an international journal for rapid publication of reports on genes and genomes 2017 - “...gaps and maintain the integrity of the S. cerevisiae sequence as the model. The datasets P02994 for EF1A and P32589 for SSE1 from UniProtKB were used as a reference for the secondary structure motifs and 3D structural features. To test whether codon conservation in protein secondary...”
- Vegemite Beer: yeast extract spreads as nutrient supplements to promote fermentation
Kerr, PeerJ 2016 (no snippet) - Enzymatic attributes of an l-isoaspartyl methyltransferase from Candida utilis and its role in cell survival
Banerjee, Biochemistry and biophysics reports 2015 - “...translation initiation factor 3 subunit 7-like protein Q4Q6Y6 70 Protein synthesis 22. Elongation factor 1-alpha P02994 73 Protein sysnthesis 23. Protein RER1 P25560 71 Protein transport 24. GTP-binding protein YPT1 P01123 74 Protein transport 25. Clan CA, family C1, cathepsin l -like cysteine peptidase A2EMU7 68...”
- More
- Mutational analysis reveals potential phosphorylation sites in eukaryotic elongation factor 1A that are important for its activity.
Mateyak, FEBS letters 2021 - GeneRIF: Mutational analysis reveals potential phosphorylation sites in eukaryotic elongation factor 1A that are important for its activity.
- Yeast translation elongation factor-1A binds vacuole-localized Rho1p to facilitate membrane integrity through F-actin remodeling.
Bodman, The Journal of biological chemistry 2015 - GeneRIF: the Rho1p-eEF1A complex acts to spatially localize a pool of eEF1A to vacuoles where it can readily organize F-actin.
- The yeast rapid tRNA decay pathway competes with elongation factor 1A for substrate tRNAs and acts on tRNAs lacking one or more of several modifications.
Dewe, RNA (New York, N.Y.) 2012 - GeneRIF: Elongation factor 1A (EF-1A) competes with the RTD pathway for substrate tRNAs, since its overexpression suppresses the tRNA degradation and the growth defect of strains subject to RTD, whereas reduced levels of EF-1A have the opposite effect.
- Translation elongation factor 1A is essential for regulation of the actin cytoskeleton and cell morphology.
Gross, Nature structural & molecular biology 2005 (PubMed)- GeneRIF: The actin bundling activity of eukaryotic translation elongation factor 1A is not required for protein synthesis functions but is essential for cytoskeletal integrity. [eEF1A]
- Domain II of the translation elongation factor eEF1A is required for Gcn2 kinase inhibition.
Ramesh, FEBS letters 2020 (PubMed)- GeneRIF: Domain II of the translation elongation factor eEF1A is required for Gcn2 kinase inhibition.
- Protein Methylation and Translation: Role of Lysine Modification on the Function of Yeast Elongation Factor 1A.
White, Biochemistry 2019 - GeneRIF: Loss of EF1A methylation was not lethal but resulted in reduced growth rates, particularly under caffeine and rapamycin stress conditions.
- Novel N-terminal and Lysine Methyltransferases That Target Translation Elongation Factor 1A in Yeast and Human.
Hamey, Molecular & cellular proteomics : MCP 2016 - GeneRIF: Data indicate that the methylation of lysine (Lys) in elongation factor 1A (eEF1A) by methyltransferase is conserved from yeast to human.
- Yeast translation elongation factor-1A binds vacuole-localized Rho1p to facilitate membrane integrity through F-actin remodeling.
Bodman, The Journal of biological chemistry 2015 - GeneRIF: the Rho1p-eEF1A complex acts to spatially localize a pool of eEF1A to vacuoles where it can readily organize F-actin.
- In vivo biochemical analyses reveal distinct roles of β-importins and eEF1A in tRNA subcellular traffic.
Huang, Genes & development 2015 - GeneRIF: Tef1/2 (the yeast form of translation elongation factor 1alpha [eEF1A]) aids the specificity of Msn5 for aminoacylated tRNAs to form a quaternary complex consisting of Msn5, RanGTP, aminoacylated tRNA, and Tef1/2
- Saccharomyces cerevisiae Eukaryotic Elongation Factor 1A (eEF1A) Is Methylated at Lys-390 by a METTL21-Like Methyltransferase.
Jakobsson, PloS one 2015 - GeneRIF: Ynl024c is the enzyme responsible for methylation of eEF1A at Lys390.
- Methylation of translation elongation factor 1A by the METTL10-like See1 methyltransferase facilitates tombusvirus replication in yeast and plants.
Li, Virology 2014 (PubMed)- GeneRIF: Methylation of TEF1 by See1 facilitates tombusvirus replication in Saccharomyces cerevisiae.
- Translation elongation factor 1A mutants with altered actin bundling activity show reduced aminoacyl-tRNA binding and alter initiation via eIF2α phosphorylation.
Perez, The Journal of biological chemistry 2014 - GeneRIF: Translation elongation factor 1A mutants with altered actin bundling activity show reduced aminoacyl-tRNA binding and alter initiation via eIF2alpha phosphorylation.
- More
- Specificity of mRNA Folding and Its Association with Evolutionarily Adaptive mRNA Secondary Structures
Yu, Genomics, proteomics & bioinformatics 2021 - “...region around the 70th nucleotide after the start codon ( Figure8 A). Taking the transcript YBR118W as an example, base pairing within the region of 68th94th nucleotides is highly specific because of the multiple supportive chimeric reads ( Figure8 B). We further predicted the secondary structure...”
- “...C. An example of the folding specificities of functional secondary structures in the yeast gene YBR118W . The scores of folding partnerships (see Material and methods) among the first 150 nucleotide chimeric reads are plotted as color gradients, the scale of which is indicated by the...”
- The role of PCNA as a scaffold protein in cellular signaling is functionally conserved between yeast and humans
Olaisen, FEBS open bio 2018 - “...Mrp2 37S ribosomal protein MRP2 12, 42 YGR240C Pfk1 ATPdependent 6phosphofructokinase subunit alpha 1, 2 YBR118W Tef2 Elongation factor 1alpha 12 YBR203W Cos111 Fbox protein Cos111 30 YDL164C Cdc9 DNA ligase 1 10 YDL191W Rpl35A 60S ribosomal protein L35A 12 YDR125C Ecm18 Extracellular mutant protein 18...”
- Mechanism and Regulation of Protein Synthesis in Saccharomyces cerevisiae
Dever, Genetics 2016 - “...YEF3/TEF3 HEF3 HYP2 ANB1 SUP45 SUP35 RLI1 YPR080w YBR118w YAL003w YKL081w YPL048w YOR133w YDR385w YLR249w YNL014w YEL034w YJR047c YBR143c YDR172w YDR091c 458...”
- Lipid droplet dynamics in budding yeast
Wang, Cellular and molecular life sciences : CMLS 2015 - “...(GAPDH) V V C/LP/M/PM TEF1/2 YPR080W/ YBR118W Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) V V C/M/ribosome Translational elongation factor EF-1 alpha...”
- Experimental evidence validating the computational inference of functional associations from gene fusion events: a critical survey
Promponas, Briefings in bioinformatics 2014 - “...YER042W YCL033C Yes 3252888 11 YER027C YGL115W Yes 18390971 13 YJL126W YDR305C Yes 9955180 21 YBR118W YKL001C Yes 46313 23 YDR419W YFR027W No 7678718 Source: http://www.yeastnet.org/data/yeastnet2.orf.txt [ 76 ]. Thus, it must be appreciated that with the availability of an ever increasing number of genomes acting...”
- Hierarchical Dirichlet process model for gene expression clustering
Wang, EURASIP journal on bioinformatics & systems biology 2013 - “...processing YDL126c YCL016c YDL188c YAL040c YEL019c YER122c YLR035c YLR055c YML032c YMR078c Protein synthesis YDR091c YGL103w YBR118w YBL057c YBR101c YBR181c YDL083c YDL184c YDR012w YDR172w YGL105w YGL129c YJL041w YJL125c YJR113c YLR185w YPL037c YPL048w YLR009w YHL001w YHL015w YHR011w YHR088w YDR450w YEL034w Protein fate YAL016w YBL009w YBR044c YDL040c Cell fate...”
- A novel biclustering approach with iterative optimization to analyze gene expression data
Sutheeworapong, Advances and applications in bioinformatics and chemistry : AABC 2012 - “...86 genes are involved in a cellular nitrogen metabolic process (GO:0034641), eg, SAS3 (YBL052C), TEF2 (YBR118W), and SWD3 (YBR175W), are co-expressed under twelve conditions. In bicluster 118 (0.037 with bicluster 56 of CC), 26 out of 66 genes, eg, RRN6 (YBL014C), ORC2 (YBR060C), and PAF1 (YBR279W),...”
- The proteomics of quiescent and nonquiescent cell differentiation in yeast stationary-phase cultures
Davidson, Molecular biology of the cell 2011 - “...YPR080W TEF1 Translational elongation factor EF1 9.16 8.34 YLL024C SSA2 ATP binding protein 9.16 8.24 YBR118W TEF2 Translational elongation factor EF1 9.09 7.81 YJR009C TDH2 Glyceraldehyde-3-phosphate dehydrogenase 8.91 7.59 YAL005C SSA1 ATPase 8.71 9.05 YLR249W YEF3 Translational elongation factor 3 8.54 6.62 YDL055C PSA1 GDP-mannose pyrophosphorylase...”
- More
- Identification and Functional Testing of Novel Interacting Protein Partners for the Stress Sensors Wsc1p and Mid2p of Saccharomyces cerevisiae
Santiago-Cartagena, G3 (Bethesda, Md.) 2019 - “...Sso1p; SSO2 has a paralog, SSO1, that arose from the whole genome duplication viable TEF1 YPR080W WSC1/MID2 Translational elongation factor EF-1 alpha; GTP-bound active form, binds to and delivers aminoacylated tRNA to the A-site of ribosomes for elongation of nascent polypeptides; moonlighting function as an actin...”
- Modular 5'-UTR hexamers for context-independent tuning of protein expression in eukaryotes
Petersen, Nucleic acids research 2018 - “...(700 bp; upstream position +1 of YNL301C) and TEF1 (420 bp; upstream position +1 of YPR080W) were cloned together with yeast-enhanced GFP (yeGFP; Supplementary Table S6 ) ( 39 ) with six randomized nucleotides upstream the start codon, into 0.03 pmol linearized EasyClone vector pCfB261 amplified...”
- The role of PCNA as a scaffold protein in cellular signaling is functionally conserved between yeast and humans
Olaisen, FEBS open bio 2018 - “...Translation initiation factor eIF2B subunit gamma 12 YPR031W Nto1 NuA3 HAT complex component Nto1 11 YPR080W Tef1 Elongation factor 1alpha 12 YPR105C Cog4 Conserved oligomeric Golgi complex subunit 4 20 YPR145W Asn1 Glutaminedependent asparagine synthetase 1 1 YBR108W Aim3 Altered inheritance of mitochondria protein 3 YDL169C...”
- Generation of infectious recombinant Adeno-associated virus in Saccharomyces cerevisiae
Barajas, PloS one 2017 - “...DB228-pESC(L)-Rep52(op)-VP1 and DB026-pESC(L)-VP1 respectively. The intergenic region between S . cerevisiae MRL1 (YPR079W) and TEF1 (YPR080W) was amplified with primers DB113 and DB264 and digested with Bam HI and Pac I. The VP1 product digested with Spe I and Bgl II and the intergenic region product...”
- “...digested with Not I. The intergenic region between S . cerevisiae MRL1 (YPR079W) and TEF1 (YPR080W) containing a polyadenylation signal and the TEF1 promoter was amplified by PCR using primers DB296 and DB299 using S . cerevisiae DNA as template. The resulting product was digested with...”
- Impact of plasmid architecture on stability and yEGFP3 reporter gene expression in a set of isomeric multicopy vectors in yeast
Hohnholz, Applied microbiology and biotechnology 2017 - “...the T synth8 synthetic transcription termination sequence (Curran et al. 2015 ). TEF1 promoter sequences (YPR080W; 407bp) were derived by PCR from yeast strain SY992 (Tomlin et al. 2001 ) with a Sac I site added to the 5 end. yEGFP3 sequences (714bp) were amplified from...”
- Mechanism and Regulation of Protein Synthesis in Saccharomyces cerevisiae
Dever, Genetics 2016 - “...EFT2 YEF3/TEF3 HEF3 HYP2 ANB1 SUP45 SUP35 RLI1 YPR080w YBR118w YAL003w YKL081w YPL048w YOR133w YDR385w YLR249w YNL014w YEL034w YJR047c YBR143c YDR172w YDR091c...”
- Transcriptome-wide mapping of pseudouridines: pseudouridine synthases modify specific mRNAs in S. cerevisiae
Lovejoy, PloS one 2014 - “...nt Region Name chr16:731679 9.278 6.465 8.116 YPR102C 67 CDS RPL11A chr16:700830 7.601 4.857 6.445 YPR080W 238 CDS TEF1 chr15:980500 5.811 5.550 6.893 YORCd25 92 N/A YORC25 chr13:24202 7.835 4.427 5.301 YML123C 1599 CDS PHO84 chr1:72955 7.342 5.389 4.377 YAL038W 1168 CDS CDC19 chr7:735635 5.811 5.550...”
- “...1486 CDS PHO84 chr1:73018 6.348 2.473 4.773 YAL038W 1231 CDS CDC19 chr16:702042 4.004 4.914 4.619 YPR080W 1450 3-UTR TEF1 chr11:164375 2.988 5.089 5.165 YKL152C 11 CDS GPM1 chr4:556458 3.170 5.004 4.742 YDR050C 12 CDS TPI1 chr13:511403 3.335 5.047 4.463 YMR122W-A 89 CDS YMR122W-A chr2:89115 0.262 5.487...”
- Global identification of new substrates for the yeast endoribonuclease, RNase mitochondrial RNA processing (MRP)
Aulds, The Journal of biological chemistry 2012 - “...with ribosomes YNL016W; poly(A) RNA-binding protein YPR080W; translational elongation factor EF-1 SNR13; snRNA YBR189W YJL177W YGR251W YHL001W YCL037C;...”
- More
APL_1844 sulphate adenylate transferase subunit 1 from Actinobacillus pleuropneumoniae L20
40% identity, 37% coverage
- Effects of growth conditions on biofilm formation by Actinobacillus pleuropneumoniae
Labrie, Veterinary research 2010 - “...APL_2016 fhuA Ferrichrome-iron receptor FhuA 2.031 APL_1847 cysW Sulfate transport system permease protein cysW 2.195 APL_1844 cysN Sulphate adenylate transferase subunit 1 2.375 APL_1848 cysA Sulfate/thiosulfate import ATP-binding protein cysA 2.401 APL_1843 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component 2.757 APL_1127 APL_1127 Predicted Na+/alanine symporter 3.402 Hypothetical/unknown/unclassified...”
BMR1_03g03490 elongation factor EF-1 alpha subunit from Babesia microti strain RI
28% identity, 65% coverage
- Establishment of a stable transfection method in Babesia microti and identification of a novel bidirectional promoter of Babesia microti
Jaijyan, Scientific reports 2020 - “...BM-CTQ41297 promoter, a gfp gene at downstream region of the promoter and a 3UTR of BMR1_03g03490 gene. The details of the episomal construct are shown in Fig. 1 D. The test episomal construct electroporated parasites were GFP positive as confirmed by fluorescence microscopy and shown in...”
- “...sequence of Pb_ANKA-DHFR promoter and a GFP gene along with~600 nucleotides from the 3UTR of BMR1_03g03490 (Fig. 2 B). Twenty-four hours post-electroporation transfected parasites were found to be GFP positive as compared to the control (Fig. 2 A,C). Our results confirmed that Pb_DHFR promoter is recognized...”
- Antigen Discovery, Bioinformatics and Biological Characterization of Novel Immunodominant Babesia microti Antigens
Verma, Scientific reports 2020 - “...AP2 BmR1_02g00670 XP_012647909.2 TP+peptidylprolyl isomerase Plastid protein folding protein peptidylprolyl isomerase with a transit peptide BmR1_03g03490 XP_012649309.1 sGTPase Translation elongation factor EF-1 alpha subunit BmR1_04g06300 XP_012649865.1 SIG adhesion/Cell surface/exported protein BmR1_01g01121 XP_012647300.2 Apicomplexa specific domain (173231) Miscellaneous Apicomplexan+Vitrella BmR1_04g08775 XP_012650340.1 HSP90 Chaperone HSP90 BmR1_02g02760 XP_012648315.1 NTN-HYDROLASE...”
B5Y4J2 Elongation factor 1-alpha from Phaeodactylum tricornutum (strain CCAP 1055/1)
30% identity, 64% coverage
- Silicon enhances the growth of Phaeodactylum tricornutum Bohlin under green light and low temperature
Zhao, Scientific reports 2014 - “...influence the photosynthetic efficiency. Protein metabolism and chromosome integration Expression of two translation elongation factors (B5Y4J2 and B8LEI9) was down-regulated when silicon was unavailable. Three predicted proteins (B7G715, B7FQU7, and B7G9G2) that function as structural constituents of ribosomes were regulated in two ways: two were up-regulated...”
- “...B7FX66 Histone linker H1 Down B7GB44 Predicted protein Up B5Y3W7 Predicted protein Up Protein synthesis B5Y4J2 Translation elongation factor, EF-1, alpha subunit Down B7FY02 Ubiquitin extension protein 3 Up B7G715 Predicted protein Down K0ST15 Hypothetical protein THAOC_10275 Down B7FQU7 Predicted protein Down B8LEI9 Hypothetical protein THAPSDRAFT_bd1861...”
NECHADRAFT_59329 uncharacterized protein from Fusarium vanettenii 77-13-4
29% identity, 67% coverage
- Diversity of Fusarium species and mycotoxins contaminating pineapple
Stępień, Journal of applied genetics 2013 - “...identification. Fourteen reference strains were also included in the phylogenetic reconstruction: F. solani FGSC 9596 (NECHADRAFT_59329), F. graminearum NRRL 31084 (FGSG_08811), F. oxysporum f. sp. lycopersici NRRL 34936 (FOXG_03515), F. verticillioides FGSC 7600 (FVEG_02381), F. ananatum NRRL 53131 (HM347128), F. begoniae NRRL 25300 (AF160293), F. bulbicola...”
Q00080 Elongation factor 1-alpha from Plasmodium falciparum (isolate K1 / Thailand)
27% identity, 65% coverage
Ecym_3450 translation elongation factor EF-1 alpha from Eremothecium cymbalariae DBVPG#7215
28% identity, 66% coverage
FFUJ_05795 translation elongation factor 1 alpha from Fusarium fujikuroi IMI 58289
29% identity, 65% coverage
TERG_00548 elongation factor 1-alpha from Trichophyton rubrum CBS 118892
28% identity, 67% coverage
XP_006964056 translation elongation factor 1a from Trichoderma reesei QM6a
28% identity, 67% coverage
K6UUT1 Elongation factor 1-alpha from Plasmodium cynomolgi (strain B)
28% identity, 65% coverage
C1LWQ6 Elongation factor 1-alpha from Schistosoma japonicum
29% identity, 65% coverage
- A comparative proteomics analysis of the egg secretions of three major schistosome species
Carson, Molecular and biochemical parasitology 2020 - “...C1LIA4 Dihydrolipoyl dehydrogenase 91 Q9Y0D3 Peroxiredoxin, Prx2 C1LMD2 Thioredoxin peroxidase 90 G4VAD2 Elongation factor 1-alpha C1LWQ6 Elongation factor 1-alpha 89 G4VRK1 Putative glyoxalase II Q86DW6 Hydroxyacylglutathione hydrolase 89 G4VJY9 Nucleoside diphosphate kinase Q86EJ4 Nucleoside diphosphate kinase 88 G4M0P7 Cell division control protein 48 Q5D9C5 SJCHGC09453 protein...”
tef102 / RF|NP_595255.1 translation elongation factor EF-1 alpha Ef1a-b from Schizosaccharomyces pombe (see paper)
SPBC839.15c translation elongation factor EF-1 alpha Ef1a-c (PMID 9099890) from Schizosaccharomyces pombe
SPAC23A1.10 translation elongation factor EF-1 alpha Ef1a-b (PMID 9099890) from Schizosaccharomyces pombe
27% identity, 67% coverage
- CharProtDB Source (per GeneDB): GeneDB_Spombe
- Inorganic polyphosphate abets silencing of a sub-telomeric gene cluster in fission yeast
Sanchez, microPublication biology 2023 - “...glucose dehydrogenase -1.13 SPBPB8B6.04c grt1 DNA-binding transcription factor -1.09 SPCC737.04 UPF0300 family protein 6 -1.08 SPBC839.15c tef103 translation elongation factor EF-1 alpha -1.08 SPAC22A12.17c short chain dehydrogenase -1.07 SPAC26H5.09c oxidoreductase in NADPH regeneration -1.07 SPBC24C6.09c phosphoketolase family protein -1.07 SPAC23A1.10 tef102 translation elongation factor EF-1 alpha...”
- Posttranslational Arginylation Enzyme Arginyltransferase1 Shows Genetic Interactions With Specific Cellular Pathways in vivo
Wiley, Frontiers in physiology 2020 - “...RSN1 TMEM63B,TMEM63C, TMEM63A clr3 SPBC800.03 0.0176608 2.37265 Histone deacetylase (class II) Clr3 HDA1 HDAC6,HDAC10 tef103 SPBC839.15c 0.0180524 2.36454 Translation elongation factor EF-1 alpha Ef1a-c TEF2,TEF1 EEF1A1,EEF1A2 hos2 SPAC3G9.07c 0.0188808 2.34788 Histone deacetylase (class I) Hos2 HOS2 HDAC1,HDAC2 pab1 SPAC227.07c 0.0193724 2.33829 Protein phosphatase PP2A regulatory subunit...”
- Inorganic polyphosphate abets silencing of a sub-telomeric gene cluster in fission yeast
Sanchez, microPublication biology 2023 - “...short chain dehydrogenase -1.07 SPAC26H5.09c oxidoreductase in NADPH regeneration -1.07 SPBC24C6.09c phosphoketolase family protein -1.07 SPAC23A1.10 tef102 translation elongation factor EF-1 alpha -1.07 SPAC1039.09 isp5 amino acid transmembrane transporter -1.05 SPCC338.12 pbi2 vaculoar proteinase B inhibitor -1.04 SPBC1815.01 eno101 enolase -1.04 SPBC29B5.02c isp4 oligopeptide transmembrane transporter...”
- Expression of Huntingtin and TDP-43 Derivatives in Fission Yeast Can Cause Both Beneficial and Toxic Effects
Marte, International journal of molecular sciences 2022 - “...wild-type and M322K forms, respectively). As a reference, the translation elongation factor EF1a (coded from SPAC23A1.10 ) is the most abundant protein during vegetative growth of the fission yeast proteome [ 42 ], more than a million copies per cell; considering that the cell volume of...”
- The conserved Wobble uridine tRNA thiolase Ctu1-Ctu2 is required to maintain genome integrity
Dewez, Proceedings of the National Academy of Sciences of the United States of America 2008 - “...this interaction was A 191 B 97 64 51 39 SPAC23A1.10 SPBC2G5.03 (Ctu1) SPBC19c2.13c (Ctu2) F29F11.3 ( ) 75h 28 RNAi 25C Fig. 2. Ctu1 forms a functional complex...”
- “...of polypeptides associated with SPBC2G5.03 (Ctu1). The SPAC23A1.10 is a translation elongation factor often found in TAP purifications and was therefore...”
F2D525 Elongation factor 1-alpha from Hordeum vulgare subsp. vulgare
29% identity, 65% coverage
SPSK_06026 elongation factor 1-alpha from Sporothrix schenckii 1099-18
29% identity, 67% coverage
ef1a-a / GI|3150122 translation elongation factor EF-1 alpha Ef1a-a from Schizosaccharomyces pombe (see paper)
P0CT53 Elongation factor 1-alpha-A from Schizosaccharomyces pombe (strain 972 / ATCC 24843)
SPCC794.09c translation elongation factor EF-1 alpha Ef1a-a (PMID 9099890) from Schizosaccharomyces pombe
27% identity, 67% coverage
- CharProtDB Source (per GeneDB): GeneDB_Spombe
- Proteasome regulation of petite-negativity in fission yeast.
Amberg, bioRxiv : the preprint server for biology 2024 - “...0.018 heat shock protein Ssz1 O42943 SPBC16H5.08c 0.27 0.032 ribosome biogenesis ATPase, Arb family ABCF2-like P0CT53 tef101 0.27 0.007 translation elongation factor EF-1 alpha Ef1a-a Q9UUE6 krs1 0.27 0.019 cytoplasmic lysine-tRNA ligase Krs1 O94313 arg4 0.26 0.033 arginine specific carbamoyl-phosphate synthase Arg4 O74413 SPCC1223.14 0.26 0.028...”
- Protein glutaminylation is a yeast-specific posttranslational modification of elongation factor 1A
Jank, The Journal of biological chemistry 2017 - “...(accession no. P02994), S. pombe (accession no. P0CT53), M. musculus (accession no. P10126), B. taurus (accession no. P68103), G. mellonella (accession...”
- Inorganic polyphosphate abets silencing of a sub-telomeric gene cluster in fission yeast
Sanchez, microPublication biology 2023 - “...SPAC13G7.02c ssa1 Hsp70 family heat shock protein -1.18 SPBC660.06 wwm2 WW domain containing protein -1.18 SPCC794.09c tef101 translation elongation factor EF-1 alpha -1.17 SPAC23H3.15c ddr48 DNA damage-responsive protein -1.17 SPCC794.01c gcd1 glucose dehydrogenase -1.13 SPBPB8B6.04c grt1 DNA-binding transcription factor -1.09 SPCC737.04 UPF0300 family protein 6 -1.08...”
- Abc3-mediated efflux of an endogenous digoxin-like steroidal glycoside by Magnaporthe oryzae is necessary for host invasion during blast disease
Patkar, PLoS pathogens 2012 - “...et al. [48] using an 80-bp flanking sequence homologies. Deletion of the Sp TEF2 ORF (SPCC794.09c) was performed in the S. pombe wild type MBY104. Stable transformants from minimal media (MM) minus uracil were tested and Sp TEF2 -deletion was confirmed by colony PCR. Plasmid pFGL547...”
- Cotranscriptional recruitment of the nuclear poly(A)-binding protein Pab2 to nascent transcripts and association with translating mRNPs
Lemieux, Nucleic acids research 2009 - “...Rpl3601 SPCC970.05 60S ribosomal subunit L36 Rpl3602 SPBC405.07 60S ribosomal subunit L36 Translation factors Ef1a-a SPCC794.09c Translation elongation factor Moe1 SPAC637.07 Translation initiation factor eIF3d Sup35 SPCC584.04 Translation release factor class II Tif11 SPBC25H2.07 Translation initiation factor eIF1A Pab2 is a shuttling protein that associates with...”
A5DPE3 Elongation factor 1-alpha from Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
28% identity, 66% coverage
B0XPK2 Elongation factor 1-alpha from Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
Q4WJD2 Elongation factor 1-alpha from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
AFUA_1G06390, Afu1g06390 translation elongation factor EF-1 alpha subunit, putative from Aspergillus fumigatus Af293
26% identity, 70% coverage
- The characterization of RNA-binding proteins and RNA metabolism-related proteins in fungal extracellular vesicles
Dallastella, Frontiers in cellular and infection microbiology 2023 - “...fungal EVs. Uniprot ID Similarity Species Uniprot ID Similarity Species Elongation factor 1-alpha Seryl-tRNA synthetase B0XPK2 * A. fumigatus B0Y360 68.14% A. fumigatus C4YDJ3 88.43% C. albicans Q9HGT6 57.79% C. albicans A0A095DDT6 85.19% C. deuterogattii A0A095DHL3 50.11% C. deuterogattii J9W2J0 84.78% C. neoformans J9VKD0 50.33% C....”
- The proteomic signature of Aspergillus fumigatus during early development
Cagas, Molecular & cellular proteomics : MCP 2011 - “...Q8NKF4 Q4X1G7 Molecular & Cellular Proteomics 10.11 Q4WWT1 Q4WJD2 Q4WJ30 Q4X1G9 Q4WWN1 Q4WP05 Q4WV26 Q4WI54 Q4WU42 Q4WX09 Q4X0G7 Q4X279 Q4WB08 Q4WCV0 Q4WXA2...”
- Pan-azole- and multi-fungicide-resistant Aspergillus fumigatus is widespread in the United States
Celia-Sanchez, Applied and environmental microbiology 2024 - “...AFUA_2g13860 ); ITS region (AFUA_4g02100); rpb2 ( AFUA_7g01920 ); sdh1 ( AFUA_3g07810 ); tef1 ( AFUA_1g06390 )] that were identified using a BLAST. Aspergillus fischeri orthologous and syntenic genes were used as an outgroup [ act1 ( NFIA_051290 ); efg1 ( NFIA_035240 ); gpdA ( NFIA_040150...”
- Disruption of the Aspergillus fumigatus RNA interference machinery alters the conidial transcriptome
Kelani, RNA (New York, N.Y.) 2023 - “...conidia were several histones (HhfA, Htb1), a Cu/Zn superoxide dismutase (SodC), and elongation factor 1- (AFUA_1G06390) ( Supplemental Data Set S4 ). At 48 h, we observed a high abundance of alcohol dehydrogenase (AFUA_7G01010), the same Cu/Zn superoxide dismutase (SodC) as in conidia, and several ubiquitin...”
- Prediction and validation of host-pathogen interactions by a versatile inference approach using Aspergillus fumigatus as a case study
Balkenhol, Computational and structural biotechnology journal 2022 - “...Further, it is shown in Fig. 3 that the translation elongation factor EF-1 alphasubunit, putative (AFUA_1G06390) might bind to ATPase, H + transporting, lysosomal V 1 subunit B2 (Atp6v1b2). The mitochondrial F1 ATPase subunit alpha (AFUA_8G05320) might bind to ATP synthase, H + transporting mitochondrial F1...”
- “...Ras family GTPase protein 11 CHEMBL3989665 Alafosfalin Antifungal AFUA_3G11260 Ubiquitin 12 CHEMBL293961 Benzimidazol derivate Fungicide AFUA_1G06390 Putative translation elongation factor EF-1 alpha subunit 13 CHEMBL2180480 4-[[5-bromo-4-[(Z)-(2,4-dioxo-3-phenacyl-1,3-thiazolidin-5-ylidene)methyl]-2-ethoxyphenoxy]methyl]benzoic acid [93] AFUA_6G12400 Putative 1,3-beta-glucan synthase catalytic subunit, major subunit of glucan synthase 14 CHEMBL281926 Bryostatins AFUA_5G11970 Protein kinase C,...”
- Modulation of Virulence-Associated Traits in Aspergillus fumigatus by BET Inhibitor JQ1
Orekhova, Microorganisms 2022 - “...1 Nucleotide sequence of A. fumigatus primers for RT-PCR. Gene Name Primer Nucleotide Sequence GenBank AFUA_1G06390 ( Elongation factor -1) EF1-F 5-AGGTCATCGTCCTCAACCAC-3 XM_745295.2 EF1-R 5-ACCGGACTTGATGAACTTGG-3 AFUA_2G17530 ( Conidial pigment biosynthesis oxidase ABR2 ) ABR-F 5-CAATCAAAGAGGCCAAGGAG-3 KAH1289617.1 ABR-R 5-TATGGCAGTGCAACAGGAAC-3 AFUA_1G11640 ( Superoxide dismutase putative ) SOD-F 5-TCTCCCACATAGACAGAACACG-3...”
- Biochemical Identification of a Nuclear Coactivator Protein Required for AtrR-Dependent Gene Regulation in Aspergillus fumigatus
Paul, mSphere 2022 - “...24 h at 37C under nonshaking conditions. The threshold cycle value of the tef1 ( Afu1g06390 ) transcript was used as a normalization control. Fluorescence microscopy. To visualize the localization of NcaA-GFP2-5 and AtrR-mNeonGreen, conidia were inoculated in 200L of minimal medium on coverslips and incubated...”
- Biotinylated Surfome Profiling Identifies Potential Biomarkers for Diagnosis and Therapy of Aspergillus fumigatus Infection
Jia, mSphere 2020 - “...M ; K130 D ; K134 D, S, G, M See Tables1 and 2 Tef1 Afu1g06390 Putative translation elongation factor EF-1 alpha subunit 494 K472 D, S, M ; K476 D, S, G ; K483 D, S, G, M ; K486 G See Tables1 and 2...”
- Functional Investigation of Iron-Responsive Microsomal Proteins, including MirC, in Aspergillus fumigatus
Mulvihill, Frontiers in microbiology 2017 - “...compared to iron-replete. Interestingly, 3 translation elongation factor proteins were uniquely detected in mirC EF-1 (AFUA_1G06390), EF-2 (AFUA_2G13530), and eEF-3 (AFUA_7G05660) compared with WT. Importantly several siderophore biosynthetic enzymes exhibited increased abundance in mirC compared with WT including SidA and SidI (Table 4 ). Together these...”
- The Aspergillus fumigatus sitA Phosphatase Homologue Is Important for Adhesion, Cell Wall Integrity, Biofilm Formation, and Virulence
Bom, Eukaryotic cell 2015 - “...in the sitA mutant strain Afu5g10490 Afu5g03540 Afu4g13750 Afu1g06390 Afu3g08290 Afu8g00710 Afu2g09030 Afu7g07010 Length (aaa) Ratio (sitA/WT)b 84 72 67 782 653...”
- More
CCM_00809 elongation factor 1-alpha from Cordyceps militaris CM01
28% identity, 66% coverage
MBR_08275 Elongation factor 1-alpha from Metarhizium brunneum
29% identity, 65% coverage
Q00251 Elongation factor 1-alpha from Aureobasidium pullulans
28% identity, 66% coverage
TGME49_094800, TGME49_294800 elongation factor 1-alpha (EF-1-ALPHA), putative from Toxoplasma gondii ME49
B6KN45 Elongation factor 1-alpha from Toxoplasma gondii
TGME49_086420 elongation factor 1-alpha (EF-1-ALPHA), putative from Toxoplasma gondii ME49
29% identity, 66% coverage
- Identification of new palmitoylated proteins in Toxoplasma gondii
Caballero, Biochimica et biophysica acta 2016 - “...data show that there are several nuclear proteins that are palmitoylated, including elongation factor 1-alpha (TGME49_294800), eukaryotic initiation factor-4A (TGME49_250770), 14-3-3 (TGME49_263090) ( Table S1 ) and the effect of this modification on them should be further studied. The finding of nuclear palmitoylated proteins is really...”
- Dual transcriptional profiling of mice and Toxoplasma gondii during acute and chronic infection
Pittman, BMC genomics 2014 - “...7 TGME49_285870 SAG-related sequence SRS20A (SRS20A) 7 TGME49_269950 hypothetical protein 7 TGME49_247280 hypothetical protein 7 TGME49_294800 elongation factor 1-alpha (EF-1-ALPHA) 7 TGME49_213050 hypothetical protein 6 TGME49_249180 bifunctional dihydrofolate reductase-thymidylate synthase 6 TGME49_226710 hypothetical protein 6 TGME49_237880 hypothetical protein 6 TGME49_250115 hypothetical protein 6 TGME49_254720 dense granule...”
- Extensive lysine acetylation occurs in evolutionarily conserved metabolic pathways and parasite-specific functions during Plasmodium falciparum intraerythrocytic development
Miao, Molecular microbiology 2013 - “...acyltransferase, putative TGME49_119920 dihydrolipoamide branched chain transacylase, E2 subunit, putative PF13_0305 elongation factor 1-alpha TGME49_086420; TGME49_094800 elongation factor 1-alpha, putative; elongation factor 1-alpha, putative PFI0645w elongation factor 1-beta (EF-1beta) TGME49_026410 elongation factor 1-beta, putative PF14_0486 elongation factor 2 TGME49_005470 elongation factor 2, putative PF10_0155 enolase (ENO)...”
- Analysis of the glycoproteome of Toxoplasma gondii using lectin affinity chromatography and tandem mass spectrometry
Luo, Microbes and infection 2011 - “...protein 12 48 62.4 ConA15 46.m01699 TGME49_036540 RRM domain-containing protein 21 377 65.7 ConA18 76.m00016 TGME49_094800 elongation factor 1-alpha, putative 23 304 49 ConA20 50.m05680 TGME49_050770 eukaryotic translation initiation factor 4A 20 48 46.6 ConA20 50.m00069 TGME49_049270 thioredoxin, putative 18 148 46.9 ConA22 42.m00047 TGME49_025800 ABC...”
- Study on Circulating Antigens in Serum of Mice With Experimental Acute Toxoplasmosis
Liu, Frontiers in microbiology 2020 - “...Putative myosin regulatory light chain 2 2 5.83% 23123.97/6.86 Herm-Gtz et al., 2002 Binding 10 B6KN45 Elongation factor 1-alpha 2 2 4.46% 49005.24/9.02 Wang et al., 2017 Binding 11 A0A086L4P6 Heat shock protein HSP70 2 2 4.35% 72291.98/5.07 Aosai et al., 2002 Response to stress 12...”
- Extracellular Toxoplasma gondii tachyzoites metabolize and incorporate unnatural sugars into cellular proteins
Nazarova, Microbes and infection 2016 - “...factor (AP2X-9) B9PZQ1 transcription factor 1 yes Calmodulin B9PZ33 Ca 2+ signaling 2 Elongation Factor-1 B6KN45 transcription 2 yes yes Elongation Factor-2 F0VEU2 transcription 2 yes Elongation factor Tu B6KC06 transcription 2 yes Nucleosome assembly protein B6KAS9 nucleosomes 1 Prohibitin B9PP22 transcription 2 yes Prohibitin B9PGD2...”
- Identification of differentially expressed proteins in sulfadiazine resistant and sensitive strains of Toxoplasma gondii using difference-gel electrophoresis (DIGE)
Doliwa, International journal for parasitology. Drugs and drug resistance 2013 - “...Translation 2533 TGME49 051810 Translation initiation factor eIF-5A, putative 17468/5.03 113 13 3 1.49 1043 TGME49_086420 Elongation factor 1 alpha, putative 49006/9.39 628 26 12 1.75 1354 TGME49_086420 Elongation factor 1 alpha, putative 49006/9.39 249 12 6 2.59 1069 TGME49_086420 Elongation factor 1 alpha, putative 49006/9.39...”
- “...3 1.63 1362 TGME49_086420 Elongation factor 1 alpha, putative 49006/9.39 67 7 3 2.29 1448 TGME49_086420 Elongation factor 1 alpha, putative 49006/9.39 311 13 3 1.47 1272 TGME49_086420 Elongation factor 1 alpha, putative 49006/9.39 107 10 5 1.98 1593 TGME49_086420 Elongation factor 1 alpha, putative 49006/9.39...”
- Extensive lysine acetylation occurs in evolutionarily conserved metabolic pathways and parasite-specific functions during Plasmodium falciparum intraerythrocytic development
Miao, Molecular microbiology 2013 - “...dihydrolipoamide acyltransferase, putative TGME49_119920 dihydrolipoamide branched chain transacylase, E2 subunit, putative PF13_0305 elongation factor 1-alpha TGME49_086420; TGME49_094800 elongation factor 1-alpha, putative; elongation factor 1-alpha, putative PFI0645w elongation factor 1-beta (EF-1beta) TGME49_026410 elongation factor 1-beta, putative PF14_0486 elongation factor 2 TGME49_005470 elongation factor 2, putative PF10_0155 enolase...”
- Lysine acetylation is widespread on proteins of diverse function and localization in the protozoan parasite Toxoplasma gondii
Jeffers, Eukaryotic cell 2012 - “...translation elongation factor 1 alpha 1 (EF1-; TGME49_086420, TGME49_ Eukaryotic Cell Downloaded from http://ec.asm.org/ on February 18, 2017 by University of...”
- Parasites, proteomes and systems: has Descartes' clock run out of time?
Wastling, Parasitology 2012 - “...displayed on ToxoDB. A screenshot illustrating protein expression data for gene a Toxoplasma gondii gene TGME49_086420 viewed on an individual gene record page. Colour coded peptides are mapped to the gene sequence according to the various experiments and laboratories that identified them. Fig. 4 Workflows for...”
- The Hsp90 co-chaperone p23 of Toxoplasma gondii: Identification, functional analysis and dynamic interactome determination
Echeverria, Molecular and biochemical parasitology 2010 - “...aldolase Tz,Bz TGME49_036040 46.m00002 6/9 yes Translation machinery/ Protein metabolism 8 Elongation factor 1alpha Tz,Bz TGME49_086420 76.m00016 14/14 9 Elongation factor 2 Tz,Bz TGME49_005470 20.m03912 5/4 yes 10 Asparaginyl-tRNA synthase Bz TGME49_070510 59.m03518 2 yes 11 Tryptophanyl tRNA Synthase Bz TGME49_088360 80.m00063 4 12 nascent polypeptide-associated...”
C4QZB0 Elongation factor 1-alpha from Komagataella phaffii (strain GS115 / ATCC 20864)
F2QQG8 Elongation factor 1-alpha from Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1)
PAS_FragB_0052 Translational elongation factor EF-1 alpha from Komagataella phaffii GS115
28% identity, 65% coverage
- Lipidome and proteome of lipid droplets from the methylotrophic yeast Pichia pastoris.
Ivashov, Biochimica et biophysica acta 2013 - “...biosynthetic process C4R2N5 ATP synthase subunit beta Atp2p (87%) M ATP synthesis coupled proton transport C4QZB0 Elongation factor 1-alpha Tef1p (89%) R/C Translational elongation, tRNA export from nucleus C4R4Y8 ATP synthase subunit alpha Atp1p (88%) M ATP synthesis coupled proton transport C4QXD6 Fatty acid transporter and...”
- The secretome of Pichia pastoris in fed-batch cultivations is largely independent of the carbon source but changes quantitatively over cultivation time
Burgard, Microbial biotechnology 2020 - “...1 1 1 1 1 1 Glyceraldehyde3phosphate dehydrogenase 35.6/6.2 N pero: 16, cyto: 8 Tef2 F2QQG8 1 1 1 1 Translational elongation factor EF1 alpha 5.1/9.1 N cyto: 26.5, cyto_nucl: 14 Tos1 core F2QQJ 1 1 1 1 1 1 1 1 Covalentlybound cell wall protein...”
- CRISPR-Cas9-mediated genomic multiloci integration in Pichia pastoris
Liu, Microbial cell factories 2019 - “...associated with DNA recombination. The gRNA targets were selected within 100-bp upstream of TEF1 - (PAS_FragB_0052), FLD1 (PAS_chr3_1028), AOX1 (PAS_chr4_0821), and GAP (PAS_chr2-1_0437) promoter, and downstream of AOX1 terminator by navigating the 5-NGG-3 protospacer adjacent motif (PAM) sequence. Potential gRNA binding sequences were assessed with CHOPCHOP,...”
P40911 Elongation factor 1-alpha from Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432)
28% identity, 66% coverage
HCAG_08798 translation elongation factor 1-alpha from Histoplasma mississippiense (nom. inval.)
A6RGN1 Elongation factor 1-alpha from Ajellomyces capsulatus (strain NAm1 / WU24)
28% identity, 66% coverage
NP_001138630 HBS1-like protein isoform 2 from Homo sapiens
29% identity, 64% coverage
- Induction of fetal hemoglobin: Lentiviral shRNA knockdown of HBS1L in β0-thalassemia/HbE erythroid cells.
Chumchuen, PloS one 2023 - GeneRIF: Induction of fetal hemoglobin: Lentiviral shRNA knockdown of HBS1L in beta0-thalassemia/HbE erythroid cells.
- Mitochondrial genome copy number measured by DNA sequencing in human blood is strongly associated with metabolic traits via cell-type composition differences.
Ganel, Human genomics 2021 - GeneRIF: Mitochondrial genome copy number measured by DNA sequencing in human blood is strongly associated with metabolic traits via cell-type composition differences.
- Functional polymorphisms of BCL11A and HBS1L-MYB genes affect both fetal hemoglobin level and clinical outcomes in a cohort of children with sickle cell anemia.
Sales, Annals of hematology 2020 (PubMed)- GeneRIF: Patients carrying Fetal Hemoglobin-boosting alleles of BCL11A and HMIP-2 ( (HBS1L-MYB) were associated with milder clinical phenotypes. Higher HbF concentration may underlie this effect.
- Histamine releasing factor and elongation factor 1 alpha secreted via malaria parasites extracellular vesicles promote immune evasion by inhibiting specific T cell responses.
Demarta-Gatsi, Cellular microbiology 2019 (PubMed)- GeneRIF: Histamine releasing factor and elongation factor 1 alpha secreted via malaria parasites extracellular vesicles promote immune evasion by inhibiting specific T cell responses.
- Protective BCL11A and HBS1L-MYB polymorphisms in a cohort of 102 Congolese patients suffering from sickle cell anemia.
Mikobi, Journal of clinical laboratory analysis 2018 - GeneRIF: Studied association of BCL11A single nucleotide polymorphisms(snps) and HBS1L-MYB Intergenic snps with Hereditary Persistence of Fetal Hemoglobin (HPFH) in a cohort of sickle cell patients.
- A short splicing isoform of HBS1L links the cytoplasmic exosome and SKI complexes in humans.
Kalisiak, Nucleic acids research 2017 - GeneRIF: Identification of HBS1LV3, a short splicing isoform of HBS1L, as a linker between the human cytoplasmic exosome and the SKI complex.
- 2SNP heritability and effects of genetic variants for neutrophil-to-lymphocyte and platelet-to-lymphocyte ratio.
Lin, Journal of human genetics 2017 - GeneRIF: genome-wide association analyses identified a new genome-wide significant locus on the HBS1L-MYB intergenic region for platelet-to-lymphocyte ratio
- Chemical footprinting reveals conformational changes of 18S and 28S rRNAs at different steps of translation termination on the human ribosome.
Bulygin, RNA (New York, N.Y.) 2016 - GeneRIF: eRF3 neither interacts with the rRNA ribosephosphate backbone nor dissociates from the complex after GTP hydrolysis at translation termination.
- More
Q04634 Elongation factor 1-alpha from Tetrahymena pyriformis
32% identity, 48% coverage
- The Influence of Symbiosis on the Proteome of the Exaiptasia Endosymbiont Breviolum minutum.
Mashini, Microorganisms 2023 - “...in hospite A0A1Q9F6G5 Nitrilase Unique, in hospite Q59Q30 Glycerophosphoinositol permease 1 (GIT1) Unique, in hospite Q04634 Elongation factor 1-alpha (eEF1) Unique, in hospite Q06135 1,3-beta-glucanosyltransferase (GAS2) 3.44 B0Y8K2 1,4-beta-D-glucan cellobiohydrolase B (CBHB) 1.78 A0A1Q9CUD0 Putative glucose-6-phosphate 1-epimerase 1.76 Q9SAU2 Ribulose-5-phosphate-3-epimerase (R5P3E) 1.16 B4R9R7 Guanosine monophosphate synthetase...”
TTHERM_00655820 translation elongation factor EF-1alpha from Tetrahymena thermophila SB210
32% identity, 48% coverage
HBS1L_HUMAN / Q9Y450 HBS1-like protein; ERFS; EC 3.6.5.- from Homo sapiens (Human) (see 8 papers)
NP_006611 HBS1-like protein isoform 1 from Homo sapiens
29% identity, 60% coverage
- function: GTPase component of the Pelota-HBS1L complex, a complex that recognizes stalled ribosomes and triggers the No-Go Decay (NGD) pathway (PubMed:21448132, PubMed:23667253, PubMed:27863242). The Pelota-HBS1L complex recognizes ribosomes stalled at the 3' end of an mRNA and engages stalled ribosomes by destabilizing mRNA in the mRNA channel (PubMed:27863242). Following mRNA extraction from stalled ribosomes by the SKI complex, the Pelota-HBS1L complex promotes recruitment of ABCE1, which drives the disassembly of stalled ribosomes, followed by degradation of damaged mRNAs as part of the NGD pathway (PubMed:21448132, PubMed:32006463).
catalytic activity: GTP + H2O = GDP + phosphate + H(+) (RHEA:19669)
subunit: Component of the Pelota-HBS1L complex, also named Dom34-Hbs1 complex, composed of PELO and HBS1L (PubMed:27863242). Interacts with the SKI complex (PubMed:23667253, PubMed:28204585).
subunit: [Isoform 2]: Associates with SKI complex; the interaction with SKIC2 is direct (PubMed:28204585). Associates with the exosome complex; the interaction with EXOSC3 is direct (PubMed:28204585). - Structural basis of mRNA decay by the human exosome-ribosome supercomplex.
Kögel, Nature 2024 - “...previous study 17 . The complete open reading frame of SKI7 (HBS1L isoform 3, UniProt: Q9Y450 ; also described as SKI7 FL here) was commercially synthesized (Eurofins Genomics) and cloned with N-terminal 6His-TRX-3C and C-terminal GSG-eGFP-TwinStrep tags under an IPTG-inducible promotor for expression in Escherichia coli...”
- The mitotic surveillance pathway requires PLK1-dependent 53BP1 displacement from kinetochores
Burigotto, 2023 - The human SKI complex regulates channeling of ribosome-bound RNA to the exosome via an intrinsic gatekeeping mechanism.
Kögel, Molecular cell 2022 - “...pH7.5, 100mM NaCl, 2mM Dithiothreitol (DTT). The complete open reading frame of the HBS1L3 (UniProt: Q9Y450 ) was commercially synthesized (Eurofins Genomics) and cloned with N-terminal 6xHis-thioredoxin and C-terminal eGFP-TwinStrep tags under a IPTG-inducible promotor for expression in E.coli . Transformed E.coli BL21 STAR pRARE cells...”
- Comprehensive comparison between azacytidine and decitabine treatment in an acute myeloid leukemia cell line.
Aumer, Clinical epigenetics 2022 - “...mitochondrial) Q9BYD1 1.53 1.24 1.37 PTER (Phosphotriesterase-related protein) Q96BW5 1.40 2.00 2.35 HBS1L (HBS1-like protein) Q9Y450 1.27 1.51 1.14 PRRC2C (Protein PRRC2C) Q9Y520 1.22 0.75 1.22 GPT2 (Alanine aminotransferase 2) Q8TD30 1.12 0.99 1.09 TNKS1BP1 (182kDa tankyrase-1-binding protein) Q9C0C2 0.98 1.54 1.59 SATB1 (DNA-binding protein SATB1)...”
- Proteomics-based screening of the endothelial heparan sulfate interactome reveals that C-type lectin 14a (CLEC14A) is a heparin-binding protein.
Sandoval, The Journal of biological chemistry 2020 - Nonsense-Mediated mRNA Decay Begins Where Translation Ends
Karousis, Cold Spring Harbor perspectives in biology 2019 (secret) - Dynamics of genomic innovation in the unicellular ancestry of animals
Grau-Bové, eLife 2017 - “...the nearest outgroup gene families: EF1-alpha and HBS1L genes for eRF3 (human accessions: Q05639/P68104 and Q9Y450); and eIF4A1/2 for eIF4A3e (human accessions: P60842/Q14240). Protein alignments and phylogenetic analyses (LIM homeobox, type IV collagen and CBP/p300, Smg5/6/7, eIF4A3, eRF3, SRSF1-9/TRA2 splicing factors) Protein alignments were built with...”
- Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
Shao, Cell 2016 - “...and decoding center. Rescue complex Models for human Pelota (UniProt: Q9BRX2 ) and Hbs1l (UniProt: Q9Y450 ) were built using the deposited models for the moderate-resolution reconstruction of Dom34Hbs1 (the yeast homologs of PelotaHbs1l) bound to a ribosome stalled by a synthetic stem loop (PDB accession...”
- Two classes of EF1-family translational GTPases encoded by giant viruses
Zinoviev, Nucleic acids research 2019 - “...for H. sapiens proteins: eEF1A1 (NP_001393), eEF1A2 (NP_001949), GTPBP1 (NP_004277), eRF3A (NP_002085), eRF3B (NP_060564), HBS1 (NP_006611). NCBI accession numbers for Acanthamoeba castellanii proteins: eEF1A1 (XP_004339060), eEF1A2 (XP_004334950), eRF3 (XP_004351562) and HBS1 (XP_004339935). NCBI accession numbers for viral GTPases: A. castellanii mamavirus (ACMaV) (AEQ60824), Hirudo virus strain...”
P19039 Elongation factor 1-alpha from Apis mellifera
29% identity, 65% coverage
- Comprehensive EST analysis of the symbiotic sea anemone, Anemonia viridis
Sabourault, BMC genomics 2009 - “...protein beta A7S4U3_NEMVE O02755 CEBPB_BOVIN Bos taurus 5E-17 CL1Contig8 482 1892 Elongation factor 1-alpha A7SSW8_NEMVE P19039 EF1A_APIME Apis mellifera 0 CL2Contig7 340 1411 Actin, cytoplasmic A7SCN8_NEMVE Q964E3 ACTC_BIOAL Biomphalaria alexandrina 0 CL3Contig4 334 764 Soma ferritin A7S8I6_NEMVE P42577 FRIS_LYMST Lymnaea stagnalis 4E-68 CL1Contig4 322 968 lipoprotein...”
J9W2J0 Elongation factor 1-alpha from Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
CNAG_06125 elongation factor 1-alpha from Cryptococcus neoformans var. grubii H99
28% identity, 65% coverage
- The characterization of RNA-binding proteins and RNA metabolism-related proteins in fungal extracellular vesicles
Dallastella, Frontiers in cellular and infection microbiology 2023 - “...88.43% C. albicans Q9HGT6 57.79% C. albicans A0A095DDT6 85.19% C. deuterogattii A0A095DHL3 50.11% C. deuterogattii J9W2J0 84.78% C. neoformans J9VKD0 50.33% C. neoformans A6RGN1 89.57% H. capsulatum C0NE91 * H. capsulatum C1G1F2 89.13% P. brasiliensis ATP-dependent RNA helicase eIF4A/Helicase FAL1 Isoleucyl-tRNA synthetase B0XYH6 * A. fumigatus...”
- Simplified All-In-One CRISPR-Cas9 Construction for Efficient Genome Editing in Cryptococcus Species
Zhang, Journal of fungi (Basel, Switzerland) 2021 - “...the pRH003 plasmid was digested with XbaI/NcoI to remove the JEC21 ATC1 promoter. The TEF1 (CNAG_06125) promoter amplified with the primer pair pTEF1-F/pTEF1-R was utilized to replace the JEC21 ACT1 promoter on pRH003 and start the expression of the Cas9 cassette in the H99 strain. The...”
- Gene Expression of Diverse Cryptococcus Isolates during Infection of the Human Central Nervous System
Yu, mBio 2021 - “...factor pacC/RIM101 2,300 N Y Translational cofactor CNAG_01117 EF3 Elongation factor 3 7,236 N Y CNAG_06125 TEF1 Elongation factor 1-alpha 6,743 Y Y CNAG_06840 Elongation factor 2 3,260 Y Y Other functions CNAG_06101 ADP, ATP carrier protein 5,543 Y Y CNAG_00456 a ISP6 Identified spore protein...”
- A fluorogenic C. neoformans reporter strain with a robust expression of m-cherry expressed from a safe haven site in the genome
Upadhya, Fungal genetics and biology : FG & B 2017 - “...) and a 410 bp of genomic DNA downstream of the predicted stop codon of CNAG_06125 (EF1-term; translation elongation factor-1 alpha) amplified from KN99 genomic DNA using the primer pair CnEF1TermF and CnEF1TermR ( Table S1 ). The resulting DNA segment (H3mCH) was cloned into pGEM-Easy...”
- Targeted Genome Editing via CRISPR in the Pathogen Cryptococcus neoformans
Arras, PloS one 2016 - “...expression cassette The C . neoformans CAS9 expression construct was created by combining the TEF1 (CNAG_06125) C . neoformans promoter (primers UQ3590 and UQ3591), a human codon optimized, SV40 NLS-containing version of the S . pyogenes CAS9 gene [ 37 ] (UQ3592 and UQ3593), and TEF1...”
- Secretome profiling of Cryptococcus neoformans reveals regulation of a subset of virulence-associated proteins and potential biomarkers by protein kinase A
Geddes, BMC microbiology 2015 - “...Pka1-induction Carbohydrate catabolic process CNAG_02189 -Amylase 16 hpi 0.298 1.096 0.314 1.270 GTP catabolic process CNAG_06125 Translation elongation factor 1 16 hpi 0.135 0.379 0.145 0.517 Carbohydrate metabolic process CNAG_01239 Chitin deacetylase 16 hpi 0.906 1.350 0.310 0.515 CNAG_04245 Chitinase 16 hpi 0.448 0.286 0.007 0.296...”
- “...Fold change b Std. Dev. Carbohydrate catabolic process CNAG_02189 -Amylase 0.777 0.019 GTP catabolic process CNAG_06125 Translation elongation factor 1 2.062 2.181 Carbohydrate metabolic process CNAG_02860 Endo-1,3(4)--glucanase 0.947 0.583 CNAG_06501 1,3--glucanosyltransferase 0.968 0.100 CNAG_05799 Chitin deacetylase 1.439 0.775 CNAG_06291 Deacetylase 1.464 0.778 CNAG_01239 Chitin deacetylase 2.014...”
- Vesicle and vesicle-free extracellular proteome of Paracoccidioides brasiliensis: comparative analysis with other pathogenic fungi
Vallejo, Journal of proteome research 2012 - “...Yes Yes HCAG_05988 YOR133W 35 - PADG_00692 elongation factor 1-alpha (461 aa) Yes Yes HCAG_08798 CNAG_06125 YPR080W 36 NS PADG_02142 ribosomal protein L5 (300 aa) Yes Yes HCAG_08444 YPL131W 37 SP PADG_02446 hypothetical protein (114 aa) Yes Yes CNAG_05762 YDR382W 38 - PADG_01407 40S ribosomal protein...”
XP_001551786 Bcef1a from Botrytis cinerea B05.10
27% identity, 66% coverage
- Unraveling the Function of the Response Regulator BcSkn7 in the Stress Signaling Network of Botrytis cinerea
Viefhues, Eukaryotic cell 2015 - “...the elongation factor 1-alpha (ef1; GenBank accession number XP_001551786; primers 66 and 67) according to the 2CT (where CT is threshold cycle) method. Means...”
- The high-affinity phosphodiesterase BcPde2 has impact on growth, differentiation and virulence of the phytopathogenic ascomycete Botrytis cinerea
Harren, PloS one 2013 - “...supermix (Bio-Rad, Hercules, CA, U.S.A). Genes encoding actin A (XP_001553368, primers 30&31), elongation factor 1-alpha (XP_001551786, primers 32&33) and tubulin (AAB60307, primers 34&35) showed the same expression pattern in wild-type and mutant strains used in this work and were therefore used to normalize the cDNA amounts...”
- “...As reference genes, the genes encoding actin (XP_001553368), beta tubulin (AAB60307) and elongation factor 1-alpha (XP_001551786) were used. The indicated values are means of three biological replicates, and were normalized to the expression in the wild type on CM. Standard deviations are indicated by error bars....”
- The role of mitogen-activated protein (MAP) kinase signalling components and the Ste12 transcription factor in germination and pathogenicity of Botrytis cinerea
Schamber, Molecular plant pathology 2010 (secret)
NP_001331941 Translation elongation factor EF1A/initiation factor IF2gamma family protein from Arabidopsis thaliana
30% identity, 55% coverage
AT5G10630 elongation factor 1-alpha, putative / EF-1-alpha, putative from Arabidopsis thaliana
30% identity, 61% coverage
- Viral RNA polymerase as a SUMOylation decoy inhibits RNA quality control to promote potyvirus infection
Ge, Nature communications 2025 - “...Gene ID and viral sequences used in this study are as follows: Pelota (AT4G27650), Hbs1 (AT5G10630), SUMO1 (AT4G26840), SCE1 (AT3G57870), AtActinII (AT3G18780), NbActin (AY179605), TuMV (NC002509), PVMV (MN082715), and ANRSV (MZ209276). Unless otherwise noted, all plasmids used in this study were constructed using Gateway technology (Invitrogen)...”
- Catalytic activities, molecular connections, and biological functions of plant RNA exosome complexes
Lange, The Plant cell 2022 - “...SKI complex, has a second function as a subunit of the nuclear PAF complex SKI7 At5g10630 HBS1LV3 Ski7 Binds to Exo9 and the SKI complex, has a GTPase domain of unknown function RST1 At3g27670 FOCAD No homolog ARM repeats, associated with EXO9 and RIPR RIPR At5g44150...”
- mRNA surveillance complex PELOTA-HBS1 regulates phosphoinositide-dependent protein kinase1 and plant growth
Kong, Plant physiology 2021 - “...analysis in Arabidopsis genome by using yeast and human HBS1 identified two candidate HBS1 homologs, AT5G10630 and AT1G18070. Sequence alignment analysis showed that only AT5G10630 had the conserved HBS1_C domain, indicating that AT5G10630 (designated as AtHBS1, HBS1) is the HBS1 homolog in Arabidopsis ( Supplemental Figure...”
- “...under the following accession numbers: PDK1.1 (AT5G04510) , PDK1.2 (AT3G10540) , PEL1 (AT4G27650) , HBS1 (AT5G10630) , D6PK (AT5G55910) , D6PKL1 (AT4G26610) , D6PKL2 (AT5G47750) , D6PKL3 (AT3G27580) , PID (AT2G34650) , OXI1/AGC2-1 (AT3G25250) , GAT 1_2.1 (AT1G15040) , SRPP (AT4G02270) , PRPL1 (AT5G05500) , DGR1...”
- Arabidopsis RanBP2-Type Zinc Finger Proteins Related to Chloroplast RNA Editing Factor OZ1
Gipson, Plants (Basel, Switzerland) 2020 - “...the other. 4.5. Hsp70 Subfamily B Suppressor (HBS1)/Superkiller Protein 7 (SKI7) The gene products of At5g10630 have splice isoforms predicted to have drastically different functions. The shorter splice form, named HBS1, may recognize and release stalled ribosomes, while the longer splice form, SKI7, likely incorporates into...”
- “...At3g17611 1 Protein interaction Plasma membrane (1) Mitochondria (0.9658) Non-Organellar (0.72) Serine protease SKI7 F4KI84 At5g10630 1 Protein interaction Cytosol (0.998) Non-Organellar (0.9999) Non-Organellar (0.99) RNA degradation SKI7-variant Q9LXB6 At5g10630 1 Protein interaction Cytosol (1) Non-Organellar (0.9913) Non-Organellar (0.97) RNA degradation HBS1 A0A1P8BFF4 At5g10630 1 Protein...”
- RST1 and RIPR connect the cytosolic RNA exosome to the Ski complex in Arabidopsis
Lange, Nature communications 2019 - “...of nucleoplasmic or nucleolar exosomes, respectively. Noteworthy, RST1 co-purified with the cytoplasmic protein encoded by AT5G10630 , the mRNA of which is alternatively spliced to produce either HBS1 or SKI7 proteins. As compared with the HBS1 mRNA, the SKI7 mRNA contains an additional exon encoding the...”
- “...fact that SKI7 proteins are bound to yeast and human exosome complexes indicate that the AT5G10630 gene product which co-purified with RST1 is indeed SKI7 rather than HBS1. The three core proteins of the cytoplasmic Ski complex SKI2, SKI3 and SKI8 were not significantly enriched (Fig....”
- A Two-Headed Monster to Avert Disaster: HBS1/SKI7 Is Alternatively Spliced to Build Eukaryotic RNA Surveillance Complexes
Brunkard, Frontiers in plant science 2018 - “...exosome (yellow and red; see Figure 4A ). (B) RNA-Seq of light-grown seedlings shows that At5g10630 is alternatively spliced into three major splice forms ( Cheng et al., 2017 ). Cumulative RNA-Seq reads are shown in black (top panel), and select individual aligned reads are shown...”
- “...exon are 20% of the level of reads for the other coding sequence exons. (C) At5g10630 forms three major splice forms. A short splice form (top) skips exon 4 (yellow), yielding a transcript that encodes HBS1 (A) . A long splice form (middle) includes exon 4...”
- The nonstop decay and the RNA silencing systems operate cooperatively in plants
Szádeczky-Kardoss, Nucleic acids research 2018 - “...light/dark condition. Columbia wild type and pelota1 and hbs1 T-DNA mutants (Pelota1:At4G27650, SAIL_881_B10 and Hbs1: At5G10630, WiscDsLox477-480D24) Arabidopsis plants were grown in a light room, at 16 h/8 h. light/dark condition, at 23C day and 18C night temperature. Agroinfiltration assay Agroinfiltration is the most efficient transient...”
- “...). Although it was proposed that in Arabidopsis , the putative Pelota and Hbs1 (At4G27650, At5G10630, respectively) homologs are single copy genes ( 60 ), our bioinformatical analysis suggests that at least two putative Pelota copies (At4G27650, At3G58390) are present in the genome ( Supplementary Data...”
F4KI84 Translation elongation factor EF1A/initiation factor IF2gamma family protein from Arabidopsis thaliana
30% identity, 61% coverage
- Arabidopsis RanBP2-Type Zinc Finger Proteins Related to Chloroplast RNA Editing Factor OZ1
Gipson, Plants (Basel, Switzerland) 2020 - “...Q8RXW0 At3g17611 1 Protein interaction Plasma membrane (1) Mitochondria (0.9658) Non-Organellar (0.72) Serine protease SKI7 F4KI84 At5g10630 1 Protein interaction Cytosol (0.998) Non-Organellar (0.9999) Non-Organellar (0.99) RNA degradation SKI7-variant Q9LXB6 At5g10630 1 Protein interaction Cytosol (1) Non-Organellar (0.9913) Non-Organellar (0.97) RNA degradation HBS1 A0A1P8BFF4 At5g10630 1...”
P28295 Elongation factor 1-alpha from Absidia glauca
28% identity, 65% coverage
- RNA-Sequencing of Heterorhabditis nematodes to identify factors involved in symbiosis with Photorhabdus bacteria.
Bhat, BMC genomics 2022 - “...2 2. TRINITY_DN3587_c0_g1_i1--LEN=1046 -10.55 RPLP0 Q95140 60S acidic ribosomal protein P0 3. TRINITY_DN7104_c0_g6_i1--LEN=722 -10.51 TEF-1 P28295 Elongation factor 1-alpha 4. TRINITY_DN7997_c0_g4_i3--LEN=1041 -10.47 RpL8 P41569 60S ribosomal protein L8 5. TRINITY_DN6295_c0_g4_i1--LEN=1062 -10.41 MT-CYB Q9XNX3 Cytochrome b 6. TRINITY_DN6392_c1_g2_i4--LEN=1245 -10.31 RPL11B P42794 60S ribosomal protein L11-2 7. TRINITY_DN5202_c0_g4_i1--LEN=677...”
ATEG_03010 translation elongation factor EF-1 alpha from Aspergillus terreus NIH2624
27% identity, 68% coverage
NFIA_018320 translation elongation factor EF-1 alpha subunit, putative from Aspergillus fischeri NRRL 181
27% identity, 67% coverage
Q9LXB6 Uncharacterized protein F12B17_10 from Arabidopsis thaliana
30% identity, 51% coverage
- Arabidopsis RanBP2-Type Zinc Finger Proteins Related to Chloroplast RNA Editing Factor OZ1
Gipson, Plants (Basel, Switzerland) 2020 - “...based on their similarity to human and yeast homologs. The third predicted protein (UniProt ID: Q9LXB6; Table 1 ) is likely the product of SKI7 regulation via alternative splicing, producing an RNA targeted for nonsense-mediated decay. The Znf domain is present in all isoforms, as are...”
- “...SKI7 F4KI84 At5g10630 1 Protein interaction Cytosol (0.998) Non-Organellar (0.9999) Non-Organellar (0.99) RNA degradation SKI7-variant Q9LXB6 At5g10630 1 Protein interaction Cytosol (1) Non-Organellar (0.9913) Non-Organellar (0.97) RNA degradation HBS1 A0A1P8BFF4 At5g10630 1 Protein interaction Cytosol (0.998) Non-Organellar (0.9984) Non-Organellar (0.99) Stalled ribosome rescue TBP-associated factor 15...”
SS1G_05520, XP_001594091 elongation factor 1-alpha from Sclerotinia sclerotiorum 1980 UF-70
27% identity, 66% coverage
- Fusiform nanoparticle boosts efficient genetic transformation in Sclerotinia sclerotiorum
Ding, Journal of nanobiotechnology 2024 - “...cloning vector [ 36 ], driven by the promoter of elongation factor 1 alpha (EF1, SS1G_05520). The fragment of S. sclerotiorum Ss-oah1 was amplified using the primer pair Sioah-F and Sioah-R (Supplementary Table S1 ). The amplicons were then inserted into the corresponding multiple cloning sites...”
- Comparative Transcriptome Analysis between the Fungal Plant Pathogens Sclerotinia sclerotiorum and S. trifoliorum Using RNA Sequencing
Qiu, The Journal of heredity 2016 - “...were chosen for comparison. Surprisingly only 2 genes (SS1G_05520, elongation factor 1-alpha and SS1G_3527, a hypothetical protein) were in common between the 2...”
- “...protein SS1G_10716, hypothetical protein SS1G_05520, elongation factor 1-alpha SS1G_03611, predicted protein SS1G_07798,glyceraldehyde-3-phosphate dehydrogenase...”
- Ss-Sl2, a novel cell wall protein with PAN modules, is essential for sclerotial development and cellular integrity of Sclerotinia sclerotiorum
Yu, PloS one 2012 - “...27.7% 21738 XP_001589969 Actin (6) 24.5% 41841 XP_001597891 Heat shock protein 60 (9) 23.1% 60934 XP_001594091 Elongation factor 1-alpha (8) 20.9% 50304 XP_001598862 40S ribosomal protein S24 (2) 20% 15458 XP_001596961 60S ribosomal protein L6 (3) 19.5% 22125 XP_001591168 ATP synthase beta chain (5) 17.4% 55642...”
An18g04840 uncharacterized protein from Aspergillus niger
28% identity, 67% coverage
- A novel fungal gene regulation system based on inducible VPR-dCas9 and nucleosome map-guided sgRNA positioning
Schüller, Applied microbiology and biotechnology 2020 - “...(in-house strain collection AIT-#931)) and the terminator region of the tef1 orthologue of A. niger (An18g04840) which was amplified by primer pair T. tef1 -1-F/R (template source: genomic DNA from A. niger wild-type isolate (in-house strain collection AIT-#931)). The VPR-dCas9 fusion was amplified from two different...”
- The amyR-deletion strain of Aspergillus niger CICC2462 is a suitable host strain to express secreted protein with a low background
Zhang, Microbial cell factories 2016 - “...Table8 Transcriptional levels of some genes in the amyR strain Gene ID FPKM FDR Description An18g04840 6672.67 0 Elongation factor 1-alpha An14g07060 6607.56 2.19E07 Nitroreductase family protein An03g06410 6318.12 0 C-4 methylsterol oxidase An04g06510 5952.65 5.22E121 Polyubiquitin An08g04880 5706.63 0 Hypoxia induced family protein An18g04220 5123.75...”
- Cytosolic streaming in vegetative mycelium and aerial structures of Aspergillus niger
Bleichrodt, Studies in mycology 2013 - “...3104 Weak similarity to Ca-dependent protein kinase CDPK1 - Marchantia polymorpha An16g06520 3009 Hypothetical protein An18g04840 2910 Strong similarity to translation elongation factor 1 alpha - Podospora anserina [putative sequencing error] An07g00070 2887 Strong similarity to hypothetical protein encoded by An07g00010 - Aspergillus niger An11g11300 2806...”
- “...ID AU Annotation An14g02140 2976 Weak similarity to Ca-dependent protein kinase CDPK1 - Marchantia polymorpha An18g04840 2752 Strong similarity to translation elongation factor 1 alpha - Podospora anserina [putative sequencing error] An16g01830 2616 Glyceraldehyde-3-phosphate dehydrogenase gpdA - Aspergillus niger An03g04530 2526 Similarity to beta-phosphoglucomutase beta-PGM -...”
- Genomic analysis of the secretion stress response in the enzyme-producing cell factory Aspergillus niger
Guillemette, BMC genomics 2007 - “...IA subunit CLP1 0.71 1.56 2.20 An02g09260 similar to nucleolar protein NOP5 2.12 9.22 4.34 An18g04840 similar to elongation factor 1 alpha ( Podospora anserina ) 1.88 6.02 3.21 An15g00750 Similar to elongation factor 1-gamma 1 TEF3 2.16 5.35 2.47 An07g02650 similar to translation elongation factor...”
TOT_010000685 elongation factor 1-alpha from Theileria orientalis strain Shintoku
28% identity, 67% coverage
Q2HJN8 Elongation factor 1-alpha 2 from Oscheius tipulae
29% identity, 69% coverage
CNM01300 translation elongation factor EF1-alpha from Cryptococcus neoformans var. neoformans JEC21
28% identity, 65% coverage
LOC9640201 HBS1-like protein from Selaginella moellendorffii
30% identity, 62% coverage
Q2KHZ2 HBS1-like protein from Bos taurus
29% identity, 60% coverage
- Comparison of nanotube-protein corona composition in cell culture media
Shannahan, Small (Weinheim an der Bergstrasse, Germany) 2013 - “...1,012,523 F1MW73 MGC148692 KIAA1211 protein 1,568,099 F1MSG6 RAPGEF2 Rap guanine nucleotide exchange factor 2 1,952,045 Q2KHZ2 HBS1L HBS1-like protein 4,041,483 F1MAX6 KATNAL1 Katanin p60 ATPase-containing subunit A-like 1 4,289,983 F1N300 Bt.76801 Condensin complex subunit 1 4,804,233 F1MYB0 STOX2 Storkhead-box protein 2 7,332,400 SWCNT-Raw F1MER7 HSPG2 Basement...”
5lzwjj / Q9Y450 of the mammalian rescue complex with Pelota and Hbs1l assembled on a truncated mRNA. (see paper)
29% identity, 65% coverage
- Ligand: magnesium ion (5lzwjj)
MYCTH_2298136 uncharacterized protein from Thermothelomyces thermophilus ATCC 42464
28% identity, 65% coverage
- Upgrading of efficient and scalable CRISPR-Cas-mediated technology for genetic engineering in thermophilic fungus Myceliophthora thermophila
Liu, Biotechnology for biofuels 2019 - “...Science Research Services Company (Genewiz, Suzhou, China). The strong constitutive tef1 (translation elongation factor EF-1, MYCTH_2298136) promoter P tef1 of M. thermophila was used to express Cas12a . The T trpC terminator was cloned from the vector pNA52-1N (GenBank number: Z32697). The synthetic NLS- Cas12a -NLS,...”
- “...sequence of the Cas12a expression cassette. Purple letters indicate the tef1 (translation elongation factor EF-1, MYCTH_2298136) promoter P tef1 . Blue letters indicate the nuclear localization signal. Red letters indicate the Cas12a gene. Gray letters indicate the T trpC terminator from A. nidulans trpC gene. Additional...”
C6L868 Elongation factor 1-alpha from Brachionus plicatilis
29% identity, 65% coverage
- Long-term survival of hydrated resting eggs from Brachionus plicatilis
Clark, PloS one 2012 - “...progression rotifera-CL3Contig3 ATPsynthase F0 subunit 6 E2D7B0 1.6E-36 ATP synthesis rotifera-CL52Contig1 Translation elongation factor 1 C6L868 1.1E-231 Protein biosynthesis rotifera-CL2956Contig1 NADH dehydrogenase subunit 3 B1GYK2 9.6E-12 Electron transport sbs02P0001I19_F.ab1 Voltage dependent anion-selective channel E3TCS5 2.8E-12 Transport Representative clones have been annotated with putative functions. Different members...”
NP_942101 G1 to S phase transition 1, like from Danio rerio
Q7T358 G1 to S phase transition 1 from Danio rerio
28% identity, 63% coverage
G4VAD2 Elongation factor 1-alpha from Schistosoma mansoni
28% identity, 65% coverage
A9RGA5 Elongation factor 1-alpha from Physcomitrium patens
29% identity, 64% coverage
- Specific pools of endogenous peptides are present in gametophore, protonema, and protoplast cells of the moss Physcomitrella patens.
Fesenko, BMC plant biology 2015 - “...of ribulose-1,5-bisphosphate carboxylase/oxygenase (RuBisCO), P34915 (giving rise to 111 native peptides), and elongation factor 1-alpha, A9RGA5 (80 native peptides), A9RX76 (chloroplastic fructose-bisphosphate aldolase, 48 native peptides), and A9SPD7 (photosystem I reaction center subunit IV, 47 native peptides), among others. We analyzed the peptide abundance in peptidomes...”
L1LF41 Elongation factor 1-alpha from Theileria equi strain WA
BEWA_037990 elongation factor Tu family member from Theileria equi strain WA
BEWA_038000 elongation factor Tu family member from Theileria equi strain WA
27% identity, 67% coverage
- Characterisation of the Theileria orientalis Piroplasm Proteome across Three Common Genotypes
Jenkins, Pathogens (Basel, Switzerland) 2022 - “...[ 30 ] Thioredoxin J7MGV8 1.02 Redox homeostasis [ 31 ] Buffeli Elongation factor 1-alpha L1LF41 1.99 Translation [ 22 ] Heat shock protein 70 J4D700 1.81 Protein processing and turnover [ 25 ] Glyceraldehyde 3-phosphate dehydrogenase J4C4H6 1.59 Metabolismglycolysis [ 32 ] Uncharacterised protein J4C2Q4...”
- Development of a stable transgenic Theileria equi parasite expressing an enhanced green fluorescent protein/blasticidin S deaminase
Tuvshintulga, Scientific reports 2021 - “...2 of the T . equi WA strain (GenBank accession no. NW_004668230.1; Gene ID no. BEWA_037990 (695,088696,737) and BEWA_038000 (697,369698,964), respectively). The two loci in the T . equi WA strain contain two ef-1 head-to-head-oriented ORFs flanked by ribonucleoside-diphosphate reductase ( rdrs ; Gene ID: BEWA_037980)...”
- Development of a stable transgenic Theileria equi parasite expressing an enhanced green fluorescent protein/blasticidin S deaminase
Tuvshintulga, Scientific reports 2021 - “...T . equi WA strain (GenBank accession no. NW_004668230.1; Gene ID no. BEWA_037990 (695,088696,737) and BEWA_038000 (697,369698,964), respectively). The two loci in the T . equi WA strain contain two ef-1 head-to-head-oriented ORFs flanked by ribonucleoside-diphosphate reductase ( rdrs ; Gene ID: BEWA_037980) and glutamyl -...”
O50018 Elongation factor 1-alpha from Zea mays
NP_001105587 elongation factor 1-alpha from Zea mays
28% identity, 66% coverage
- Leaf Proteomic Analysis in Seedlings of Two Maize Landraces with Different Tolerance to Boron Toxicity
Mamani-Huarcaya, Plants (Basel, Switzerland) 2023 - “...control of gene expression in organelles Proteins very strongly repressed by B toxicity in Pacha O50018 Zm00001d046449 Elongation factor 1- 0.29 0.0269 Translation. Translation elongation factor activity TRANSPORTERS AND TRANSPORT PROCESSES Proteins very strongly induced by B toxicity in Pacha B6SP43 Zm00001d007597 ABC family1 4.54 0.0103...”
- Combining P and Zn fertilization to enhance yield and grain quality in maize grown on Mediterranean soils
Sánchez-Rodríguez, Scientific reports 2021 - “...2688.99 57.05 0.18 0.29 2.78 0.68 A0A1D6FW13 Actin-7 19 1169.94 54.85 0.11 0.00 1.61 3.24 O50018 Elongation factor 1-alpha 20 1972.30 53.24 0.10 0.0270 0.29 0.94 0.79 Q5EUE0 Protein disulfide-isomerase (EC 5.3.4.1) 27 766.07 54.88 0.10 0.0365 0.58 1.40 1.89 B6UHJ4 Elongation factor 1-alpha 20 1642.73...”
- Evaluation of the effects of humic acids on maize root architecture by label-free proteomics analysis
Nunes, Scientific reports 2019 - “...C0P4Q3 Putative heat shock protein 90 family protein 1.7 1.3E-03 K7UBP7 Uncharacterized protein 1.6 1.0E-05 O50018 Elongation factor 1-alpha 1.3 1.0E-05 B4G0V4 Coatomer subunit delta 1.2 1.0E-05 B8A0C4 Uncharacterized protein 1.2 1.0E-05 C0P6Q4 Transcribed sequence 1087 protein 1.2 1.0E-05 K7V7B1 Transketolase isoform 1 1.2 1.0E-05 B6TBM1...”
- Genome-wide investigation of maize RAD51 binding affinity through phage display
Milsted, BMC genomics 2022 - “...uncharacterized protein NP_001168647 31 11 Ten Elongation factor 1-alpha-like proteins: AQK85106, NP_001152668, XP_008656156, XP_008656153, NP_001338678, NP_001105587, NP_001105933, XP_035815740, AQK85098, Q41803 These peptides were designed based on regions of known or predicted maize proteins with close alignment to selected phage peptides from Table 1 . Of these...”
S7UIZ8 Elongation factor 1-alpha from Toxoplasma gondii (strain ATCC 50853 / GT1)
31% identity, 49% coverage
EFA1 elongation factor 1-alpha from Magnaporthe grisea 70-15 (see paper)
MGG_03641 elongation factor 1-alpha from Pyricularia oryzae 70-15
29% identity, 66% coverage
- Rapid adaptation of signaling networks in the fungal pathogen Magnaporthe oryzae
Bohnert, BMC genomics 2019 - “...following the manufacturers instructions. We used the tubulin gene (MGG_06650) and the EF1-alpha gene (MGG MGG_03641) as reference genes (housekeeping genes) for the relative quantification of the expression ratio. Calculations were based on the relative quantification method of [ 55 ]. SNP analysis Sequencing reads mapped...”
- Structure Analysis Uncovers a Highly Diverse but Structurally Conserved Effector Family in Phytopathogenic Fungi
de, PLoS pathogens 2015 - “...biotrophic infection ( BAS3 , MGG_11610 ), late infection (MGG_01147 ) and constitutive expression (EF1, MGG_03641 ) were determined by q-RT-PCR in rice leaf samples harvested 16, 24, 48 and 72 h after inoculation and mycelium grown in vitro . Relative expression levels were calculated by...”
- “...( BAS3 , MGG_11610 ), late infection ( MGG_01147 ), constitutive expression ( EF1 , MGG_03641 ). Relative expression levels were calculated by using expression of a constitutively expressed Actin ( MGG_03982 ) as a reference. Mean values and standard deviation were calculated from three independent...”
BBOV_IV010620 putative translation elongation factor EF-1 subunit alpha from Babesia bovis T2Bo
28% identity, 67% coverage
- Recent Advances in Molecular Genetic Tools for Babesia
Hakimi, Veterinary sciences 2021 - “...tagging, or overexpression. Gene Product Gene ID Targeted Method Phenotye Reference Elongation factor 1-alpha (ef1-) BBOV_IV010620 Knockout Not essential for in vitro growth [ 23 , 35 , 36 , 38 ] Thioredoxin perxidase 1 (Tpx-1) BBOV_II004970 Knockout Not essential for in vitro growth, increased sensitivity...”
A0A059Q008 Elongation factor 1-alpha from Saccharum hybrid cultivar R570
28% identity, 66% coverage
- Metabolic Pathways Involved in Carbon Dioxide Enhanced Heat Tolerance in Bermudagrass
Yu, Frontiers in plant science 2017 - “...6 n574 A0A0U5GUY4 Ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [ Neostapfiella perrieri ] 6.3398514 49871.655 7 n598 A0A059Q008 Elongation factor 1-alpha [ Saccharum hybrid cultivar ] 9.1394882 49276.993 3 n616 C0P699 Elongation factor Tu [ Zea mays ] 6.1954422 50776.346 3 n619 A0A077JG84 S-adenosylmethionine synthase [ Andropogon virginicus...”
- “...3 h845 A0A059Q0R4 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase [ Saccharum hybrid cultivar R570] 6.8003159 53254.56 2 h903 A0A059Q008 Elongation factor 1-alpha [ Saccharum hybrid cultivar R570] 9.1394882 49276.993 3 h951 A0A077JG84 S-adenosylmethionine synthase [ Andropogon virginicus ] 5.5640793 43045.785 4 h964 K3ZIK0 Rubisco activase [ Arabidopsis thaliana ]...”
Q6AXM7 HBS1-like protein from Rattus norvegicus
28% identity, 61% coverage
Q5DEG6 Elongation factor 1-alpha from Schistosoma japonicum
28% identity, 70% coverage
XP_036011791 HBS1-like protein isoform X3 from Mus musculus
29% identity, 65% coverage
Q41803 Elongation factor 1-alpha from Zea mays
28% identity, 66% coverage
- Genome-wide investigation of maize RAD51 binding affinity through phage display
Milsted, BMC genomics 2022 - “...11 Ten Elongation factor 1-alpha-like proteins: AQK85106, NP_001152668, XP_008656156, XP_008656153, NP_001338678, NP_001105587, NP_001105933, XP_035815740, AQK85098, Q41803 These peptides were designed based on regions of known or predicted maize proteins with close alignment to selected phage peptides from Table 1 . Of these 32 synthesized peptides, 14...”
- Leaf proteome modulation and cytological features of seagrass Cymodocea nodosa in response to long-term high CO2 exposure in volcanic vents.
Piro, Scientific reports 2020 - “...Photosynthesis P0C520 K02132 ATP synthase subunit alpha, mitochondrial 1.414 2.665 SLA 55,657.7 ko00190 Energy metabolism Q41803 K03231 Elongation factor 1-alpha 7.805 223.659 STD 49,574.4 ko03013 Translation Q08062 K00025 Malate dehydrogenase, cytoplasmic 7.712 209.621 STD 35,931.6 ko01200 Carbon metabolism P0C510 K01601 Ribulose bisphosphate carboxylase large chain 7.099...”
- Protein Profiling Reveals Novel Proteins in Pollen and Pistil of W22 (ga1; Ga1) in Maize
Yu, Proteomes 2014 - “...Exopolygalacturonase 63 43,269 8.44 5 17.8 67.85 P35338 Exopolygalacturonase 79 43,387 6.59 5 15.1 66.03 Q41803 Elongation factor 1-alpha 96 49,202 9.19 7 23 46.8 P29022 Endochitinase A 103 29,106 8.3 3 22.5 69.56 P29023 Endochitinase B (Fragment) 61 28,147 8.94 2 14.9 59.82 P10593 Albumin...”
- Abscisic acid refines the synthesis of chloroplast proteins in maize (Zea mays) in response to drought and light
Hu, PloS one 2012 - “...5.31/54.04 512 63% (31) Chloroplast Chloroplast Chloroplast ATP bindingATP synthase activity 4 Elongation factor 1 Q41803 5.33/53 5.33/44.57 55 40% (11) Chloroplast Chloroplast Chloroplast GTP binding, translation elongation factor activity 5 Malic enzyme Q8W000 5.6/53 6.46/70.74 163 36% (23) Chloroplast Chloroplast Chloroplast NAD bindingMalate dehydrogenase 6...”
B6UHJ4 Elongation factor 1-alpha from Zea mays
NP_001152668 uncharacterized protein LOC100286309 from Zea mays
28% identity, 66% coverage
- Combining P and Zn fertilization to enhance yield and grain quality in maize grown on Mediterranean soils
Sánchez-Rodríguez, Scientific reports 2021 - “...0.94 0.79 Q5EUE0 Protein disulfide-isomerase (EC 5.3.4.1) 27 766.07 54.88 0.10 0.0365 0.58 1.40 1.89 B6UHJ4 Elongation factor 1-alpha 20 1642.73 53.24 0.09 0.00 1.33 2.57 B6SMQ5 Triose phosphate isomerase5 13 412.68 63.67 0.08 0.0031 1.09 1.49 5.15 A0A1D6K2D7 Sucrose synthase (EC 2.4.1.13) 35 758.50 45.11...”
- Genome-wide investigation of maize RAD51 binding affinity through phage display
Milsted, BMC genomics 2022 - “...factor MYC2 XP_020402137 and uncharacterized protein NP_001168647 31 11 Ten Elongation factor 1-alpha-like proteins: AQK85106, NP_001152668, XP_008656156, XP_008656153, NP_001338678, NP_001105587, NP_001105933, XP_035815740, AQK85098, Q41803 These peptides were designed based on regions of known or predicted maize proteins with close alignment to selected phage peptides from Table...”
HBS1L_MOUSE / Q69ZS7 HBS1-like protein; EC 3.6.5.- from Mus musculus (Mouse) (see 2 papers)
28% identity, 60% coverage
- function: GTPase component of the Pelota-HBS1L complex, a complex that recognizes stalled ribosomes and triggers the No-Go Decay (NGD) pathway. The Pelota-HBS1L complex recognizes ribosomes stalled at the 3' end of an mRNA and engages stalled ribosomes by destabilizing mRNA in the mRNA channel. Following mRNA extraction from stalled ribosomes by the SKI complex, the Pelota-HBS1L complex promotes recruitment of ABCE1, which drives the disassembly of stalled ribosomes, followed by degradation of damaged mRNAs as part of the NGD pathway.
catalytic activity: GTP + H2O = GDP + phosphate + H(+) (RHEA:19669)
subunit: Component of the Pelota-HBS1L complex, also named Dom34-Hbs1 complex, composed of PELO and HBS1L. Interacts with the SKI complex.
disruption phenotype: Embryonic lethality; embryos fail to develop after 8.5 dpc (PubMed:33899734). Conditional deletion in the in the developing cerebellum and midbrain leads to severe development defects in the cerebellum characterized by the absence of multiple cell types (PubMed:33899734). In contrast, conditional deletion in the adult cerebellum and midbrain does not cause defects in neuron survival (PubMed:33899734). Defects are probably caused by ribosome pausing, due to inability to rescue stalled ribosomes (PubMed:33899734). - In utero and lactational 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) exposure exacerbates urinary dysfunction in hormone-treated C57BL/6J mice through a non-malignant mechanism involving proteomic changes in the prostate that differ from those elicited by testosterone and estradiol
Turco, American journal of clinical and experimental urology 2020 (secret) - Comparative analyses of differentially induced T-cell receptor-mediated phosphorylation pathways in T lymphoma cells.
Ortiz, Experimental biology and medicine (Maywood, N.J.) 2010 - “...protein vesicle/trafficking <1.00E-14 GPKOW Q56A08 G patch domain and KOW motifs cell cycle <1.00E-14 HBS1L Q69ZS7 HBS1-like (S. cerevisiae) transcription/translation, cell cycle <1.00E-14 HCLS1 ^ P49710 hematopoietic cell-specific Lyn substrate 1 signal transduction <1.00E-14 HNRNPA3 Q8BG05 heterogeneous nuclear ribonucleoprotein A3 transcription/translation <1.00E-14 ITSN1 Q9Z0R4 intersectin 1...”
Q8SAT2 Elongation factor 1-alpha from Saccharum officinarum
28% identity, 66% coverage
- Insights of cellular and molecular changes in sugarcane response to oxidative signaling
Silva, BMC plant biology 2025 - “...polymerase subunit beta, EC 2.7.7.6 Rhododendron macrophyllum Root 0.67 0.04544 - - - - 18873725 Q8SAT2 Elongation factor 1-alpha Saccharum officinarum Root 4.00 0.01645 4.00 0.01645 4.00 0.01645 116314 P08252 Endochitinase A, CHN-A, EC 3.2.1.14 Nicotiana tabacum Root 1.33 0.02278 1.33 0.02278 1.33 0.02278 162461501 Q09054...”
- “...Chlorophyll a-b binding protein, chloroplastic Zea mays Leaf - - 2.33 0.01750 - - 18873725 Q8SAT2 Elongation factor 1-alpha Saccharum officinarum Leaf 4.33 0.00130 1.33 0.19171 133917261 A4F3R3 Chlorophyll a-b binding protein, chloroplastic Spinacia oleracea Leaf - - 21.33 0.04770 - - 242087035 C5Z116 Germin-like protein...”
XP_004334950 translation elongation factor EF1, subunit alpha, putative from Acanthamoeba castellanii str. Neff
28% identity, 67% coverage
- Two classes of EF1-family translational GTPases encoded by giant viruses
Zinoviev, Nucleic acids research 2019 - “...(NP_002085), eRF3B (NP_060564), HBS1 (NP_006611). NCBI accession numbers for Acanthamoeba castellanii proteins: eEF1A1 (XP_004339060), eEF1A2 (XP_004334950), eRF3 (XP_004351562) and HBS1 (XP_004339935). NCBI accession numbers for viral GTPases: A. castellanii mamavirus (ACMaV) (AEQ60824), Hirudo virus strain Sangsue (HV-Sang) (AHA45220), A. polyphaga mimivirus (APMiV) (YP_003987141), Megavirus lba (MV-lba)...”
eft-3 / AAY17225.1 eukaryotic translation elongation factor 1A from Oscheius tipulae (see paper)
29% identity, 65% coverage
eft-4 / AAY17221.1 eukaryotic translation elongation factor 1A from Oscheius tipulae (see paper)
29% identity, 69% coverage
P29520 Elongation factor 1-alpha from Bombyx mori
28% identity, 65% coverage
- Generation and analysis of transcriptomic resources for a model system on the rise: the sea anemone Aiptasia pallida and its dinoflagellate endosymbiont
Sunagawa, BMC genomics 2009 - “...(2.5) Elongation factor 2 P05197 Rattus norvegicus 0 Contig642 b 203 (2.0) Elongation factor 1-alpha P29520 Bombyx mori 0 Contig643 c 181 (1.8) Polyadenylate-binding protein 1 P11940 Homo sapiens 1e-177 Contig785 c 178 (1.7) Polyadenylate-binding protein 4 Q13310 Homo sapiens 8e-30 Contig248 113 (1.1) Collagen alpha-2(I)...”
- “...Contig514 79 (0.8) Catalase P04040 Homo sapiens 0 Contig1015 b 55 (0.5) Elongation factor 1-alpha P29520 Bombyx mori 1e-125 Contig950 51 (0.5) Collagen alpha-1(II) chain Q91717 Xenopus laevis 2e-50 Contig262 50 (0.5) no_hits_found - - - Contig6 44 (0.4) no_hits_found - - - Contig651 43 (0.4)...”
XP_001801902 hypothetical protein from Parastagonospora nodorum SN15
27% identity, 66% coverage
- Differential effector gene expression underpins epistasis in a plant fungal disease
Phan, The Plant journal : for cell and molecular biology 2016 - “...CFX96 RealTime PCR Detection System (BioRad, Hercules, CA). Elongation factor 1 ( EF1 (GenBank acc, XP_001801902 ) and actin Act1 housekeeping genes were used as a constitutively expressed control for normalisation using the EF1alphaF/R and ActinqpcrF/R primer pairs (Tan etal ., 2008 ). All reactions were...”
Q8BPH0 Tr-type G domain-containing protein (Fragment) from Mus musculus
28% identity, 66% coverage
GL50803_112312 Elongation factor 1-alpha from Giardia intestinalis
GL50803_112304 Elongation factor 1-alpha from Giardia intestinalis
28% identity, 65% coverage
- A core UPS molecular complement implicates unique endocytic compartments at the parasite-host interface in Giardia lamblia
Balmer, Virulence 2023 - “...1-alpha present in Giardia which differ only by their up- and downstream regions (GL50803_112304 and GL50803_112312) while their coding regions differ only by two nucleotides, which do not affect the predicted protein sequence (Skarin et al. 2011). As these two genes give rise to the same...”
- A core UPS molecular complement implicates unique endocytic compartments at the parasite-host interface in Giardia lamblia
Balmer, 2022 - Giardia secretome highlights secreted tenascins as a key component of pathogenesis
Dubourg, GigaScience 2018 - “...Sentrin GL50803_7760 GL50581_3210 NP c 1.44E+05 ND c ND c ND c 3.67E+04 31 EF-1 GL50803_112312 NP c ND c 2.22E+06 17 ATP-binding cassette protein 5 GL50803_8227 GL50581_3399 NP c 2.93E+06 2.89E+06 0.98546 2.01E+05 1.43E+04 0.071052 15 897 CxC rich protein GL50803_17476 GL50581_4509 1 4.80E+05 2.83E+05...”
- The minimal proteome in the reduced mitochondrion of the parasitic protist Giardia intestinalis
Jedelský, PloS one 2011 - “...O 0 # 0 GL50803_88765 Cytosolic HSP70 22 1 Y N O 4% 1 0 GL50803_112312 Elongation factor 1-alpha 424 10 Y N O 4% 1 0 GL50803_12102 Elongation factor 1-gamma 158 3 Y N M 13% 1 0 GL50803_28379 Multidrug resistance-associated protein 1 210 4...”
- A core UPS molecular complement implicates unique endocytic compartments at the parasite-host interface in Giardia lamblia
Balmer, Virulence 2023 - “...(Maayeh et al. 2017) No 212.2/39.26 GL50803_3910 hypothetical sec. (Maayeh et al. 2017) No 157.87/236.14 GL50803_112304 EF1-alpha sec. (Dubourg et al. 2017, Maayeh et al. 2017) No 161.61/76 GL50803_12091 Macrophage migration inhibitory factor sec. (Dubourg et al. 2017) No 140.06/16.53 GL50803_6687 GAPDH sec. (Maayeh et al....”
- “...(GL50803_112103 Arginine deiminase, GL50803_12091 Macrophage migration inhibitory factor (MIF), GL50803_3910 hypothetical protein, GL50803_16453 carbamate kinase, GL50803_112304 TEF1 alpha, GL50803_6687 GAPDH (Glyceraldehyde 3-phosphate dehydrogenase)) show a cytosolic distribution, while GL50803_4812 beta-giardin shows localization to the ventral disc. The first four transgenic lines on the right (GL50803_17327 Xaa-Pro...”
- Transcriptome profiling of Giardia intestinalis using strand-specific RNA-seq
Franzén, PLoS computational biology 2013 - “..., consistent with our data. Finally, Skarin et al. reported the 3 UTR of EF-1 (GL50803_112304) to be 16 nt [63] , which was also consistent with our data. In conclusion, RACE experiments and data from the literature supported the authenticity of mapped polyA sites. 10.1371/journal.pcbi.1003000.t003...”
XP_008656153 elongation factor 1-alpha from Zea mays
28% identity, 66% coverage
- Genome-wide investigation of maize RAD51 binding affinity through phage display
Milsted, BMC genomics 2022 - “...XP_020402137 and uncharacterized protein NP_001168647 31 11 Ten Elongation factor 1-alpha-like proteins: AQK85106, NP_001152668, XP_008656156, XP_008656153, NP_001338678, NP_001105587, NP_001105933, XP_035815740, AQK85098, Q41803 These peptides were designed based on regions of known or predicted maize proteins with close alignment to selected phage peptides from Table 1 ....”
Q91855 SUP35 protein (Fragment) from Xenopus laevis
28% identity, 66% coverage
- A deep proteomics perspective on CRM1-mediated nuclear export and nucleocytoplasmic partitioning
Kırlı, eLife 2015 - “...channel as a control for the LMB-effect. Tested candidates: eukaryotic peptide chain release factor eRF3a (Q91855), subunit 1b of the ARP2/3 complex (Q6GNU1), Septin-2 (B7ZR20), Ap1-gamma subunit of the clathrin-associated adapter complex (Q6GPE1), the cAMP-dependent kinase type II-alpha regulatory subunit pRKAr2a (F7CZT8), and the regulator of...”
- “...of cargo candidates as direct CRM1-binders. The H14-ZZ-Sumo tagged candidate proteins ARP2/3 1b (Q6GNU1), eRF3a (Q91855), Haus1 (Q3B8L5), pRKAr2a (F7CZT8), Septin-2 (B7ZR20) were expressed in E. coli , purified, immobilised on anti-zz beads, and incubated with CRM1 in the absence or presence of RanGTP. Immobilised candidate...”
I3LNK5 Eukaryotic peptide chain release factor GTP-binding subunit ERF3A isoform 1 from Sus scrofa
28% identity, 65% coverage
ERF3A_HUMAN / P15170 Eukaryotic peptide chain release factor GTP-binding subunit ERF3A; Eukaryotic peptide chain release factor subunit 3a; eRF3a; G1 to S phase transition protein 1 homolog; EC 3.6.5.- from Homo sapiens (Human) (see 8 papers)
NP_001123479 eukaryotic peptide chain release factor GTP-binding subunit ERF3A isoform 3 from Homo sapiens
28% identity, 66% coverage
- function: GTPase component of the eRF1-eRF3-GTP ternary complex, a ternary complex that mediates translation termination in response to the termination codons UAA, UAG and UGA (PubMed:15987998, PubMed:19417105, PubMed:2511002, PubMed:27863242). GSPT1/ERF3A mediates ETF1/ERF1 delivery to stop codons: The eRF1-eRF3-GTP complex binds to a stop codon in the ribosomal A-site (PubMed:27863242). GTP hydrolysis by GSPT1/ERF3A induces a conformational change that leads to its dissociation, permitting ETF1/ERF1 to accommodate fully in the A-site (PubMed:16777602, PubMed:27863242). Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons (PubMed:24486019). Required for SHFL-mediated translation termination which inhibits programmed ribosomal frameshifting (-1PRF) of mRNA from viruses and cellular genes (PubMed:30682371).
catalytic activity: GTP + H2O = GDP + phosphate + H(+) (RHEA:19669)
subunit: Component of the eRF1-eRF3-GTP ternary complex, composed of ETF1/ERF1 and ERF3 (GSPT1/ERF3A or GSPT2/ERF3B) and GTP (PubMed:19417105, PubMed:27863242). Component of the transient SURF (SMG1-UPF1-eRF1-eRF3) complex (PubMed:19417104). The ETF1-GSPT1 complex interacts with JMJD4 (PubMed:24486019). Interacts with PABPC1 (By similarity). Interacts with SHFL (PubMed:30682371). - Potential of GSPT1 as a novel target for glioblastoma therapy.
Sasayama, Cell death & disease 2024 - GeneRIF: Potential of GSPT1 as a novel target for glioblastoma therapy.
- GSPT1 Functions as a Tumor Promoter in Human Liver Cancer.
Xi, Current medical science 2023 (PubMed)- GeneRIF: GSPT1 Functions as a Tumor Promoter in Human Liver Cancer.
- MicroRNA-508-3p regulates the proliferation of human lung cancer cells by targeting G1 to S phase transition 1 (GSPT1) protein.
Chen, Acta biochimica Polonica 2023 (PubMed)- GeneRIF: MicroRNA-508-3p regulates the proliferation of human lung cancer cells by targeting G1 to S phase transition 1 (GSPT1) protein.
- Vimentin binds to a novel tumor suppressor protein, GSPT1-238aa, encoded by circGSPT1 with a selective encoding priority to halt autophagy in gastric carcinoma.
Hu, Cancer letters 2022 (PubMed)- GeneRIF: Vimentin binds to a novel tumor suppressor protein, GSPT1-238aa, encoded by circGSPT1 with a selective encoding priority to halt autophagy in gastric carcinoma.
- Identification of GSPT1 as prognostic biomarker and promoter of malignant colon cancer cell phenotypes via the GSK-3β/CyclinD1 pathway.
Long, Aging 2021 - GeneRIF: Identification of GSPT1 as prognostic biomarker and promoter of malignant colon cancer cell phenotypes via the GSK-3beta/CyclinD1 pathway.
- Role of GSPT1 and GSPT2 polymorphisms in different outcomes upon Hepatitis B virus infection and prognosis to lamivudine therapy.
Liu, Bioscience reports 2019 - GeneRIF: Data show that G1 to S phase transition 1 protein (GSPT1)-rs33635C was a predictor for lamivudine (LAM) therapy.
- Downregulation of microRNA-27b-3p via aberrant DNA methylation contributes to malignant behavior of gastric cancer cells by targeting GSPT1.
Zhang, Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie 2019 (PubMed)- GeneRIF: miR-27b-3p suppresses gastric cancer cell proliferation, invasion, and migration via negative expression regulation of GSPT1.
- The role of miR-144/GSPT1 axis in gastric cancer.
Tian, European review for medical and pharmacological sciences 2018 (PubMed)- GeneRIF: miR-144 was found to be down-regulated in gastric cancer tissues while GSPT1 expression level was markedly increased; GSPT1 was a direct target of miR-144.
- More
- Acute stress and multicellular development alter the solubility of the Dictyostelium Sup35 ortholog ERF3.
Williams, Microbiology spectrum 2024 - “...S. cerevisiae Sup35, and human GSPT1 protein sequences were obtained from UniProt (Q7YZN9, P05453, and P15170, respectively). Predicted structures were obtained from AlphaFold ( 94 , 95 ) and aligned in PyMOL v2 (Schrdinger, LLC.). Disorder prediction was conducted using IUPRED3 ( 96 ), and protein...”
- An integrated approach using proximity labelling and chemical crosslinking to probe in situ host-virus protein-protein interactions.
Li, QRB discovery 2024 - “...P23396 5AJ0 PSMC5 P62195 5GJR Antiviral EIF4G2 P78344 4IUL Antiviral UPF1 Q92900 2GJK Antiviral GSPT1 P15170 5LZT Proviral TurboID Single protein HCMV US28 1,054 PDZ-RhoGEF O15085 1HTJ Proviral Medica et al. ( 2023 ) p115-RhoGEF Q92888 1IAP Proviral ROCK1 Q13464 2ESM Proviral TurboID Recombinant virus HCMV...”
- Longitudinal Assessment of Nasopharyngeal Biomarkers Post-COVID-19: Unveiling Persistent Markers and Severity Correlations.
Redondo-Calvo, Journal of proteome research 2024 - “...1.62 COPS4 Q9BT78 ERF3A eukaryotic peptide chain release factor GTP-binding subunit ERF3A 1.82 1.63 GSPT1 P15170 SETD7 histone-lysineN-methyltransferase SETD7 1.89 1.64 SETD7 Q8WTS6 ANS1A ankyrin repeat and SAM domain-containing protein 1A 1.90 1.65 ANKS1A Q92625 AIMP2 aminoacyl tRNA synthase complex-interacting multifunctional protein2 1.65 1.65 AIMP2 Q13155...”
- Proteomics analysis of coronary blood microparticles in patients with acute myocardial infarction
Ma, Cardiology journal 2023 - “...protein 4 0.11984 < 0.001 17 P23396 RS3 40S ribosomal protein S3 54.46225 0.044 18 P15170 ERF3A Eukaryotic peptide chain release factor GTP-binding subunit ERF3A 39.50445 0.005 19 p02724 CD235 Glycophorin-A 28.00383 < 0.001 20 Q9P289 STK26 Serine/threonine-protein kinase 26 25.99137 0.038 21 Q8IXS0 FAM217A Protein...”
- The mitotic surveillance pathway requires PLK1-dependent 53BP1 displacement from kinetochores
Burigotto, 2023 - ArtinM Cytotoxicity in B Cells Derived from Non-Hodgkin's Lymphoma Depends on Syk and Src Family Kinases
Barboza, International journal of molecular sciences 2023 - “...cells ( Table 1 C), positive regulators of cell cycle progression, namely, ANP32B (Q92688), GSPT1 (P15170), and SUB1 (P53999) were upregulated after ArtinM stimulus. In addition, ArtinM-stimulation of Daudi cells up-regulated proteins was involved in the transcriptional regulation of histones H1-2 (P16403), H1-4 (P10412), and H2AC11...”
- “...Accession Fold-Change H1-4 Histone H1.4 P10412 1.94501 GSPT1 Eukaryotic peptide chain release factor subunit 3a P15170 0.97709 H1-2 Histone H1.2 P16403 0.71206 SUB1 Activated RNA polymerase II transcriptional coactivator p15 P53999 0.64848 KRT18 Keratin, type I cytoskeletal 18 P05783 0.56628 ANP32B Acidic leucine-rich nuclear phosphoprotein 32...”
- An Exploratory Application of Multilayer Networks and Pathway Analysis in Pharmacogenomics.
Milano, Genes 2023 - “...disease progression or decline, is regulated by the interactions of more multilayer genes, namely P43088, P15170, P18509, P05546, Q9Y277, Q02817, Q13285, O75976 , and P15328 , reinforcing the benefits of the multilayer formalism to represent complex networks. 3.4. Results and Discussion Pharmacogenomics is a complex field...”
- “...Q8WY36 Q5VXI4 Q9BS34 O76080 D008654 D003645 D013276 Q16778 Q9HAW4 D009901 P04350 D017544 C538090 D007239 A0A087X004 P15170 P15170 Q9Y4B6 D015658 Q9NY84 P41250 D033461 Q9H857 Q9BUR5 Q9UKX2 A0A087WUN7 J3KNS1 D013272 Q9UPY5 Q8N392 Q9H8E8 E9PLK3 D001528 Q13275 Q7Z7E8 D009402 Q96FG2 O95996 Q9Y2B9 Q9BUA6 Q99687 Q9UHE8 D011695 Q96DC8 Q9ULC0 Q9H1K4...”
- A MademoiseLLE domain binding platform links the key RNA transporter to endosomes
Devan, PLoS genetics 2022 - “...Usp10 (Q14694), GW182 Q9HCJ0), Mkrn1 (Q9UHC7), Paip1 (Q9H074), Paip2 (Q9BPZ3), Atx2 (-Q99700), NFX (Q12986), eRF3 (P15170), PAN3 (Q58A45), LARP4 (Q71RC2), LARP4b (Q92615), Tob (P50616), HECT (O95071), Asp and Glu are indicated in red stressing the highly negative charges in PAM2L sequences. ( B ) Western blot...”
- More
5lztjj / P15170 of the mammalian ribosomal termination complex with eRF1 and eRF3. (see paper)
28% identity, 66% coverage
- Ligands: rna; magnesium ion (5lztjj)
K7UUB7 Elongation factor 1-alpha from Zea mays
XP_008656156 elongation factor 1-alpha-like isoform X1 from Zea mays
28% identity, 66% coverage
- Combining P and Zn fertilization to enhance yield and grain quality in maize grown on Mediterranean soils
Sánchez-Rodríguez, Scientific reports 2021 - “...0.0143 0.31 3.73 0.90 A0A1D6KL30 Sorbitol dehydrogenase 18 961.14 68.03 0.20 0.0007 0.25 1.72 1.24 K7UUB7 Elongation factor 1-alpha 21 2688.99 57.05 0.18 0.29 2.78 0.68 A0A1D6FW13 Actin-7 19 1169.94 54.85 0.11 0.00 1.61 3.24 O50018 Elongation factor 1-alpha 20 1972.30 53.24 0.10 0.0270 0.29 0.94...”
- Genome-wide investigation of maize RAD51 binding affinity through phage display
Milsted, BMC genomics 2022 - “...MYC2 XP_020402137 and uncharacterized protein NP_001168647 31 11 Ten Elongation factor 1-alpha-like proteins: AQK85106, NP_001152668, XP_008656156, XP_008656153, NP_001338678, NP_001105587, NP_001105933, XP_035815740, AQK85098, Q41803 These peptides were designed based on regions of known or predicted maize proteins with close alignment to selected phage peptides from Table 1...”
XP_013586115 elongation factor 1-alpha 1-like from Brassica oleracea var. oleracea
28% identity, 66% coverage
Q4H447 Elongation factor 1-alpha from Dryophytes japonicus
28% identity, 67% coverage
NP_001338678 elongation factor alpha 5 from Zea mays
28% identity, 66% coverage
- Genome-wide investigation of maize RAD51 binding affinity through phage display
Milsted, BMC genomics 2022 - “...and uncharacterized protein NP_001168647 31 11 Ten Elongation factor 1-alpha-like proteins: AQK85106, NP_001152668, XP_008656156, XP_008656153, NP_001338678, NP_001105587, NP_001105933, XP_035815740, AQK85098, Q41803 These peptides were designed based on regions of known or predicted maize proteins with close alignment to selected phage peptides from Table 1 . Of...”
NP_002085 eukaryotic peptide chain release factor GTP-binding subunit ERF3A isoform 1 from Homo sapiens
28% identity, 65% coverage
- Two classes of EF1-family translational GTPases encoded by giant viruses
Zinoviev, Nucleic acids research 2019 - “...ClustalW. NCBI accession numbers for H. sapiens proteins: eEF1A1 (NP_001393), eEF1A2 (NP_001949), GTPBP1 (NP_004277), eRF3A (NP_002085), eRF3B (NP_060564), HBS1 (NP_006611). NCBI accession numbers for Acanthamoeba castellanii proteins: eEF1A1 (XP_004339060), eEF1A2 (XP_004334950), eRF3 (XP_004351562) and HBS1 (XP_004339935). NCBI accession numbers for viral GTPases: A. castellanii mamavirus (ACMaV)...”
XP_006340223 elongation factor 1-alpha-like from Solanum tuberosum
28% identity, 65% coverage
- LreEF1A4, a Translation Elongation Factor from Lilium regale, Is Pivotal for Cucumber Mosaic Virus and Tobacco Rattle Virus Infections and Tolerance to Salt and Drought
Sun, International journal of molecular sciences 2020 - “...Petunia hybrida PheEF1A (Peaxi162Scf00351g00321, Sol Genomics Network database), Lycopersicum esculentum LeeEF1A (P17786), Solanum tuberosum SteEF1A (XP_006340223), Nicotiana tabacum NteEF1A (XP_016492900), Glycine max GmeEF1A (P25698), Triticum aestivum TaeEF1A (AQU14666), Arabidopsis AteEF1A1 (At1g07920), AteEF1A2 (At1g07930), AteEF1A3 (At1g07940), and AteEF1A4 (At5g60390), Oryza sativa OseEF1A1 (BAA23657), OseEF1A2 (BAA23658), OseEF1A3 (BAA23659),...”
ERF3A_MOUSE / Q8R050 Eukaryotic peptide chain release factor GTP-binding subunit ERF3A; Eukaryotic peptide chain release factor subunit 3a; eRF3a; G1 to S phase transition protein 1 homolog; EC 3.6.5.- from Mus musculus (Mouse)
28% identity, 66% coverage
- function: GTPase component of the eRF1-eRF3-GTP ternary complex, a ternary complex that mediates translation termination in response to the termination codons UAA, UAG and UGA. GSPT1/ERF3A mediates ETF1/ERF1 delivery to stop codons: The eRF1-eRF3-GTP complex binds to a stop codon in the ribosomal A-site. GTP hydrolysis by GSPT1/ERF3A induces a conformational change that leads to its dissociation, permitting ETF1/ERF1 to accommodate fully in the A-site. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Required for SHFL-mediated translation termination which inhibits programmed ribosomal frameshifting (-1PRF) of mRNA from viruses and cellular genes.
catalytic activity: GTP + H2O = GDP + phosphate + H(+) (RHEA:19669)
subunit: Component of the eRF1-eRF3-GTP ternary complex, composed of ETF1/ERF1 and ERF3 (GSPT1/ERF3A or GSPT2/ERF3B) and GTP. Component of the transient SURF (SMG1-UPF1-eRF1-eRF3) complex. The ETF1-GSPT1 complex interacts with JMJD4 (By similarity). Interacts with PABPC1 (Ref.7). Interacts with SHFL (By similarity).
NP_001123480 eukaryotic peptide chain release factor GTP-binding subunit ERF3A isoform 2 from Mus musculus
28% identity, 66% coverage
CAOG_07807 translation elongation factor 1-alpha from Capsaspora owczarzaki ATCC 30864
28% identity, 67% coverage
- Transfection of Capsaspora owczarzaki, a close unicellular relative of animals
Parra-Acero, Development (Cambridge, England) 2018 - “...the promoter and terminator regions of the endogenous elongation factor 1- ( EF1- ) gene (CAOG_07807) from Capsaspora (see Materials and Methods). We confirmed the successful expression of both fluorescent proteins by fluorescence microscopy ( Fig.2 A-A) and flow cytometry. We performed an immunofluorescence assay on...”
- “...expression vectors, named pONSY, bear the promoter and terminator regions from the endogenous EF-1 gene (CAOG_07807). To build the pONSY-Venus vector (5.849kb), the EF-1 promoter (906bp upstream from methionine) and terminator (320bp downstream from the stop codon) were amplified from gDNA with primers 1 and 2...”
LOC108222822 elongation factor 1-alpha from Daucus carota subsp. sativus
29% identity, 65% coverage
- Mining for Candidate Genes Controlling Secondary Growth of the Carrot Storage Root
Macko-Podgórni, International journal of molecular sciences 2020 - “...most reliable reference genes, we screened three chromosomal genes (actin7, LOC108202619; GADPH, LOC108223758; and EF-1-alpha, LOC108222822) and two plastid genes (rpl2, DCAR_032527; TIF-1, DCAR_032520). RT-qPCR was performed using the StepOnePlus Real-Time PCR (Thermo Fisher Scientific, Waltham, MA, USA). Primer efficiencies were calculated as described by Bowman...”
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory