PaperBLAST

PaperBLAST Hits for tr|Q9HUQ6|Q9HUQ6_PSEAE Probable short-chain dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA4907 PE=1 SV=1 (253 a.a., MSSTLFITGA...)

Show query sequence

>tr|Q9HUQ6|Q9HUQ6_PSEAE Probable short-chain dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA4907 PE=1 SV=1
MSSTLFITGATSGFGEACARRFAEAGWSLVLTGRREERLQALAGELSAKTRVLPLTLDVR
DRAAMSAAVDNLPEEFATLRGLINNAGLALGTDPAQSCDLDDWDTMVDTNIKGLLYSTRL
LLPRLIAHGAGASIVNLGSVAGKWPYPGSHVYGGTKAFVEQFSLNLRCDLQGTGVRVTNL
EPGLCESEFSLVRFGGDQARYDKTYAGAHPIQPEDIAETIFWIMNQPAHLNINSLEIMPV
SQSWAGFAIHRES

Running BLASTp...

Found 252 similar proteins in the literature:

PA4907 probable short-chain dehydrogenase from Pseudomonas aeruginosa PAO1
100% identity, 100% coverage

• The Breadth and Molecular Basis of Hcp-Driven Type VI Secretion System Effector Delivery
  Howard, mBio 2021
  • “...7.2 1.77 Dehydrocarnitine CoA c transferase 23.2 PA0662 ArgC 6.6 1.35 N -Acetyl-gamma-glutamyl-phosphate reductase 36.7 PA4907 YdfG 6.4 2.24 Short-chain dehydrogenase 27.4 PA0075 PppA 5.8 1.44 Represses H1-T6SS 25.9 PA5220 5.3 1.32 Hypothetical 30.5 PA4748 TpiA 5.3 2.46 Triosephosphate isomerase 25.6 PA0895 AruC 5 1.73 Succinylornithine...”
• Transcriptome analysis of Pseudomonas aeruginosa PAO1 grown at both body and elevated temperatures
  Chan, PeerJ 2016
  • “...32.829 101.139 1.6233 3.26832 5e-05 0.00069884 gene1803 cmaX 3.33028 10.2239 1.61823 1.72921 0.00745 0.0385256 gene5020 PA4907 9.76191 26.8597 1.46021 2.09157 0.0021 0.0159759 gene5057 hflK 17.8262 48.4164 1.4415 2.40358 0.00015 0.001803 gene3216 PA3157 9.87412 26.4346 1.4207 2.17387 0.00065 0.00630081 gene1838 clpX 55.3485 145.186 1.39129 2.83085 5e-05 0.00069884...”
• Proteome-wide quantification and characterization of oxidation-sensitive cysteines in pathogenic bacteria
  Deng, Cell host & microbe 2013
  • “...b GabT, 4-aminobutyrate aminotransferase LSHTC*FQVLAYEPYI ELAEEIAK 0.24 PA3155 b WbpE, probable aminotransferase AIIPVSLYGQC*ADFD AINAIASK 0.24 PA4907 Probable short-chain dehydrogenase VTNLEPGLC*ESEFSL VR 0.25 PA5171 ArcA, arginine deiminase (C363) EQWDDGNNVVC*LE PGVVVGYDR 0.25 PA1609 b FabB, beta-ketoacyl-ACP synthase I C*MQQALATVDAPID YLNTHGTSTPVGDV AEIR 0.25 PA3148 WbpI, UDP-N-acetylglucosamine 2-epimerase DQTEWVELVTC*GA NVLVGAAR...”
• A theoretical and experimental proteome map of Pseudomonas aeruginosa PAO1
  Lecoutere, MicrobiologyOpen 2012
  • “...0.068 144 * PA4886 Two-component sensor T CM 50.9 48 6.83 4.92 0.638 0.004 145 PA4907 Short-chain dehydrogenase R C 27.4 28 5.26 5.25 0.696 0.047 146 PA4920 nadE NH3-dependent NAD synthetase H C 29.7 34 5.42 5.59 0.693 0.193 147 PA4931 dnaB Replicative DNA helicase...”
• Characterization of the polyoxin biosynthetic gene cluster from Streptomyces cacaoi and engineered production of polyoxin H
  Chen, The Journal of biological chemistry 2009
  • “...A3(2) NodU, Sinorhizobium sp. ArgA, Rhodoferax ferrireducens PA4907, P. aeruginosa PAO1 ORF3, Agrobacterium vitis SanC, S. ansochromogenes SanB, S....”

PP_4862 oxidoreductase, short chain dehydrogenase/reductase family from Pseudomonas putida KT2440
80% identity, 99% coverage

• Genome-scale metabolic network model and phenome of solvent-tolerant Pseudomonas putida S12
  Han, BMC genomics 2024
  • “...gene (PP_3959) was absent in S12. Four other genes in KT2440 (PP_0321, PP_0527, PP_1995, and PP_4862) corresponded to the S12 genes, whose associated reactions could be carried out by alternative reactions in S12. The metabolic reactions related to the remaining eight genes are associated with several...”

VK055_1961 SDR family NAD(P)-dependent oxidoreductase from Klebsiella pneumoniae subsp. pneumoniae
62% identity, 99% coverage

• A Serendipitous Mutation Reveals the Severe Virulence Defect of a Klebsiella pneumoniae fepB Mutant
  Palacios, mSphere 2017
  • “...ABC transporter, permease VK055_1963 ABC-type amino acid transport system, permease VK055_1962 ABC transporter family protein VK055_1961 Serine 3-dehydrogenase VK055_1960 Aminotransferase class III family protein smr_B mutant VK055_1959 ABC transporter family protein VK055_1958 ABC transporter family protein VK055_1957 Oligopeptide transport permease family protein VK055_1956 Binding protein-dependent transport...”

isfD / D3U1D9 sulfoacetaldehyde reductase (NADPH) (EC 1.1.1.313) from Klebsiella oxytoca (see 2 papers)
ISFD_KLEOX / D3U1D9 Sulfoacetaldehyde reductase; Isethionate formation reductase; EC 1.1.1.313 from Klebsiella oxytoca (see 2 papers)
D3U1D9 sulfoacetaldehyde reductase (EC 1.1.1.313) from Klebsiella oxytoca (see 2 papers)
61% identity, 99% coverage

• function: Catalyzes the formation of isethionate from 2- sulfoacetaldehyde in the deaminative pathway of taurine. The enzyme is specific for NADPH; NADH is not a substrate.
  catalytic activity: 2-hydroxyethane-1-sulfonate + NADP(+) = sulfoacetaldehyde + NADPH + H(+) (RHEA:29591)
  subunit: Homodimer and heterotetramer.

6ixjA / D3U1D9 The crystal structure of sulfoacetaldehyde reductase from klebsiella oxytoca (see paper)
61% identity, 99% coverage

• Ligands: nadph dihydro-nicotinamide-adenine-dinucleotide phosphate; 2-hydroxyethylsulfonic acid (6ixjA)

ISFD2_CHRSD / Q1QU27 Sulfoacetaldehyde reductase 2; Isethionate formation reductase 2; EC 1.1.1.313 from Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) (see paper)
63% identity, 100% coverage

• function: Catalyzes the formation of isethionate from 2- sulfoacetaldehyde in the deaminative pathway of taurine. Constitutively expressed enzyme that only mediates a small part of the activity observed in taurine-grown cells.
  catalytic activity: 2-hydroxyethane-1-sulfonate + NADP(+) = sulfoacetaldehyde + NADPH + H(+) (RHEA:29591)
  subunit: Homodimer and heterotetramer.

isfD / Q1R183 sulfoacetaldehyde reductase monomer (EC 1.1.1.313) from Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) (see paper)
ISFD_CHRSD / Q1R183 Sulfoacetaldehyde reductase; Isethionate formation reductase; EC 1.1.1.313 from Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) (see paper)
Q1R183 sulfoacetaldehyde reductase (EC 1.1.1.313) from Chromohalobacter salexigens (see paper)
Csal_0161 short-chain dehydrogenase/reductase SDR from Chromohalobacter salexigens DSM 3043
60% identity, 100% coverage

• function: Catalyzes the formation of isethionate from 2- sulfoacetaldehyde in the deaminative pathway of taurine. The enzyme is specific for NADPH; NADH is not a substrate. Responsible for most of the activity observed in taurine-grown cells.
  catalytic activity: 2-hydroxyethane-1-sulfonate + NADP(+) = sulfoacetaldehyde + NADPH + H(+) (RHEA:29591)
  subunit: Homodimer and heterotetramer.
• Isethionate formation from taurine in Chromohalobacter salexigens: purification of sulfoacetaldehyde reductase
  Krejčík, Microbiology (Reading, England) 2010 (PubMed)
  • “...by peptide-mass fingerprinting as the gene product of Csal_0161. The putative exporter of isethionate (IsfE) is encoded by Csal_0160; isfE was inducibly...”
  • “...the activity from fraction 34 was attributed to IsfD (Csal_0161) (91 % coverage of deduced sequence), and (iii) the enzyme(s) in fractions 38 and 40 contained...”

YPTB2195 probable oxidoreductase in dcp-nohA intergenic region from Yersinia pseudotuberculosis IP 32953
56% identity, 98% coverage

• Characterization of chromosomal regions conserved in Yersinia pseudotuberculosis and lost by Yersinia pestis
  Pouillot, Infection and immunity 2008
  • “...proteins involved in diverse pathways: an oxidoreductase (YPTB2195), an aldehyde dehydrogenase (YPTB2197), and an aminotransferase (YPTB2200). The last gene...”

Q8U8I2 Serine 3-dehydrogenase from Agrobacterium fabrum (strain C58 / ATCC 33970)
57% identity, 100% coverage

• The METTL20 Homologue from Agrobacterium tumefaciens Is a Dual Specificity Protein-lysine Methyltransferase That Targets Ribosomal Protein L7/L12 and the β Subunit of Electron Transfer Flavoprotein (ETFβ)
  Małecki, The Journal of biological chemistry 2016
  • “...name Accession number A9CFF1 Q8U9K1 A9CGA0 A9CLE5 A9CJ20 Q8U8I2 Q7CU78 A9CFM8 Q7CV16 H0HGF5 TABLE 2 List of proteins identified in 15-kDa region of 0.15Q...”

Smlt0396 putative oxidoreductase from Stenotrophomonas maltophilia K279a
58% identity, 100% coverage

• Functional characterization of the RNA chaperone Hfq in the opportunistic human pathogen Stenotrophomonas maltophilia
  Roscetto, Journal of bacteriology 2012
  • “...upregulated in the hfq mutant Smlt0134 Smlt0347 Smlt0396 Smlt0694 Smlt0717 Smlt0833 Smlt0953 Smlt1426 Smlt1445 Smlt1476 Smlt1720 Smlt1742 Smlt2477 Smlt3003...”

ZMO0226 short-chain dehydrogenase/reductase SDR from Zymomonas mobilis subsp. mobilis ZM4
59% identity, 99% coverage

• Genome-Scale Transcription-Translation Mapping Reveals Features of Zymomonas mobilis Transcription Units and Promoters
  Vera, mSystems 2020
  • “...TSS_2169 980442 105 ZMO0963 TetR family transcriptional regulator 655 821 703 TSS_0437 220931 + 180 ZMO0226 sdh Short-chain dehydrogenase/reductase 1,076 1,106 1,043 TSS_1434 617212 + 173 ZMO0619 flgA Flagellum basal body P-ring formation protein 1,331 1,215 1,564 TSS_1798 783747 0 ZMO0784 gatC Glutamyl-tRNA(Gln) amidotransferase C subunit...”
• Towards an informative mutant phenotype for every bacterial gene
  Deutschbauer, Journal of bacteriology 2014
  • “...a specific example. Mutations in the dehydrogenase ZMO0226 have reduced fitness in three experiments with different concentrations of the uncoupling agent...”
  • “...for five different strains with transposon insertions in ZMO0226). The lowest P value from any single experiment was 0.0071, but after correcting for multiple...”

SDH_RHIRD / Q9KWN1 Serine 3-dehydrogenase; EC 1.1.1.276 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
56% identity, 100% coverage

• function: Catalyzes the oxidation of the hydroxyl group of serine to form 2-aminomalonate semialdehyde which is spontaneously converted into 2-aminoacetaldehyde and CO(2). Also acts on D-serine, L-glycerate, D- glycerate and 2-methyl-DL-serine. Does not act on O-methyl-DL-serine and L-threonine.
  catalytic activity: L-serine + NADP(+) = aminoacetaldehyde + CO2 + NADPH (RHEA:43620)
  subunit: Homotetramer.

plu2233 No description from Photorhabdus luminescens subsp. laumondii TTO1
54% identity, 98% coverage

• Lumiquinone A, an α-Aminomalonate-Derived Aminobenzoquinone from Photorhabdus luminescens
  Park, Journal of natural products 2015
  • “...homologues of the E. coli serine dehydrogenase 27 and tentatively identified P. luminescens serine dehydrogenase Plu2233 (global alignment: identity/similarity/gap, 73.5/83.5/0.4%) clustered directly next to the phenylalanine ammonia lyase (StlA, Plu2234), which converts phenylalanine to cinnamate, initiating stilbene biosynthesis. Oxidation of -aminomalonate semialdehyde to -aminomalonate and subsequent...”

CFF8240_0977 NADP-dependent l-serine/l-allo-threonine dehydrogenase ydfg from Campylobacter fetus subsp. fetus 82-40
52% identity, 100% coverage

• Phylogenomic Analysis of Campylobacter fetus Reveals a Clonal Structure of Insertion Element ISCfe1 Positive Genomes
  Abdel-Glil, Frontiers in microbiology 2020
  • “...S S 654050 CFF8240_0641 ABK82108.1 507 Hit family protein A G non-synonymous I V 979346 CFF8240_0977 ABK82797.1 747 NADP-dependent l-serine/l-allo-threonine dehydrogenase ydfg C T non-synonymous C Y 1020607 CFF8240_1016 ABK82995.1 879 phosphatase, Ppx/GppA family A C non-synonymous D E 1025195 CFF8240_1023 ABK83085.1 615 translocator protein, LysE...”

BPSL2759 putative short-chain dehydrogenase from Burkholderia pseudomallei K96243
56% identity, 98% coverage

• Burkholderia pseudomallei transcriptional adaptation in macrophages
  Chieng, BMC genomics 2012
  • “...15.76 BPSL1817 Putative lipoprotein 30.07 14.11 12.67 11.33 BPSL1902 Hypothetical protein 37.91 18.81 12.46 8.39 BPSL2759 Putative short-chain dehydrogenase 16.54 8.31 5.93 5.61 BPSL2945 Allantoicase 27.90 9.57 8.83 7.41 BPSL3354 Putative cytochrome 18.66 11.70 8.64 7.62 BPSS0140 Sugar ABC transport system, lipoprotein 7.80 16.62 13.56 13.94...”

SEET0819_14220 bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG from Salmonella enterica subsp. enterica serovar Tennessee str.
54% identity, 98% coverage

• Whole Genome DNA Sequence Analysis of Salmonella subspecies enterica serotype Tennessee obtained from related peanut butter foodborne outbreaks
  Wilson, PloS one 2016
  • “...A->G 2926925 CP007505 coding SEET0819_13915 214 TAC->CAC Y->H N - glutathione S-transferase 2990295 CP007505 coding SEET0819_14220 633 GAC->GAA D->E N - malonic semialdehyde reductase 3062233 CP007505 coding SEET0819_14570 559 ACG->GCG T->A N + TetR family transcriptional regulator 3141458 CP007505 coding SEET0819_14930 1564 GTG->TTG V->L N -...”

c1965 Probable oxidoreductase ydfG from Escherichia coli CFT073
52% identity, 98% coverage

• Time resolution in cryo-EM using a PDMS-based microfluidic chip assembly and its application to the study of HflX-mediated ribosome recycling
  Bhattacharjee, Cell 2024 (secret)

PMI1288 NADP-dependent L-serine/L-allo-threonine dehydrogenase from Proteus mirabilis HI4320
53% identity, 98% coverage

• Anaerobic choline metabolism in microcompartments promotes growth and swarming of Proteus mirabilis
  Jameson, Environmental microbiology 2016
  • “...protein PMI3109 fdoH 1.6200982 0.001691 Formate dehydrogenaseO subunit beta, transmembrane PMI0297 1.7078902 0.001728 Fimbrial subunit PMI1288 ydfG 1.7860287 0.001896 NADPdependent Lserine/Lallothreonine dehydrogenase PMI1955 eco 1.6974899 0.002404 Protease inhibitor ecotin; homodimeric protease inhibitor BMC, bacterial microcompartment; NADP, nicotinamide adenine dinucleotide phosphate. 2015 Society for Applied Microbiology and...”

YdfG / b1539 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) from Escherichia coli K-12 substr. MG1655 (see 7 papers)
ydfG / P39831 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) from Escherichia coli (strain K12) (see 6 papers)
YDFG_ECOLI / P39831 NADP-dependent 3-hydroxy acid dehydrogenase YdfG; L-allo-threonine dehydrogenase; Malonic semialdehyde reductase; EC 1.1.1.381; EC 1.1.1.298 from Escherichia coli (strain K12) (see 2 papers)
P39831 3-hydroxy acid dehydrogenase (EC 1.1.1.381) from Escherichia coli (see paper)
3asvA The closed form of serine dehydrogenase complexed with NADP+ (see paper)
NP_416057 3-hydroxy acid dehydrogenase YdfG from Escherichia coli str. K-12 substr. MG1655
b1539 L-allo-threonine dehydrogenase, NAD(P)-binding from Escherichia coli str. K-12 substr. MG1655
52% identity, 98% coverage

• function: NADP-dependent dehydrogenase with broad substrate specificity acting on 3-hydroxy acids. Catalyzes the NADP-dependent oxidation of L- allo-threonine to L-2-amino-3-keto-butyrate, which is spontaneously decarboxylated into aminoacetone. Also acts on D-threonine, L-serine, D-serine, D-3-hydroxyisobutyrate, L-3-hydroxyisobutyrate, D-glycerate and L-glycerate (PubMed:12535615). Able to catalyze the reduction of the malonic semialdehyde to 3-hydroxypropionic acid. YdfG is apparently supplementing RutE, the presumed malonic semialdehyde reductase involved in pyrimidine degradation since both are able to detoxify malonic semialdehyde (PubMed:20400551).
  catalytic activity: 3-hydroxypropanoate + NADP(+) = 3-oxopropanoate + NADPH + H(+) (RHEA:26438)
  catalytic activity: L-allo-threonine + NADP(+) = aminoacetone + CO2 + NADPH (RHEA:43524)
  subunit: Homotetramer.
  disruption phenotype: Cells lacking this gene grow poorly on pyrimidine nucleosides and bases as the sole source of nitrogen at room temperature indicating a probably accumulation of a toxic intermediate, the malonic semialdehyde.
• Ligands: nadp nicotinamide-adenine-dinucleotide phosphate; phosphate ion (3asvA)
• Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.
  Link, Electrophoresis 1997 (PubMed)
  • GeneRIF: N-terminus verified by Edman degradation on complete protein
• The mycolic acid reductase Rv2509 has distinct structural motifs and is essential for growth in slow-growing mycobacteria
  Javid, Molecular microbiology 2020
  • “...PDB database to find structural templates for homology modelling. The serine dehydrogenase YdfG (UniProt ID P39831; PDB ID 3ASU/3ASV) (Yamazawa, Nakajima, Mushiake, Yoshimoto, & Ito, 2011 ) had the highest identity score; however, structural analysis revealed several gaps in the pairwise alignment and the Cterminal region...”
• A workflow for annotating the knowledge gaps in metabolic reconstructions using known and hypothetical reactions
  Vayena, Proceedings of the National Academy of Sciences of the United States of America 2022
  • “...iML1515 network, BridgIT suggests it can also encode for phosphotransferases (EC 2.7.4.-), and though ydfG (b1539) acts as dehydrogenase (EC 1.1.1.-) in the iML1515 network, BridgIT suggests it can also act as a carbon-carbon lyase (EC 4.1.1.-, 4.1.2.-). Nine of these 33 genes already show substrate...”
• 18th Congress of the European Hematology Association, Stockholm, Sweden, June 13–16, 2013
  , Haematologica 2013

HI1430 short chain dehydrogenase/reductase from Haemophilus influenzae Rd KW20
51% identity, 100% coverage

• Identification of a siderophore utilization locus in nontypeable Haemophilus influenzae
  Morton, BMC microbiology 2010
  • “...No No No No No HI1429 (nt) BLD 93 IV No No No No No HI1430 (nt) BLD 94 IV No No No No No HI1378 (nt) EAR 31 V No No No No No HI1379 (nt) EAR 32 V No No No No No HI1388...”

ETAE_1724 short-chain alcohol dehydrogenase of unknown specificity from Edwardsiella tarda EIB202
53% identity, 98% coverage

• Genome sequence of the versatile fish pathogen Edwardsiella tarda provides insights into its adaptation to broad host ranges and intracellular niches
  Wang, PloS one 2009
  • “...gapA Glyceraldehyde-3-phosphate dehydrogenase ETAE_1508 adhE Aldehyde-alcohol dehydrogenase ETAE_1549 Short chain dehydrogenase ETAE_1658 putA Proline dehydrogenase ETAE_1724 Short-chain alcohol dehydrogenase of unknown specificity ETAE_1753 Short-chain dehydrogenase/reductase ETAE_1771 ldhA D-lactate dehydrogenase ETAE_1899 kduD 2-Deoxy-D-gluconate 3-dehydrogenase ETAE_1922 3-Hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases ETAE_2050 Isocitrate dehydrogenase, specific for NADP+...”

NGO1079 putative oxidoreductase from Neisseria gonorrhoeae FA 1090
51% identity, 90% coverage

• Current and Future Technologies for the Detection of Antibiotic-Resistant Bacteria
  Yamin, Diagnostics (Basel, Switzerland) 2023
  • “...distance and the population structure. When exposed to drugs, transcripts for rpsO, rplN, omp3, and NGO1079 exhibited the most significant changes between phenotypes [ 113 ]. The expression of almost half of the genes involved in multidrug resistance in Salmonella enterica serovar Typhimurium was altered after...”
• Antimicrobial Resistance Profile by Metagenomic and Metatranscriptomic Approach in Clinical Practice: Opportunity and Challenge
  Waskito, Antibiotics (Basel, Switzerland) 2022
  • “...population structure affect the transcriptional response to azithromycin with four transcripts (rpsO, rplN, omp3, and NGO1079) that were the most significantly regulated between phenotypes with drug exposure [ 64 ]. Another study describing multidrug resistance of Salmonella enterica serovar typhimurium showed an alteration in the expression...”
• Bridging the gap between development of point-of-care nucleic acid testing and patient care for sexually transmitted infections
  Hsieh, Lab on a chip 2022
  • “...and led to four candidate diagnostic transcripts ( rpsO , rplN , omp3 , and NGO1079) that categorically predicted resistance in 19/20 cases upon 60-min azithromycin exposure. These results point to the usefulness of employing a phylogenetically diverse panel of NG for the development of pheno-molecular...”
• Impact of Species Diversity on the Design of RNA-Based Diagnostics for Antibiotic Resistance in Neisseria gonorrhoeae
  Wadsworth, Antimicrobial agents and chemotherapy 2019
  • “...candidate diagnostic transcripts (rpsO, rplN, omp3, and NGO1079) that were the most significantly differentially regulated between phenotypes across drug...”
  • “...60-minute azithromycin exposure treatments for four markers (rpsO, NGO1079, omp3, and rplN) using the 2-CT method (30, 31), normalizing to an empirically...”
• Impact of population structure in the design of RNA-based diagnostics for antibiotic resistance in Neisseria gonorrhoeae
  Wadsworth, 2019
• MpeR regulates the mtr efflux locus in Neisseria gonorrhoeae and modulates antimicrobial resistance by an iron-responsive mechanism
  Mercante, Antimicrobial agents and chemotherapy 2012
  • “...NGO0606 NGO0694 NGO0820 NGO0876 NGO0958 NGO1058 NGO1059 NGO1079 NGO1406 NGO1488 NGO1810 NGO2132 NGO2167 NGO0221 NGO0527 NGO0567 NGO0606 NGO0694 mesJ NGO0876 rph...”

DJ41_1604, KZA74_05010 SDR family oxidoreductase from Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841
52% identity, 94% coverage

• DNA damage response coregulator <i>ddrR</i> affects many cellular pathways and processes in <i>Acinetobacter baumannii</i> 17978
  Cook, Frontiers in cellular and infection microbiology 2023
  • “...NSC KZA74_04205 NSC NSC 8 A1S_2629/KZA74_04435 NSC NSC KZA74_04435 NSC NSC 9 A1S_2514/KZA74_05010 NSC NSC KZA74_05010 NSC NSC 10 A1S_2510/KZA74_05040 NSC R KZA74_05040 NSC R 11 A1S_2459/KZA74_05305 NSC NSC KZA74_05305 NSC NSC 12 A1S_2458/KZA74_05310 NSC NSC KZA74_05310 NSC NSC 13 A1S_2354/KZA74_05795 NSC NSC KZA74_05795 NSC NSC...”
• Role of Iron-Containing Alcohol Dehydrogenases in Acinetobacter baumannii ATCC 19606 Stress Resistance and Virulence
  Lin, International journal of molecular sciences 2021
  • “...iron-containing ADHs were respectively encoded by DJ41_189 (ADH3; 1,158 bp), DJ41_136 (ADH4; 1,173 bp), and DJ41_1604 (ADH6; 1,185 bp). Interestingly, the number of annotated Adh genes is relatively low in terms of the genome size of A. baumannii (genome size 3.97 Mb, 7 Adh genes annotated...”

gbs1158 unknown from Streptococcus agalactiae NEM316
49% identity, 98% coverage

• A naturally occurring gene amplification leading to sulfonamide and trimethoprim resistance in Streptococcus agalactiae
  Brochet, Journal of bacteriology 2008
  • “...78 are clustered on the NEM316 genome from gbs1033 to gbs1158. The average ratio of 2.3 for these 78 genes (Fig. 1) suggested a duplication of this chromosomal...”
  • “...to gbs1185 in strain CCH290 and gbs1033 to gbs1158 in strain NEM969. DNA segment duplications in bacteria frequently correspond to tandem duplications involving...”

CJJ81176_0850 oxidoreductase, short chain dehydrogenase/reductase family from Campylobacter jejuni subsp. jejuni 81-176
48% identity, 99% coverage

• FliW controls growth-phase expression of Campylobacter jejuni flagellar and non-flagellar proteins via the post-transcriptional regulator CsrA
  Li, Microbiology (Reading, England) 2018 (secret)

Cj0833c oxidoreductase from Campylobacter jejuni subsp. jejuni NCTC 11168
48% identity, 99% coverage

• Whole genome sequencing reveals extended natural transformation in Campylobacter impacting diagnostics and the pathogens adaptive potential
  Golz, Scientific reports 2020
  • “...encode proteins involved in oxidative stress response ( katA , Cj1386, mrsB , canB , Cj0833c hydA , hydA2 , nadD , nuoA , nuoB , nuoC , Cj0081), stress response in general ( clpA , htrB , htrA , cpn10 , cpn60 ), DNA metabolism...”
  • “...an enzyme important for growth at low CO 2 concentrations 36 . A further oxidoreductase (Cj0833c) and genes encoding for the Ni/Fe hydrogenase small subunit hydA (Cj1267c) and hydA 2 (Cj1399c) as well as nadD (Cj1404) involved in the synthesis of the redox cofactor NAD+were found...”
• The CJIE1 prophage of Campylobacter jejuni affects protein expression in growth media with and without bile salts
  Clark, BMC microbiology 2014
  • “...2.430.31 2.670.58 Acetate kinase AckA gi|384443065 Cj0689 Acetate metabolism, regulation 0.330.64 3.370.25 2.701.00 Oxidoreductase gi|218562461 Cj0833c Oxidoreductase 0.100.10 0.961.76 1.100.95 Ankyrin repeat-containing periplasmic protein gi|218562462 Cj0834c Mediates protein-protein interactions 0.670.25 1.202.42 1.601.05 Amino acid ABC transporter, ATP-binding protein PEB1 gi|121612723 Cj0922c Amino-acid ABC transporter 0.770.21 0.630.68...”
• Campylobacter jejuni gene expression in the chick cecum: evidence for adaptation to a low-oxygen environment
  Woodall, Infection and immunity 2005
  • “...0.05 9.06 106 6.83 104 3.25 103 9.77 104 Cj0833c Probable oxidoreductase 4.83 6.92 107 Cj0437 Cj0438 Cj0439 Cj0409 Cj0410 Cj1487c Cj1488c Cj1489c Cj1490c Cj0780...”
  • “...serine dehydratase, sdaA (Cj1624c), and the putative oxidoreductase Cj0833c, which suggests C. jejuni can utilize serine in vivo. SdaA catalyses the deamination...”

HP0357 short chain alcohol dehydrogenase from Helicobacter pylori 26695
49% identity, 98% coverage

• Riboregulation in the Major Gastric Pathogen Helicobacter pylori
  Tejada-Arranz, Frontiers in microbiology 2021
  • “...asRNA Hp1116 Sharma et al. (2010) HPnc2450 asRNA Hp0513 Sharma et al. (2010) HPnc1470 asRNA Hp0357 Sharma et al. (2010) HPnc7450 asRNA HPr06 Sharma et al. (2010) HPnc3320 asRNA Hp0660 Sharma et al. (2010) HPnc1810 asRNA Hp0423 Sharma et al. (2010) HPnc7520 asRNA Hp1412 Sharma et...”
• New implications on genomic adaptation derived from the Helicobacter pylori genome comparison
  Lara-Ramírez, PloS one 2011
  • “...protein (Omp27) HP1502 Conserved hypothetical integral membrane protein metabolic proteins HP0208 Lipopolysaccharide 1,2-glycosyltransferase HP0211 HcpA HP0357 Short chain alcohol dehydrogenase HP0407 Biotin sulfoxide reductase (BisC) HP0473 Molybdenum ABC transporter, periplasmic molybdate-binding protein (ModA) HP0475 Molybdenum ABC transporter, ATP-binding protein (ModC) HP0798 Co-factor de molibdeno en la...”
  • “...macrophages. Thus, HcpA is a bacterial immune modulator on the process of infection [54] . HP0357 is a short chain alcohol dehydrogenase. H. acinonychis has not the homologous sequence but in H. pylori it is a conserved protein with 250253 aa. This protein has two domains,...”
• Acid-adaptive genes of Helicobacter pylori
  Wen, Infection and immunity 2003
  • “...1.27 2.78 2.65 3.09 2.95 2.59 2.63 2.58 HP0194 HP0277 HP0357 HP0588 HP0589 HP0590 HP0591 0.96 0.85 0.90 1.11 1.06 1.01 1.23 1.05 2.22 1.55 3.52 1.64 6.74 4.84...”
• Metabolism and genetics of Helicobacter pylori: the genome era
  Marais, Microbiology and molecular biology reviews : MMBR 1999
  • “...Tomb et al. (280) found ORFs HP1222 and HP0357 with similarities to the H. influenzae genes encoding D-lactate dehydrogenase, necessary to convert pyruvate to...”
  • “...orthologous gene was found in H. pylori DNA. The HP0357 ORF has similarity to the gene encoding alcohol dehydrogenase, which may produce acetaldehyde in an...”

APA386B_2052 SDR family NAD(P)-dependent oxidoreductase from Acetobacter pasteurianus 386B
49% identity, 97% coverage

• Complete genome sequence and comparative analysis of Acetobacter pasteurianus 386B, a strain well-adapted to the cocoa bean fermentation ecosystem
  Illeghems, BMC genomics 2013
  • “...and terminal oxidases : (6) uncharacterized oxidoreductases [APA386B_1815 (transmembrane region: 133153), APA386B_1888 (transmembrane region: 307329), APA386B_2052 (transmembrane region: 931), APA386B_767 (transmembrane region: 36102), APA386B_1507 (transmembrane region: 168188), and APA386B_2362 (transmembrane regions: 164184, 222242)]; (7) succinate dehydrogenase/fumarate reductase (APA386B_1513 - APA386B_1516); (8) cytochrome bo 3 ubiquinol oxidase...”

all0475 probable short-chain dehydrogenase from Nostoc sp. PCC 7120
48% identity, 98% coverage

• Transcription and regulation of the bidirectional hydrogenase in the cyanobacterium Nostoc sp. strain PCC 7120
  Sjöholm, Applied and environmental microbiology 2007
  • “...GGTATCGTTGTACT AGAATTAGTGTACC AGTATTATTGTTCC GTATCCAAGTTCC AGTATATCTGTTCT all0475 alr1044 alr1095 alr2780 all2951 all5215 all3735 all3272 528 472 687...”

PP0488, PP_0488 oxidoreductase, short chain dehydrogenase/reductase family from Pseudomonas putida KT2440
47% identity, 98% coverage

• Systems biology of electrogenic Pseudomonas putida - multi-omics insights and metabolic engineering for enhanced 2-ketogluconate production
  Weimer, Microbial cell factories 2024
  • “...P. putida KT2440 genome. Possible alternative sources of acetaldehyde include threonine (degradation via ltaE and PP_0488) and phospholipid phosphatidylethanolamine (degradation via eutB and eutC ) (Fig. 8 B). Threonine degradation was transcriptionally upregulated (log2 fold change 1.0 for ltaE and 2.6 for PP_0488), likely activated as...”
• UEG Week 2024 Poster Presentations
  , United European gastroenterology journal 2024
• UEG Week 2023 Poster Presentations
  , United European gastroenterology journal 2023
• Redundancy of enzymes for formaldehyde detoxification in Pseudomonas putida
  Roca, Journal of bacteriology 2009
  • “...assays showed that PP0489 was not transcribed with PP0488, whereas the last gene (PP0492) was transcribed with the 3-adjacent ORFs, PP0493 and PP0494, which...”

PGN_0711 putative oxidoreductase short chain dehydrogenase/reductase family from Porphyromonas gingivalis ATCC 33277
48% identity, 97% coverage

• Porphyromonas gingivalis Tyrosine Kinase Is a Fitness Determinant in Polymicrobial Infections
  Perpich, Infection and immunity 2022 (secret)

PG0676 oxidoreductase, short chain dehydrogenase/reductase family from Porphyromonas gingivalis W83
48% identity, 97% coverage

• VimA-dependent modulation of acetyl coenzyme A levels and lipid A biosynthesis can alter virulence in Porphyromonas gingivalis
  Aruni, Infection and immunity 2012
  • “...dehydrogenase/ reductase family oxidoreductase, PG0676 Glycosyltransferase, PG1346 Conserved hypothetical protein/protein kinase, PG1348 Peptidyl-prolyl...”

CBU_1513 oxidoreductase, short chain dehydrogenase/reductase family from Coxiella burnetii RSA 493
Q83BJ5 Short chain dehydrogenase from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
41% identity, 93% coverage

• Evaluation of a Human T Cell-Targeted Multi-Epitope Vaccine for Q Fever in Animal Models of Coxiella burnetii Immunity
  Sluder, Frontiers in immunology 2022
  • “...CBU_1835 Q83AP6 protoporphyrinogen oxidase 20 30 p17 KIPVKIIKPPFVRRG CBU_1716 Q83B06 gcvT 28 30 *p18 QGHIINIGSISSHQV CBU_1513 Q83BJ5 short chain dehydrogenase 14 17 p19 EAVYKGFTPLKAEDIAEA CBU_1513 Q83BJ5 short chain dehydrogenase 20 26 *p20 AQPIIHRLSTGQNTNP CBU_1416 Q83BT6 repressor protein C2 9 4 *p21 IARYFMVNISQLIGEE CBU_1416 Q83BT6 repressor protein...”
• Coxiella burnetii Epitope-Specific T-Cell Responses in Patients with Chronic Q Fever
  Scholzen, Infection and immunity 2019 (secret)
• Promiscuous Coxiella burnetii CD4 Epitope Clusters Associated With Human Recall Responses Are Candidates for a Novel T-Cell Targeted Multi-Epitope Q Fever Vaccine
  Scholzen, Frontiers in immunology 2019
  • “...DRB1*1301, DRB1*1501 p17 KIPVKIIKPPFVRRG CBU_1716 Q83B06 gcvT DRB1*0101, DRB1*0401, DRB1*0701, DRB1*1101, DRB1*1301, DRB1*1501 p18 QGHIINIGSISSHQV CBU_1513 Q83BJ5 short chain dehydrogenase DRB1*0101, DRB1*0401, DRB1*0701, DRB1*1101, DRB1*1301, DRB1*1501 p19 EAVYKGFTPLKAEDIAEA CBU_1513 Q83BJ5 short chain dehydrogenase DRB1*0101, DRB1*0401, DRB1*0701, DRB1*0801, DRB1*1101, DRB1*1301, DRB1*1501 p20 AQPIIHRLSTGQNTNP CBU_1416 Q83BT6 repressor protein...”
• Proteomics paves the way for Q fever diagnostics
  Kowalczewska, Genome medicine 2011
  • “...Markers of Q fever (general) SP: CBU_1910, CBU_0891, CBU_0109, CBU_1143, CBU_0612, CBU_0092, CBU_0545, CBU_1398, CBU_0630, CBU_1513, CBU_1719, CBU_0229, CBU_0653 [ 69 ] Candidate RPs for Q fever vaccine development and serodiagnosis ELISA (HS), ELISPOT (AS) 11 RPs, Cb NM RSA493 I HS Q-fever (IFA-positive, convalescent), HS...”
• Evaluation of a Human T Cell-Targeted Multi-Epitope Vaccine for Q Fever in Animal Models of Coxiella burnetii Immunity
  Sluder, Frontiers in immunology 2022
  • “...Q83AP6 protoporphyrinogen oxidase 20 30 p17 KIPVKIIKPPFVRRG CBU_1716 Q83B06 gcvT 28 30 *p18 QGHIINIGSISSHQV CBU_1513 Q83BJ5 short chain dehydrogenase 14 17 p19 EAVYKGFTPLKAEDIAEA CBU_1513 Q83BJ5 short chain dehydrogenase 20 26 *p20 AQPIIHRLSTGQNTNP CBU_1416 Q83BT6 repressor protein C2 9 4 *p21 IARYFMVNISQLIGEE CBU_1416 Q83BT6 repressor protein C2...”
• Promiscuous Coxiella burnetii CD4 Epitope Clusters Associated With Human Recall Responses Are Candidates for a Novel T-Cell Targeted Multi-Epitope Q Fever Vaccine
  Scholzen, Frontiers in immunology 2019
  • “...DRB1*1501 p17 KIPVKIIKPPFVRRG CBU_1716 Q83B06 gcvT DRB1*0101, DRB1*0401, DRB1*0701, DRB1*1101, DRB1*1301, DRB1*1501 p18 QGHIINIGSISSHQV CBU_1513 Q83BJ5 short chain dehydrogenase DRB1*0101, DRB1*0401, DRB1*0701, DRB1*1101, DRB1*1301, DRB1*1501 p19 EAVYKGFTPLKAEDIAEA CBU_1513 Q83BJ5 short chain dehydrogenase DRB1*0101, DRB1*0401, DRB1*0701, DRB1*0801, DRB1*1101, DRB1*1301, DRB1*1501 p20 AQPIIHRLSTGQNTNP CBU_1416 Q83BT6 repressor protein C2...”

PtVFX2014_13425 SDR family NAD(P)-dependent oxidoreductase from Legionella pneumophila
42% identity, 95% coverage

• A Search for Novel Legionella pneumophila Effector Proteins Reveals a Strain Specific Nucleotropic Effector
  Monteiro, Frontiers in cellular and infection microbiology 2022
  • “...in Predotar and EffectiveELD, respectively. Of these 25 candidates, only four (PtVFX2014_03805, PtVFX2014_06065, PtVFX2014_12350 and PtVFX2014_13425) have not previously been described as putative effectors in literature after cross-checking against a custom database of the repertoire of known Dot/Icm substrates in Pt/VFX2014 strain (summarized in Supplementary Table2...”
  • “...the T4SS substrated lpg2999 and lpg3000 ). In summary, eight candidate proteins (PtVFX2014_03805, PtVFX2014_06065, PtVFX2014_12350, PtVFX2014_13425, PtVFX2014_05045 [GenBank KZX34370.1], PtVFX2014_05055, PtVFX2014_09510 and PtVFX2014_10045 [GenBank KZX33632.1]) were selected to proceed to experimental assays. For the sake of simplicity, the prefix of GenBank locus tags PtVFX2014_ is referred...”

XP_001689640 uncharacterized protein from Chlamydomonas reinhardtii
43% identity, 95% coverage

• Discovery of nuclear-encoded genes for the neurotoxin saxitoxin in dinoflagellates
  Stüken, PloS one 2011
  • “...91/4e 34 none sxtU A. fundyense 33 83/2e 16 predicted protein [ Chlamydomonas reinhardtii ] XP_001689640 Eukaryota; Viridiplantae 214/4e 54 107/8e 22 A. minutum 27 84/2e 16 hypothetical protein [ Schizophyllum commune H4-8] XP_003034688 Eukaryota; Fungi 116/1e 24 797/2e 13 Given are: the number of contigs...”

YI13_SCHPO / Q9P7B4 NADP-dependent 3-hydroxy acid dehydrogenase; L-allo-threonine dehydrogenase; EC 1.1.1.381 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
SPAC521.03 short chain dehydrogenase (predicted) from Schizosaccharomyces pombe
40% identity, 97% coverage

• function: NADP-dependent dehydrogenase with broad substrate specificity acting on 3-hydroxy acids. Catalyzes the NADP-dependent oxidation of L- allo-threonine to L-2-amino-3-keto-butyrate, which is spontaneously decarboxylated into aminoacetone. Also acts on D-threonine, L-serine, D-serine, D-3-hydroxyisobutyrate, L-3-hydroxyisobutyrate, D-glycerate and L-glycerate.
  catalytic activity: L-allo-threonine + NADP(+) = aminoacetone + CO2 + NADPH (RHEA:43524)
  subunit: Homotetramer.
• Factors governing the transcriptome changes and chronological lifespan of fission yeast during phosphate starvation
  Garg, The Journal of biological chemistry 2024
  • “...cells by RNA-seq, only four SPAC1039.02 (up 17-fold), urg2 (up 16-fold), urg1 (up 14-fold), and SPAC521.03 (up 8-fold)had been flagged as upregulated in the earlier microarray analyses of phosphate-replete pho7 cells by Carter-OConnell etal . ( 2 ). It is noteworthy that our RNA-seq analysis showed...”
  • “...to ePMGT+PO 4 as follows: SPAC1039.02 (up 8-fold), urg2 (up 20-fold), urg1 (up 32-fold), and SPAC521.03 (up 4-fold). Indeed, a total of 30 of the mRNAs that were upregulated in phosphate-replete pho7 cells were also upregulated during the shift of WT cells from YES to ePMGT+PO...”
• Systematic screen for mutants resistant to TORC1 inhibition in fission yeast reveals genes involved in cellular ageing and growth
  Rallis, Biology open 2014
  • “...mutants, which may compromise lifespan. Finally, cells deleted for a short chain dehydrogenase gene ( SPAC521.03 ) showed no changes in lifespan. Although, this enzyme is also implicated in respiration, there are 13 short chain dehydrogenases in S. pombe , and the absence of phenotype could...”
• Global transcriptional responses of fission yeast to environmental stress
  Chen, Molecular biology of the cell 2003
  • “...involved in peroxisomal fatty acid betaoxidation pathway SPAC521.03 Putative short chain dehydrogenase; similar to S. cerevisiae Ymr226p SPAC26F1.04C Containing...”

SP_1909 short chain dehydrogenase/reductase family oxidoreductase from Streptococcus pneumoniae TIGR4
42% identity, 100% coverage

• Expression of the lux genes in Streptococcus pneumoniae modulates pilus expression and virulence
  Herbert, PloS one 2018
  • “...with the lux insertion some have been implicated to play a role in virulence including, SP_1909, SP_1913, SP_1923 and SP_1931 and may contribute to the reduced virulence observed in Xen35 [ 28 ]. Whether these changes affect the functionality of the protein is unknown. However, genes...”
• Intraclonal variations among Streptococcus pneumoniae isolates influence the likelihood of invasive disease in children
  Browall, The Journal of infectious diseases 2014
  • “...CP000919). In both BHN191 and JJA, the phage is located between TIGR4 genes SP_1908 and SP_1909. To further investigate the possible role of the prophages in intraclonal variation and invasive-disease potential, we next studied the presence of phages in all serotype 6B isolates by PCR and...”

SPD_RS09115 SDR family NAD(P)-dependent oxidoreductase from Streptococcus pneumoniae D39
41% identity, 100% coverage

• Streptococcus pneumoniae: a Plethora of Temperate Bacteriophages With a Role in Host Genome Rearrangement
  Martín-Galiano, Frontiers in cellular and infection microbiology 2021
  • “...event in strain SMRU1319 (arrangement D2) produced an inversion of the genes located upstream of SPD_RS09115 and downstream of SPD_RS09110 ( Table S12 ). Figure4 Sequence signatures of lytA Spn * and lytA PPH_090 * alleles. (A) Bacterial and prophage lytA genes of strains harboring PPH090...”
  • “...coding for an adenylosuccinate synthase). The purple rectangle corresponds to positions 1,712,4851,712,386 (between SPD_RS09110 and SPD_RS09115 in the D39 chromosome). For additional information see Tables S6 and S8 . At the bottom, the nucleotide sequence surrounding the initiation codon of SPD_RS09110 in strains D39 and SMRU1319...”

M5005_Spy_0852 short chain dehydrogenase from Streptococcus pyogenes MGAS5005
48% identity, 75% coverage

• A genome-wide analysis of small regulatory RNAs in the human pathogen group A Streptococcus
  Perez, PloS one 2009
  • “...Adjacent to rplL and M5005_Spy_0797 L SR843321 843321 843412 91 > Adjacent to pta and M5005_Spy_0852 L SR862600 862600 862900 300 > Adjacent to an ABC transporter and nox M SR869300 869300 869600 300 > Adjacent to a glyoxalase family protein and M5005_Spy_0877 M SR914400 914400...”

SJAG_01690 NADP-dependent L-serine/L-allo-threonine dehydrogenase ydfG from Schizosaccharomyces japonicus yFS275
38% identity, 96% coverage

• Molecular and comparative genomic analyses reveal evolutionarily conserved and unique features of the Schizosaccharomyces japonicus mycelial growth and the underlying genomic changes
  Papp, Current genetics 2021
  • “...HAL protein kinase Oca2 orf19.6232 HCBG_01745 SJAG_03809 + Cdc20/Fizzy family WD repeat protein orf19.2084 HCBG_03481 SJAG_01690 + NADP-dependent L-serine/L-allo-threonine dehydrogenase ydfG orf19.4633 HCBG_04866 + SJAG_03794 + DNAJ domain-containing protein Psi1 orf19.3861 HCBG_05481 + SJAG_04185 + ZIP zinc transporter Zrt1 orf19.1585 HCBG_07321 + SJAG_01475 + SAGA complex/transcription...”

PAAG_02354 serine 3-dehydrogenase from Paracoccidioides lutzii Pb01
36% identity, 93% coverage

• Prediction of Conserved Peptides of Paracoccidioides for Interferon-γ Release Assay: The First Step in the Development of a Lab-Based Approach for Immunological Assessment during Antifungal Therapy
  Rosa, Journal of fungi (Basel, Switzerland) 2020
  • “...dehydrogenase PADG_00246 0.0 100% 98% Shock protein SSVB1 PAAG_07775 0.0 98% 100% Serine 3 dehydrogenase PAAG_02354 0.0 97% 100% Serine hydroxymethyltransferase PAAG_07412 0.0 99% 100% Sorbitol SOU2 PAAG_04184 0.0 98% 100% Succinate dehydrogenase PADG_06494 0.0 97% 100% Succinate dehydrogenase PADG_08013 0.0 100% 98% Succinyl CoA ligase...”
• Proteomic profile response of Paracoccidioides lutzii to the antifungal argentilactone
  Prado, Frontiers in microbiology 2015
  • “...acetyltransferase PAAG_03447 1578.04 * Peroxisomal 3-ketoacyl-coA thiolase PAAG_03689 1248.76 * Siderophore-iron transport Siderophore peptide synthase PAAG_02354 1582.68 * Protein fate Chaperone DnaK PAAG_01339 14261.80 1.259 Chaperonin PAAG_05142 71219.03 1.584 Chaperonin GroL PAAG_08059 36257.80 1.336 GrpE protein homolog PAAG_06255 6685.85 1.649 Glutathione S-transferase PAAG_08162 766.51 1.405 Peptidylprolyl...”
• Transcriptional and proteomic responses to carbon starvation in Paracoccidioides
  Lima, PLoS neglected tropical diseases 2014
  • “...chain base-responsive protein LSP1 * endocytosis MISCELLANEOUS PAAG_04908 NAD binding Rossmann fold oxidoreductase * oxidoreductase PAAG_02354 serine 3-dehydrogenase * serine 3-dehydrogenase activity a Identification of differentially regulated proteins from Paracoccidioides genome database ( http://www.broadinstitute.org/annotation/genome/paracoccidioides_brasiliensis/MultiHome.html ) using the ProteinLynx Global Server (PLGS) version 3.0 (Waters Corporation. Manchester....”

SJAG_01492 NADP-dependent L-serine/L-allo-threonine dehydrogenase ydfG from Schizosaccharomyces japonicus yFS275
35% identity, 96% coverage

• Molecular and comparative genomic analyses reveal evolutionarily conserved and unique features of the Schizosaccharomyces japonicus mycelial growth and the underlying genomic changes
  Papp, Current genetics 2021
  • “...HCBG_07173 + SJAG_02199 DNA replication ATPase orf19.3019 HCBG_03457 + SJAG_02615 Phenylalanyl-tRNA synthetase orf19.2039 HCBG_00956 ? SJAG_01492 NADP-dependent L-serine/L-allo-threonine dehydrogenase yd orf19.4633 HCBG_04866 + SJAG_00307 Centromere-specific histone H3 CENP-A orf19.6163 HCBG_02786 + SJAG_00799 Ribosomal protein subunit L23 orf19.3350 HCBG_01756 + SJAG_00238 Glutathione S-transferase Gst1 AOW27495 (orf19.155) +...”

Rv0484c PROBABLE SHORT-CHAIN TYPE OXIDOREDUCTASE from Mycobacterium tuberculosis H37Rv
40% identity, 95% coverage

• Rv0687 a Putative Short-Chain Dehydrogenase Is Required for In Vitro and In Vivo Survival of Mycobacterium tuberculosis
  Bhargavi, International journal of molecular sciences 2024
  • “...survival [ 23 , 24 ]. The genome of Mtb possess 23 SDRs, namely Rv0148, Rv0484c, Rv0687, Rv0851c, Rv0927c, Rv0945, Rv1144, Rv1245c, Rv1865c, Rv1882c, Rv1928c, Rv1941, Rv2214c, Rv2509, Rv2766c, Rv2857c, Rv3085, Rv3174, Rv3224, Rv3485c, Rv3502c, Rv3548c and Rv3549c (as listed in Mycobrowser) and only a few...”
• Comparative Genomic and Metagenomic Investigations of the Corynebacterium tuberculostearicum Species Complex Reveals Potential Mechanisms Underlying Associations To Skin Health and Disease
  Salamzade, Microbiology spectrum 2023
  • “...one instead of three for the coarser homolog group and featured the M. tuberculosis proteins Rv0484c, a short-chain type oxidoreductase, but not fabG1 or any fabG -homologs from M. tuberculosis . Phylogenomics of the C. tuberculostearicum species complex and the representative selection of Corynebacterium . We...”
• One-Year Old Dormant, "Non-culturable" Mycobacterium tuberculosis Preserves Significantly Diverse Protein Profile
  Trutneva, Frontiers in cellular and infection microbiology 2020
  • “...carboxykinase [GTP] PckA (phosphoenolpyruvate carboxylase) (PEPCK)(pep carboxykinase) Rv0211 130 7 Membrane Probable short-chain type oxidoreductase Rv0484c N/D 7 Membrane Possible ketoacyl reductase Rv1544 N/D 7 Membrane DNA-binding protein HU homolog HupB (histone-like protein) (HLP) (21-kDa laminin-2-binding protein) Rv2986c N/D 7 Cytosol Probable acetohydroxyacid synthase IlvX (acetolactate...”
• Function and structure of a prokaryotic formylglycine-generating enzyme
  Carlson, The Journal of biological chemistry 2008
  • “...both Rv3406 and Rv3762c were ligated into pET28b (Novagen) using NdeI and XhoI restriction sites. Rv0484c, Rv0576, Rv1730c, Rv1980c, Rv2837c, Rv3137, Rv3205c, and Rv3849 were all amplified from M. tuberculosis H37Rv genomic DNA and cloned into pET151/D-TOPO. DNA sequencing was performed to confirm the fidelity of...”

NCgl2122 SDR family NAD(P)-dependent oxidoreductase from Corynebacterium glutamicum ATCC 13032
38% identity, 94% coverage

• Engineered Corynebacterium glutamicum as the Platform for the Production of Aromatic Aldehydes
  Kim, Frontiers in bioengineering and biotechnology 2022
  • “...P57/P58 for NCgl1608 , P61/P62 and P63/P64 for NCgl 1962 , P67/P68 and P69/P70 for NCgl2122 , P73/P74 and P75/P76 for NCgl2213 , P79/P80 and P81/P82 for NCgl2277 , P85/P86 and P87/P88 for NCgl2358 , P91/P92 and P93/P94 for NCgl2382 , P97/P98 and P99/P100 for NCgl2449...”

YM71_YEAST / Q05016 NADP-dependent 3-hydroxy acid dehydrogenase; L-allo-threonine dehydrogenase; EC 1.1.1.-; EC 1.1.1.381 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
Q05016 3-hydroxy acid dehydrogenase (EC 1.1.1.381) from Saccharomyces cerevisiae (see paper)
YMR226C NADP(+)-dependent dehydrogenase; acts on serine, L-allo-threonine, and other 3-hydroxy acids; green fluorescent protein fusion protein localizes to the cytoplasm and nucleus; may interact with ribosomes, based on co-purification experiments from Saccharomyces cerevisiae
34% identity, 91% coverage

• function: NADP-dependent dehydrogenase with broad substrate specificity acting on 3-hydroxy acids. Catalyzes the NADP-dependent oxidation of L- allo-threonine to L-2-amino-3-keto-butyrate, which is spontaneously decarboxylated into aminoacetone. Also acts on D-threonine, L-serine, D-serine, D-3-hydroxyisobutyrate, L-3-hydroxyisobutyrate, D-glycerate and L-glycerate.
  catalytic activity: L-allo-threonine + NADP(+) = aminoacetone + CO2 + NADPH (RHEA:43524)
  catalytic activity: L-allo-threonine + NADP(+) = (2S)-2-amino-3-oxobutanoate + NADPH + H(+) (RHEA:30055)
  subunit: Homotetramer.
• Bio-click chemistry: a bridge between biocatalysis and click chemistry
  Rodríguez, RSC advances 2022
  • “...a recombinant carbonyl reductase from Candida magnoliae (CMCR) and an alcohol dehydrogenase from Saccharomyces cerevisiae (Ymr226c), with glucose dehydrogenase as cofactor-regeneration enzyme, for the enzymatic reduction of -azidoacetophenone. 29 Both enzymes were able to catalyze the formation of the corresponding chiral alcohol in excellent optical purities,...”
• High-yield production of (R)-acetoin in Saccharomyces cerevisiae by deleting genes for NAD(P)H-dependent ketone reductases producing meso-2,3-butanediol and 2,3-dimethylglycerate
  Bae, Metabolic engineering 2021 (PubMed)
  • “...a newly identified byproduct. Ara1, Ypr1, and Ymr226c (named Ora1) were identified as (S)-alcohol-forming reductases, which can reduce (R)-acetoin to...”
  • “...a newly identified byproduct. Ara1, Ypr1, and Ymr226c (named Ora1) were identified as (S )-alcohol-forming reductases, which can reduce (R )-acetoin...”
• Predicting enzymatic reactions with a molecular transformer
  Kreutter, Chemical science 2021
  • “...given enzyme. To illustrate this point, we considered the enzyme d -glucose dehydrogenase alcohol dehydrogenase ymr226c from Saccharomyces cerevisiae , which is documented in six reactions of the training set to reduce various acetophenones enantioselectively and correctly predicts the product structure and stereochemistry for the 2...”
• Yeast Sphingolipid Phospholipase Gene ISC1 Regulates the Spindle Checkpoint by a CDC55-Dependent Mechanism
  Matmati, Molecular and cellular biology 2020 (secret)
• Improving heterologous production of phenylpropanoids in Saccharomyces cerevisiae by tackling an unwanted side reaction of Tsc13, an endogenous double-bond reductase
  Lehka, FEMS yeast research 2017
  • “...oye2/oye2 YHR179W ylr460c/ylr460c YLR460C adh7/adh7 YCR105W ydr541c/ydr541c YDR541C gre2/gre2 YOL151W adh6/adh6 YMR318C yml131w/yml131w YML131W ymr226c/ymr226c YMR226C oye3/oye3 YPL171C ypl088w/ypl088w YPL088W aad4/aad4 YDL243C aad6/aad6 YFL056C dfg10/dfg10 YIL049W zta1/zta1 YBR046C ari1/ari1 YGL157W aad3/aad3 YCR107W frd1/frd1 YEL047C shh3/shh3 YMR118C osm1/osm1 YJR051W lot6/lot6 YLR011W ayr1/ayr1 YIL124W yjr096w/yjr096w YJR096W ydl124w/ydl124w YDL124W...”
• Increased availability of NADH in metabolically engineered baker's yeast improves transaminase-oxidoreductase coupled asymmetric whole-cell bioconversion
  Knudsen, Microbial cell factories 2016
  • “...of strains over-expressing SADH as compared to the background activity of native reductases (for example YMR226c, [ 27 ]) was confirmed by enzyme activity measurements (Table 2 ). It is noteworthy that although the activity in cell extract was more than 2-fold higher for the control...”
  • “...TJ Hua L Enzymatic ketone reduction: mapping the substrate profile of a short-chain alcohol dehydrogenase (YMR226c) from Saccharomyces cerevisiae Tetrahedron Asymmetry 2007 18 1799 1803 10.1016/j.tetasy.2007.08.008 28. Knudsen JD Johanson T Lantz AE Carlquist M Exploring the potential of the glycerol-3-phosphate dehydrogenase 2 (GPD2) promoter for...”
• Highly Efficient Synthesis of Optically Pure (S)-1-phenyl-1,2-ethanediol by a Self-Sufficient Whole Cell Biocatalyst
  Chen, ChemistryOpen 2015
  • “...CMCR 3.50 99 99 S SSCR 0.05 45 92 S GCY1 0.01 8 99 R Ymr226c 0.92 86 83 R PFADH 0.03 12 32 R Gre3 [a]For details, see the general comments in the Experimental Section. [b]Ketone (6.25m m ), NADPH (0.40m m ) and 10%...”
  • “...material industries. Experimental Section General : Carbonyl reductase from Sporobolomyces salmonicolor AKU4429 (SSCR), 18 GCY1, Ymr226c and Gre3 from Saccharomyces cerevisiae , 19 PFADH from Pyrococcus furiosus , 20 carbonyl reductase from Candida magnolia (CMCR) and d -glucose dehydrogenase (GDH) 21 were prepared as described previously....”
• Global expression analysis of the yeast Lachancea (Saccharomyces) kluyveri reveals new URC genes involved in pyrimidine catabolism
  Andersson, Eukaryotic cell 2014
  • “...permease Transport of basic amino acids URC8 SAKL0H04730g YMR226C 3-Hydroxy acid reductase DAL5 DAL4 FUR4 a All of these genes, except the LkFUI1 homolog...”
  • “...FUI1 FUR1 DUR1,2 ATR1 YGR015C Nonea PRM1 DUR3 DAL4 FUR4 YMR226C None None FUN26 None UGA4 TPO4 9.703 8.410 5.951 5.728 5.465 5.264 4.976 4.668 4.626 4.550 4.483...”
• More

3rkuA / Q05016 Substrate fingerprint and the structure of NADP+ dependent serine dehydrogenase from saccharomyces cerevisiae complexed with NADP+
34% identity, 90% coverage

• Ligand: nadp nicotinamide-adenine-dinucleotide phosphate (3rkuA)

SAS2370 putative short chain dehydrogenase from Staphylococcus aureus subsp. aureus MSSA476
33% identity, 93% coverage

• Identification of Secreted Exoproteome Fingerprints of Highly-Virulent and Non-Virulent Staphylococcus aureus Strains
  Bonar, Frontiers in cellular and infection microbiology 2016
  • “...hydrolase SAB1566c Y1566 1 1 ch24 Uncharacterized protein SA1692 Y1692 1 1 ch24 Uncharacterized oxidoreductase SAS2370 Y2370 1 1 ch24 Uncharacterized protein SA0829 Y829 1 1 ch24 UPF0477 protein SA0873 Y873 1 1 ch24 Uncharacterized protein SAOUHSC_00997 Y997 1 3 ch24 a Proteins identified as differentiating...”

CNC05450 oxidoreductase from Cryptococcus neoformans var. neoformans JEC21
35% identity, 79% coverage

• Identification of Cryptococcus neoformans temperature-regulated genes with a genomic-DNA microarray
  Kraus, Eukaryotic cell 2004
  • “...on gene at 37C Induction Annotation E valueb CNC05450 CNA06780 CNL00800 MGA2 CNC06420 CND03740 CNE01110 PPS1 THR4 CLC1 CNA02540 GLT1 CNH04480 DUR3 CNI03330 LYS2...”

SACOL2488 oxidoreductase, short-chain dehydrogenase/reductase family from Staphylococcus aureus subsp. aureus COL
Q2FE21 Uncharacterized oxidoreductase SAUSA300_2422 from Staphylococcus aureus (strain USA300)
SAUSA300_2422 oxidoreductase, short-chain dehydrogenase/reductase family from Staphylococcus aureus subsp. aureus USA300_FPR3757
NWMN_2375 NAD-dependent epimerase/dehydratase from Staphylococcus aureus subsp. aureus str. Newman
33% identity, 93% coverage

• Virulence and Metabolism
  Richardson, Microbiology spectrum 2019 (secret)
• Nitric oxide stress induces different responses but mediates comparable protein thiol protection in Bacillus subtilis and Staphylococcus aureus
  Hochgräfe, Journal of bacteriology 2008
  • “...BACTERIOL. and fermentation pathways (Ldh1, PflB, SACOL2177, and SACOL2488) (Fig. 3 and Fig. 4). Fermentation enzymes such as lactate dehydrogenase Ldh1 and...”
  • “...a zinc-containing alcohol dehydrogenase, and the oxidoreductase SACOL2488 probably catalyzes the reversible reduction of acetoin to 2,3-butanediol in the...”
• The Spl Serine Proteases Modulate Staphylococcus aureus Protein Production and Virulence in a Rabbit Model of Pneumonia
  Paharik, mSphere 2016
  • “...92.33 122.33 0.00022 Q2FKJ0 ( Q2FKJ0_STAA3 ) Putative lysophospholipase SAUSA300_0070 Putative lysophospholipase 0.00 5.00 0.000031 Q2FE21 ( Y2422_STAA3 ) Uncharacterized oxidoreductase SAUSA300_2422 Putative oxidoreductase 0.67 4.00 0.0065 Q2FEG8 ( Q2FEG8_STAA3 ) Oxidoreductase, short-chain dehydrogenase/reductase family GN=SAUSA300_2275 Putative oxidoreductase 0.00 3.00 0.002 Q2FFM0 ( Q2FFM0_STAA3 ) Uncharacterized...”
• The Spl Serine Proteases Modulate Staphylococcus aureus Protein Production and Virulence in a Rabbit Model of Pneumonia
  Paharik, mSphere 2016
  • “...) Putative lysophospholipase SAUSA300_0070 Putative lysophospholipase 0.00 5.00 0.000031 Q2FE21 ( Y2422_STAA3 ) Uncharacterized oxidoreductase SAUSA300_2422 Putative oxidoreductase 0.67 4.00 0.0065 Q2FEG8 ( Q2FEG8_STAA3 ) Oxidoreductase, short-chain dehydrogenase/reductase family GN=SAUSA300_2275 Putative oxidoreductase 0.00 3.00 0.002 Q2FFM0 ( Q2FFM0_STAA3 ) Uncharacterized putative glycosyl hydrolase SAUSA300_1856 Putative peptidase...”
• Sulfide Homeostasis and Nitroxyl Intersect via Formation of Reactive Sulfur Species in Staphylococcus aureus
  Peng, mSphere 2017
  • “...SA2156 12.7 l -Lactate permease 2 NWMN_2301 SA2189 nirR 10.3 Nitrite reductase transcriptional regulator c NWMN_2375 SA2266 5.0 NAD short-chain dehydrogenase/reductase (SDR) NWMN_2377 SA2268 4.6 Hypothetical (63 residues) NWMN_2412 SA2302 3.7 ABC transporter (ATPase); lantibiotic NWMN_2448 SA2336 clpC 5.0 Clp protease C subunit (ATPase subunit) NWMN_2465...”

FRAAL4695 Putative oxidoreductase, short chain dehydrogenase family. from Frankia alni ACN14a
37% identity, 97% coverage

• Frankia alni Carbonic Anhydrase Regulates Cytoplasmic pH of Nitrogen-Fixing Vesicles
  Pujic, International journal of molecular sciences 2023
  • “...5.6 FRAAL6528 DNA repair protein RadA 5.2 FRAAL2491 Squalene-hopene cyclase 5.2 FRAAL5157 Lipoyl synthase 5.2 FRAAL4695 Oxidoreductase 5.16 FRAAL1433 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 5.12 FRAAL4489 Carboxylate-amine ligase 5.08 FRAAL4685 Biotin carboxylase 4.8 FRAAL6803 Nitrogen fixation protein NifB 4.68 FRAAL0263 Protein of unknown function 4.67 FRAAL4691 Protein of...”

SAR2567 putative short chain dehydrogenase from Staphylococcus aureus subsp. aureus MRSA252
Q6GDV6 Uncharacterized oxidoreductase SAR2567 from Staphylococcus aureus (strain MRSA252)
33% identity, 93% coverage

• Structural and Functional Dynamics of Staphylococcus aureus Biofilms and Biofilm Matrix Proteins on Different Clinical Materials
  Hiltunen, Microorganisms 2019
  • “...protease Q6GI62 Hydrolase encoded by the agr operon P55177 Probable thiol peroxidase Q6GFZ4 Uncharacterized oxidoreductase SAR2567 Q6GDV6 Peptide methionine sulfoxide reductase MsrB Q6GGY4 Heme-dependent peroxidase (SAV0587) Q99W24 Thioredoxin reductase Q6GB66 NADPH-dependent oxidoreductase Q6GJR6 Multicopper oxidaseMco Q6GIX3 Nitric oxide synthase oxygenase Q6GFE2 Putative NAD(P)H nitroreductase (SAV2523) Q99RB2...”
• What Happens in the Staphylococcal Nucleoid under Oxidative Stress?
  Morikawa, Microorganisms 2019
  • “...sau:SAP018 arsC Protein arsC 0.59 sau:SA2040 rplP 50S ribosomal protein L16 0.54 sau:SA2266 Uncharacterized oxidoreductase SAR2567 0.54 sau:SA1529 UPF0173 metal-dependent hydrolase SA1529 0.52 sau:SA1146 bsaA Glutathione peroxidase homolog bsaA 0.47 sau:SA1076 rnc Ribonuclease 3 0.46 sau:SA0774 Probable ABC transporter ATP-binding protein 0.46 sau:SA0941 UPF0356 protein SA0941...”
• Structural and Functional Dynamics of Staphylococcus aureus Biofilms and Biofilm Matrix Proteins on Different Clinical Materials
  Hiltunen, Microorganisms 2019
  • “...Q6GI62 Hydrolase encoded by the agr operon P55177 Probable thiol peroxidase Q6GFZ4 Uncharacterized oxidoreductase SAR2567 Q6GDV6 Peptide methionine sulfoxide reductase MsrB Q6GGY4 Heme-dependent peroxidase (SAV0587) Q99W24 Thioredoxin reductase Q6GB66 NADPH-dependent oxidoreductase Q6GJR6 Multicopper oxidaseMco Q6GIX3 Nitric oxide synthase oxygenase Q6GFE2 Putative NAD(P)H nitroreductase (SAV2523) Q99RB2 FMN-dependent...”

Q7A3L9 Uncharacterized oxidoreductase SA2266 from Staphylococcus aureus (strain N315)
Q99RF5 Uncharacterized oxidoreductase SAV2478 from Staphylococcus aureus (strain Mu50 / ATCC 700699)
SA2266 hypothetical protein from Staphylococcus aureus subsp. aureus N315
SAV2478 similar to oxidoreductase from Staphylococcus aureus subsp. aureus Mu50
32% identity, 93% coverage

• Impacts of the Type I Toxin-Antitoxin System, SprG1/SprF1, on Staphylococcus aureus Gene Expression
  Chlebicka, Genes 2021
  • “...(AldA) Q7A825 1.74 2.12 48 Putative dipeptidase (SA1572) Q7A522 1.51 2.32 49 Uncharacterized oxidoreductase (SA2266) Q7A3L9 2.52 50 Uncharacterized protein (SA0829) Q7A6H3 1.90 1.79 51 UPF0342 protein (SA1663) Q7A4V3 1.82 2.17 52 Serine-aspartate repeat-containing protein D (SdrD) Q7A780 1.58 * the arrow denotes the direction of...”
• Discovery, characterization, and structure of a cofactor-independent histidine racemase from the oral pathogen Fusobacterium nucleatum
  Lamer, The Journal of biological chemistry 2024
  • “...domain-containing protein (A0A0H3JT89) V-type sodium ATP synthase subunit G ( Q8RI71 ) Uncharacterized oxidoreductase SAV2478 (Q99RF5) V-type ATP synthase subunit I ( Q8RI72 ) DUF1433 domain-containing protein (A0A0H3JTL9) V-type sodium ATP synthase subunit K ( Q8RI73 ) DUF1433 domain-containing protein (A0A0H3K113) V-type ATP synthase subunit E...”
• Impacts of the Type I Toxin-Antitoxin System, SprG1/SprF1, on Staphylococcus aureus Gene Expression
  Chlebicka, Genes 2021
  • “...dehydrogenase (AldA) Q7A825 1.74 2.12 48 Putative dipeptidase (SA1572) Q7A522 1.51 2.32 49 Uncharacterized oxidoreductase (SA2266) Q7A3L9 2.52 50 Uncharacterized protein (SA0829) Q7A6H3 1.90 1.79 51 UPF0342 protein (SA1663) Q7A4V3 1.82 2.17 52 Serine-aspartate repeat-containing protein D (SdrD) Q7A780 1.58 * the arrow denotes the direction...”
• Sulfide Homeostasis and Nitroxyl Intersect via Formation of Reactive Sulfur Species in Staphylococcus aureus
  Peng, mSphere 2017
  • “...12.7 l -Lactate permease 2 NWMN_2301 SA2189 nirR 10.3 Nitrite reductase transcriptional regulator c NWMN_2375 SA2266 5.0 NAD short-chain dehydrogenase/reductase (SDR) NWMN_2377 SA2268 4.6 Hypothetical (63 residues) NWMN_2412 SA2302 3.7 ABC transporter (ATPase); lantibiotic NWMN_2448 SA2336 clpC 5.0 Clp protease C subunit (ATPase subunit) NWMN_2465 SA2352...”
• Transcriptional profiling analysis of the global regulator NorG, a GntR-like protein of Staphylococcus aureus
  Truong-Bolduc, Journal of bacteriology 2011
  • “...ion transport and metabolism SA0946 SA2011 SA2138 SA2265 SA2266 SA2272 SA1716 SA1717 SA1718 SA1887 SA1888 SA1889 SA2173 Na/H antiporter family protein Sodium...”
• Characterizing the effects of inorganic acid and alkaline shock on the Staphylococcus aureus transcriptome and messenger RNA turnover
  Anderson, FEMS immunology and medical microbiology 2010
  • “...biosynthesis sa_c4965s4269_a_at 2.4 2.5 5 mobB SA2265 molybdopterin-guanine dinucleotide biosynthesis sa_c4967s4271_a_at 3.1 2.5 2.5 moeA SA2266 putative molybdopterin biosynthesis sa_c2753s2324_a_at * 5.1 2.5 5 nadD SA1650 nicotinate (nicotinamide) nucleotide adenylyltransferase sa_c6363s5534_a_at 2.7 2.5 2.5 panB SA2615 3-methyl-2-oxobutanoate hydroxymethyltransferase sa_c6367s5538_a_at 4.6 2.5 5 panE SA2616 2-dehydropantoate 2-reductase...”
• Discovery, characterization, and structure of a cofactor-independent histidine racemase from the oral pathogen Fusobacterium nucleatum
  Lamer, The Journal of biological chemistry 2024
  • “...DUF1413 domain-containing protein (A0A0H3JT89) V-type sodium ATP synthase subunit G ( Q8RI71 ) Uncharacterized oxidoreductase SAV2478 (Q99RF5) V-type ATP synthase subunit I ( Q8RI72 ) DUF1433 domain-containing protein (A0A0H3JTL9) V-type sodium ATP synthase subunit K ( Q8RI73 ) DUF1433 domain-containing protein (A0A0H3K113) V-type ATP synthase subunit...”

XP_002112422 uncharacterized protein from Trichoplax adhaerens
35% identity, 19% coverage

• The reductase domain in a Type I fatty acid synthase from the apicomplexan Cryptosporidium parvum: restricted substrate preference towards very long chain fatty acyl thioesters
  Zhu, BMC biochemistry 2010
  • “...i.e., Ciona intestinalis , (XP_002121624, E-value = 2.E-25), Brugia malayi (XP_001899674, 9.E-25), and Trichoplax adhaerens (XP_002112422, 8.E-15). Other invertebrate hits with much lower identities were a number of acyl-CoA reductases, mainly from insects such as Drosophila mojavensis (XP_002000602, 4.E-10) and Culex quinquefasciatus (XP_001847721, 1.E-9). This is...”

N2J7Q2 Oxidoreductase from Pseudomonas sp. HPB0071
36% identity, 95% coverage

• Arhodomonas sp. strain Seminole and its genetic potential to degrade aromatic compounds under high-salinity conditions
  Dalvi, Applied and environmental microbiology 2014
  • “...2e91 A4BNV8 80 1e40 A4BNV7 75 e144 Q46UU1 48 2e52 N2J7Q2 51 2e86 K0CBT9 Herbaspirillum sp. strain CF444 Thauera sp. strain 28 72 e179 J2LFC3 71 5e78 N6YDP9...”

SMa0320 putative from Sinorhizobium meliloti 1021
36% identity, 94% coverage

• Role of the regulatory gene rirA in the transcriptional response of Sinorhizobium meliloti to iron limitation
  Chao, Applied and environmental microbiology 2005
  • “...Berkeley SMa0002 SMa0142 SMa0172 SMa0312 SMa0314 SMa0316 SMa0320 SMa0612 SMa0617 SMa0621 SMa0994 SMa1461 SMa1683 SMa1686 SMa1745 SMa1746 SMa1749 SMa1860 SMa1985...”

GOX1899 Putative oxidoreductase from Gluconobacter oxydans 621H
36% identity, 95% coverage

• Bioenzymatic detoxification of mycotoxins
  Liu, Frontiers in microbiology 2024
  • “...were greatly improved ( Xing et al., 2023 ). The NADPH-dependent short-chain dehydrogenases GOX0525 and GOX1899 from Gluconobacter oxydans ATCC 621, both of which belong to the short-chain dehydrogenase/reductase (SDR) family, completely converted PAT to E-ascladiol within 24h ( Chan et al., 2022 ). Mr MnP...”
  • “...al. (2021) GOX0525 Gluconobacter oxydans ATCC 621 Short-chain dehydrogenase E-ascladiol Reduce Chan et al. (2022) GOX1899 Gluconobacter oxydans ATCC 621 Short-chain dehydrogenase E-ascladiol Reduce Chan et al. (2022) Mr MnP Moniliophthora roreri Manganese peroxidase hydroascladiol Reduce Wang S. et al. (2022) MgAKR Meyerozyma guilliermondii Aldo-keto reductase...”
• Characterization of Two Dehydrogenases from Gluconobacter oxydans Involved in the Transformation of Patulin to Ascladiol
  Chan, Toxins 2022
  • “...peptide mass fingerprinting, enabling the identification of two NADPH dependent short chain dehydrogenases, GOX0525 and GOX1899, with the requisite activity. The genes encoding these enzymes were expressed in E. coli and purified. Kinetic parameters for patulin reduction, as well as pH profiles and thermostability were established...”
  • “...in G. oxydans 621 strain. Two enzymes from the short-chain dehydrogenase/reductase (SDR) family, GOX0525 and GOX1899, were overproduced in recombinant E. coli and purified, enabling their kinetic and biochemical characterization. 2. Results 2.1. Analysis of Patulin Transformation by G. oxydans 621 Cell suspensions of G. oxydans...”
• Microbial detoxification of mycotoxins in food
  Abraham, Frontiers in microbiology 2022
  • “...of reducing patulin to E-ascladiol in an NADPH-dependent manner. Two of the enzymes (GOX0525 and GOX1899), belonging to the SDR family, was purified from recombinant E. coli and showed superior activity compared to the enzyme from C. guilliermondii . Recently, an aldo-keto reductase, originally isolated from...”
  • “...efficiency of this enzyme, DepB, is 80-and 4-times lower compared to the SDRs GOX0525 and GOX1899 from G. oxydans . DepB can however utilize the less expensive NADH as a coenzyme, albeit less efficiently than NADPH. Patulin can also be transformed to hydroascladiol ( Figure 4C...”
• Analysis of aldehyde reductases from Gluconobacter oxydans 621H
  Schweiger, Applied microbiology and biotechnology 2010 (PubMed)
  • “...nicotinamide adenine dinucleotide phosphate-dependent aldehyde reductases, Gox1899 and Gox2253, from Gluconobacter oxydans 621H were overproduced and purified...”
  • “...The purified proteins exhibited subunit masses of 26.4 (Gox1899) and 36.7 kDa (Gox2253). Both proteins formed homo-octamers exhibiting native masses of 210 and...”

BCAS0172 putative dehydrogenase from Burkholderia cenocepacia J2315
35% identity, 96% coverage

• Burkholderia cenocepacia differential gene expression during host-pathogen interactions and adaptation to the host environment
  O'Grady, Frontiers in cellular and infection microbiology 2011
  • “...facilitator superfamily protein 1.55 BCAS0074 Conserved hypothetical protein 1.52 BCAS0085 Organic hydroperoxide resistance protein 1.53 BCAS0172 Putative dehydrogenase 1.51 BCAS0173 Putative tautomerase 1.60 BCAS0189 Conserved hypothetical protein 1.82 BCAS0190 Putative H-NS family DNA-binding protein 2.38 BCAS0225 LysR family regulatory protein 2.71 BCAS0226 Putative hydrolase 1.99 BCAS0256...”

MSMEG_5568 clavaldehyde dehydrogenase from Mycobacterium smegmatis str. MC2 155
33% identity, 95% coverage

• Posttranslational modification of a histone-like protein regulates phenotypic resistance to isoniazid in mycobacteria
  Sakatos, Science advances 2018
  • “...and table S2). The differentially expressed genes included genes implicated in metabolic functions [such as MSMEG_5568 (clavaldehyde dehydrogenase), MSMEG_0894 (dihydrodipicolinate reductase), and MSMEG_3362 (enoylcoenzyme A hydratase)] and transcriptional regulation (such as arsR , marR , and tetR ), consistent with broad differences in cellular physiology (accession...”

2jahC / Q9LCV7 Biochemical and structural analysis of the clavulanic acid dehydeogenase (cad) from streptomyces clavuligerus (see paper)
37% identity, 94% coverage

• Ligand: nadph dihydro-nicotinamide-adenine-dinucleotide phosphate (2jahC)

BB341_RS07845, SCLAV_4190 SDR family oxidoreductase from Streptomyces clavuligerus
37% identity, 94% coverage

• The CagRS Two-Component System Regulates Clavulanic Acid Metabolism via Multiple Pathways in Streptomyces clavuligerus F613-1
  Fu, Frontiers in microbiology 2019
  • “...CA biosynthesis SCLAV_4185 BB341_RS07870 (orf14) 0.40 0.34 GNAT family acetyltransferase Biosynthesis of CA 0 SCLAV_4190 BB341_RS07845 (car) 0.35 0.48 Oxidoreductase Biosynthesis of CA 0 SCLAV_4193(oat2) BB341_RS07830 (oat2) 2.81 0.89 Ornithine acetyltransferase Biosynthesis of CA 1.11E-15 SCLAV_4197 BB341_RS07810 (ceaS2) 0.40 0.7 N (2)-(2-carboxyethyl)arginine synthase Biosynthesis of CA...”
  • “...in CA biosynthesis SCLAV_4185 BB341_RS07870 (orf14) 0.40 0.34 GNAT family acetyltransferase Biosynthesis of CA 0 SCLAV_4190 BB341_RS07845 (car) 0.35 0.48 Oxidoreductase Biosynthesis of CA 0 SCLAV_4193(oat2) BB341_RS07830 (oat2) 2.81 0.89 Ornithine acetyltransferase Biosynthesis of CA 1.11E-15 SCLAV_4197 BB341_RS07810 (ceaS2) 0.40 0.7 N (2)-(2-carboxyethyl)arginine synthase Biosynthesis of...”
• Comparative Transcriptome Analysis of Streptomyces Clavuligerus in Response to Favorable and Restrictive Nutritional Conditions
  Pinilla, Antibiotics (Basel, Switzerland) 2019
  • “...the late coding genes N-glycyl-clavaminic acid synthetase gcas (SCLAV_4181) and clavulanate-9-aldehyde reductase cad / car (SCLAV_4190), were up regulated; the latter two are involved in the last step of the CA biosynthetic pathway (see Figure 1 ). Similarly, the global regulator ccaR (SCLAV_4204) was positively regulated...”
  • “...10 4 SCLAV_4196 Carboxyethyl-arginine beta-lactam-synthase ( bls ) 2.850 1.975 10 4 6.227 10 3 SCLAV_4190 Clavaldehyde dehydrogenase ( car ) 2.739 5.920 10 5 2.268 10 3 SCLAV_4197 Carboxyethylarginine synthase ( ceas ) 2.556 1.492 10 4 4.988 10 3 Cephamycin C biosynthesis SCLAV_4206 Deacetoxycephalosporin...”
• Transcriptomic analysis of Streptomyces clavuligerus ΔccaR::tsr: effects of the cephamycin C-clavulanic acid cluster regulator CcaR on global regulation
  Alvarez-Álvarez, Microbial biotechnology 2014
  • “...05 1.68 <1E 06 SCLAV_4196 bls2 Beta-lactam synthetase 2 6.38 <1E 06 5.36 <1E 06 SCLAV_4190 car Clavaldehyde dehydrogenase 3.94 <1E 06 3.03 <1E 06 SCLAV_4194 cas2 Clavaminato sintase 2 6.55 <1E 06 6.00 <1E 06 SCLAV_4197 ceaS2 Carboxyethyl arginine synthetase 1 5.78 <1E 06 5.33...”

cad / Q9LCV7 clavulanate dehydrogenase subunit from Streptomyces clavuligerus (see paper)
37% identity, 94% coverage

Bm2014 oxidoreductase, short chain dehydrogenase/reductase family protein from Brugia malayi
33% identity, 19% coverage

• Brugia malayi Glycoproteins Detected by the Filariasis Test Strip Antibody AD12.1
  Hertz, Frontiers in tropical diseases 2021
  • “...0 Y BmSOM only 113 - Aminopeptidase Bm5654a 126 11 10 Y 47 - Oxidoreductase Bm2014 138 12 0 Y 37 - Hypothetical PAN domain containing protein Bm5611 210 109 5 Y 34 - Filarial antigen Av33 Bm3738 26 13 0 Y 33 - Hypothetical protein...”
• Profiling the macrofilaricidal effects of flubendazole on adult female Brugia malayi using RNAseq
  O'Neill, International journal for parasitology. Drugs and drug resistance 2016
  • “...5 overlapping genes, including an uncharacterized protein (Bm982), clec-1 (Bm3563), a sugar transporter (Bm5053), oxidoreductase (Bm2014) and snf-11 (Bm5517). At 48h, eight genes overlapped between the two concentrations: an uncharacterized protein (Bm8094), two ground-like domain containing proteins (Bm3090, Bm14305), clec-1 (Bm3563), snpn-1 (Bm1903), membrane-anchored cell surface...”

Atu0857 oxidoreductase from Agrobacterium tumefaciens str. C58 (Cereon)
34% identity, 95% coverage

• Two separate modules of the conserved regulatory RNA AbcR1 address multiple target mRNAs in and outside of the translation initiation region
  Overlöper, RNA biology 2014
  • “...protein 66,90 PykA atu3762 pyruvate kinase 36,86 RbsB atu3821 ABC transporter substrate-binding protein (ribose) 25,64 Atu0857 atu0857 oxidoreductase 13,45 Atu2188 atu2188 oxidoreductase 9,42 MalE atu2601 ABC transporter, substrate binding protein (maltose) 8,05 Pgi atu0404 glucose-6-phosphate isomerase 6,64 Atu4046 atu4046 ABC transporter substrate-binding protein (glycine betaine) 6,22...”
  • “...elevated protein levels in the AbcR1 strain ( Fig.2AE ). The same was true for Atu0857, an annotated oxidoreductase ( Fig.2F ). The frcB transcript appears to be downregulated by AbcR1 in the exponential growth phase but, consistent with 2D PAGE, upregulated in stationary phase (...”

MSMEG_6859 oxidoreductase from Mycobacterium smegmatis str. MC2 155
36% identity, 94% coverage

• Association of Mycobacterium Proteins with Lipid Droplets
  Armstrong, Journal of bacteriology 2018
  • “...gapA rpoC kgd atpFH MSMEG_2444 rplP MSMEG_6575 MSMEG_6859 sigA MSMEG_1757 sucC MSMEG_5053 disA disA MSMEG_6283 MSMEG_0067 rplA clpC1 MSMEG_4703 MSMEG_1736...”

2ehdB / Q5SK86 Crystal structure analysis of oxidoreductase
33% identity, 94% coverage

• Ligand: cobalt (ii) ion (2ehdB)

ZMO3_RS07160 SDR family oxidoreductase from Zymomonas mobilis subsp. mobilis
ZMO1576 short-chain dehydrogenase/reductase SDR from Zymomonas mobilis subsp. mobilis ZM4
32% identity, 96% coverage

• Conversion sweet sorghum biomass to produce value-added products
  Hu, Biotechnology for biofuels and bioproducts 2022
  • “...instance, Yan, et al. [ 111 ] employed laboratory adaptive evolution to identify the gene ZMO3_RS07160 responding to phenolic aldehydes tolerance in Zymomonas mobilis Z198, and overexpression of ZMO3_RS07160 in wild type Z. mobilis 8b increased its phenolic aldehyde (vanillin) tolerance and cellulosic ethanol production. Expression...”
• Microbial detoxification of lignocellulosic biomass hydrolysates: Biochemical and molecular aspects, challenges, exploits and future perspectives
  Ujor, Frontiers in bioengineering and biotechnology 2022
  • “...in CSH. Transcriptional analysis revealed that the evolved strain showed greater expression of the gene ZMO3_RS07160 encoding an SDR family oxidoreductase. SDRs have been strongly implicated in the detoxification of LDMICs ( Zhang and Ezeji, 2013 ; Zhang et al., 2015 ; Okonkwo et al., 2019...”
• Increasing cellulosic ethanol production by enhancing phenolic tolerance of Zymomonas mobilis in adaptive evolution
  Yan, Bioresource technology 2021 (PubMed)
  • “...analysis using qRT-PCR revealed that the gene ZMO3_RS07160 encoding SDR family oxidoreductase in Z. mobilis Z198 was significantly up-regulated by 11.7-fold....”
  • “...inhibitors ZMO3_RS07160 https://api.elsevier.com/content/object/eid/1-s2.0-S0960852421002650-gr1.jpg?httpAccept=%2A%2F%2A...”
• Design and construction of microbial cell factories based on systems biology
  Yan, Synthetic and systems biotechnology 2023
  • “...p-benzoq-uinone Z. mobilis transcriptomics Zinc-binding alcohol dehydrogenase ZMO1696 , NAD(P)H dehydrogenase ZMO1949 , short-chain dehydrogenase/reductase ZMO1576 , aldo-keto reductase ZMO1984 , fatty acid hydroxylase ZMO1399 [ 56 ] formate, acetate S. cerevisiae transcriptomics transcriptional/translational machinery-related genes: RTC3 and ANB1 [ 57 ] butanol Cyanobacteria transcriptomics the...”
• Mechanism of Tolerance to the Lignin-Derived Inhibitor p-Benzoquinone and Metabolic Modification of Biorefinery Fermentation Strains
  Yan, Applied and environmental microbiology 2019
  • “...five key genes in Z. mobilis (ZMO1696, ZMO1949, ZMO1576, ZMO1984 and ZMO1399) 31 accelerated its cell growth and cellulosic ethanol production in BQ-containing...”
  • “...172 encoding a zinc-binding alcohol dehydrogenase, and ZMO1576, encoding a short-chain 173 dehydrogenase/reductase); one fatty acid hydroxylase gene, ZMO1399;...”
• Transcriptome analysis of Zymomonas mobilis ZM4 reveals mechanisms of tolerance and detoxification of phenolic aldehyde inhibitors from lignocellulose pretreatment
  Yi, Biotechnology for biofuels 2015
  • “...protein 3.72 2.42 2.81 Unassigned ZMO1529 RND family efflux transporter subunit MFP 2.54 2.32 Unassigned ZMO1576 Short-chain dehydrogenase/reductase SDR 3.77 2.17 Unassigned ZMO1602 Hypothetical protein 2.77 2.17 Unassigned ZMO1696 Zinc-binding alcohol dehydrogenase 2.46 2.94 Unassigned ZMO1821 Hypothetical protein 3.62 4.26 Unassigned ZMO1880 Hypothetical protein 2.58 2.90...”
  • “...ZMO1254 encoded redoxin domain protein, ZMO1303 encoded a pyrroline-5-carboxylate reductase, ZMO1399 encoded fatty acid hydroxylase, ZMO1576 encoded short-chain dehydrogenase/reductase SDR, ZMO1696 encoding zinc-binding alcohol dehydrogenase, ZMO1984 encoded aldo/keto reductase, were also up-regulated over twofold change under at least two phenolic aldehyde inhibitors. ZMO0020 , ZMO0021 ,...”
• Systems biology analysis of Zymomonas mobilis ZM4 ethanol stress responses
  Yang, PloS one 2013
  • “...dehydrogenase/class IIIalcohol dehydrogenase 2.6 4.80E-03 0.3 6.92E-09 1 ZMO1544 Cobaltochelatase 2.6 4.50E-05 0.5 2.75E-15 1 ZMO1576 putative short-chain dehydrogenase/oxidoreductase 2.5 1.80E-05 0.2 9.55E-05 1 ZMO1605 pyruvate dehydrogenase subunit beta 2.3 4.10E-06 1.0 5.62E-23 1 ZMO1741 GTP-binding protein LepA 2.0 4.90E-03 0.4 1.62E-08 1 ZMO0811 methionyl-tRNA formyltransferase...”

Afu5g11240 oxidoreductase, short chain dehydrogenase/reductase family from Aspergillus fumigatus Af293
37% identity, 67% coverage

• Evolutionary Analysis of Sequence Divergence and Diversity of Duplicate Genes in Aspergillus fumigatus
  Yang, Evolutionary bioinformatics online 2012
  • “...1.17 [1.35, 0.63] Afu5g01440 1.01 [1.81, 3.52] Afu6g12500 1.94 [2.22, 1.50] Afu6g09140 1.01 [1.82, 3.52] Afu5g11240 2.80 [2.07,0.45] Afu6g04790 1.00 [1.85, 3.53] Afu5g02150 0.07 [3.18, 6.33] Afu3g13650 0.98 [0.69, 2.00] Afu8g05805 0.94 [0.59, 1.85] Afu4g02700 0.97 [0.69, 2.00] Afu4g13750 1.05 [1.50, 0.99] Afu1g00810 0.97 [0.31, 1.50]...”
  • “...15 1.1 Afu1g01610 Conserved hypothetical protein 0.00001 Afu4g02880 Conserved hypothetical protein 34.5% <0.001 16 0.0295 Afu5g11240 Oxidoreductase, short chain dehydrogenase/reductase family 0.0001 Afu6g09140 Oxidoreductase, short-chain dehydrogenase/reductase family 15.1% <0.0001 17 0.0001 Afu3g15280 Methyltransferase 0.0000 Afu2g04380 LaeA-like methyltransferase 78.5% <0.0001 18 0.0001 Afu5g14930 * Conserved hypothetical protein...”
• Transcriptional profiling identifies a role for BrlA in the response to nitrogen depletion and for StuA in the regulation of secondary metabolite clusters in Aspergillus fumigatus
  Twumasi-Boateng, Eukaryotic cell 2009
  • “...Adenine phosphoribosyltransferase 1 Methyltransferase Afu5g11240 Afu6g11430 Afu7g01000 Afu7g01010 Afu6g10260 Afu3g05450 Afu6g09140 Afu2g08380 Afu7g02310...”

bll3640 short-chain dehydrogenase from Bradyrhizobium japonicum USDA 110
34% identity, 99% coverage

• Identification of the Important Genes of Bradyrhizobium diazoefficiens 113-2 Involved in Soybean Nodule Development and Senescence
  Yuan, Frontiers in microbiology 2021
  • “...113-2GL004326 113-2GL008064 blr1516 Pessi et al., 2007 Glyma.05G033800 blr1516 113-2GL008064 Delmotte et al., 2010 Glyma.14G145000 bll3640 113-2GL005884 uklina et al., 2016 blr4473 113-2GL004883 Zhang et al., 2018 bll4736 113-2GL004557 bll5710 113-2GL003508 113-2GL001540 bll7600 Delmotte et al., 2010 Glyma.17G228800 bll7600 113-2GL001540 uklina et al., 2016 Glyma.18G277300 Zhang...”

VPA1275 oxidoreductase, short-chain dehydrogenase/reductase family from Vibrio parahaemolyticus RIMD 2210633
34% identity, 96% coverage

• Transcriptome analysis of Vibrio parahaemolyticus in type III secretion system 1 inducing conditions
  Nydam, Frontiers in cellular and infection microbiology 2014
  • “...Hypothetical protein vpa0635 Oxidoreductase, oxygen dependent, FAD-dependent protein COG0277C vpa0882 Heme transport protein HutA COG1629P vpa1275 Short chain dehydrogenase/reductase family oxidoreductase COG4221R * T3SS1 associated genes (vp1656vp1702; vpa0450vpa0451) are excluded from this table. HeLa cell infectionT3SS1 associated genes Expression analysis of replicate samples at each HeLa...”
  • “...parahaemolyticus (Yildiz and Visick, 2009 ). Enzymes like oxidoreductases ( vpa0635 ) and dehydrogenases ( vpa1275 ) are typically involved in redox reactions important in metabolism and managing oxidative stress (Green and Paget, 2004 ; White et al., 2012 ), although there are some studies indicating...”

A9762_05735 SDR family oxidoreductase from Pandoraea sp. ISTKB
35% identity, 94% coverage

• Genomic and proteomic analysis of lignin degrading and polyhydroxyalkanoate accumulating β-proteobacterium Pandoraea sp. ISTKB
  Kumar, Biotechnology for biofuels 2018
  • “...61.8 30.679 4.89E178 A0A1E3LCB2 A9762_09255 NADH-quinone oxidoreductase subunit B 1.96385 10 72.3 17.519 1.56E64 A0A1E3LEJ8 A9762_05735 Oxidoreductase 1.97509 18 85.7 26.372 6.17E220 A0A1E3LKX1 A9762_15740 Quinone oxidoreductase 1.99406 18 90.7 34.556 1.06E219 Oxygenases A0A1E3LHN5 A9762_23090 2-Nitropropane dioxygenase 1.84558 3 15.1 38.789 7.50E15 A0A1E3LFU3 A9762_22350 Quercetin 2,3-dioxygenase 1.82796...”

AFUA_5G10120, Afu5g10120 NRPS-like enzyme, putative from Aspergillus fumigatus Af293
34% identity, 18% coverage

• Recent advances in the genome mining of Aspergillus secondary metabolites (covering 2012-2018)
  Romsdahl, MedChemComm 2019
  • “...Afu3g14700 Afu3g15270 Afu4g00210 Afu4g14560 Afu4g14770 Afu5g10120 Afu5g12730 Afu6g03480 Afu6g08560 Afu6g09610 Afu6g09660 Afu6g12050 Afu6g12080 Afu6g13930...”
• Expression profile analysis reveals that Aspergillus fumigatus but not Aspergillus niger makes type II epithelial lung cells less immunological alert
  Escobar, BMC genomics 2018
  • “...48.25 Up Afu4g12920 2.43 Up Aspni7|1,117,390 3.52 Up Afu4g12990 (trr1) 4.47 Up Aspni7|1,101,794 7.80 Down Afu5g10120 3.76 Up Aspni7|1,121,186 30.54 Up Afu5g10610 (rip1) 3.26 Up Aspni7|1,003,271 3.07 Up Afu6g02280 (aspf3) 2.41 Up Aspni7|1,143,258 2.97 Down Afu6g02520 2.01 Up Aspni7|1,172,785 3.90 Up Afu6g03060 18.45 Up Aspni7|1,143,191 14.30...”
• Additional oxidative stress reroutes the global response of Aspergillus fumigatus to iron depletion
  Kurucz, BMC genomics 2018
  • “...b /0 0/1 1/2 3/0 Afu3g13730 cluster 9 0/5 b 0/4 b 0/1 0/5 b Afu5g10120 cluster 10 3/0 1/0 2/0 6 b /0 Afu6g13930 cluster 9 0/9 b 0/2 b 1/5 b 0/9 b Afu7g00170 cluster 7 1/1 4 b /0 1/0 1/0 No PKS...”
  • “...were detected (Table 2 , Additional files 2 and 3 ). Regarding secondary metabolism, the Afu5g10120 and siderophore clusters showed up-regulation, whereas nine clusters (DHN-melanin, endocrocin, fumigaclavine C, fumipyrrole, fumiquinazoline, fumitremorgin B gliotoxin, Afu3g13730, and Afu6g13930 clusters) were down-regulated (Table 4 , Additional files 4 and...”
• Caspofungin exposure alters the core septin AspB interactome of Aspergillus fumigatus
  Vargas-Muñiz, Biochemical and biophysical research communications 2017
  • “...caspofungin exposure AspGD ID Protein Spectral Count Secondary Metabolism AFUA_8G00540 PsoA PKS-NRPS hybrid synthase 41 AFUA_5G10120 NRPS-Like 3 AFUA_8G00440 PsoF Mono-oxygenase 7 Induced after exposure to antifungal agents AFUA_1G13330 ArpB 4 AFUA_2G03720 Cyp4 3 AFUA_4G10770 PpoA 9 Table 3 Minimum effective concentration of caspofungin and nikkomycin...”
• Temperature during conidiation affects stress tolerance, pigmentation, and trypacidin accumulation in the conidia of the airborne pathogen Aspergillus fumigatus
  Hagiwara, PloS one 2017
  • “...Hexadehydroastechrome AFUA_3G13730 3.7 2.6 1.1 1.40 0.42 pesG AFUA_3G15270 0.1 0.0 0.1 - - pesH AFUA_5G10120 5.9 6.1 18.8 0.96 3.07 AFUA_5G12730 43.2 28.4 12.0 1.52 0.42 pes3 AFUA_6G03480 0.4 0.4 1.5 0.93 3.40 AFUA_6G08560 5.2 4.1 15.7 1.27 3.81 AFUA_6G09610 2.1 0.3 2.0 6.22 5.95...”
• Regulation of Secondary Metabolism by the Velvet Complex Is Temperature-Responsive in Aspergillus
  Lind, G3 (Bethesda, Md.) 2016
  • “..., Afu5g10050 , Afu5g10060 , Afu5g10070 , Afu5g10080 , Afu5g10090 , Afu5g10100 , Afu5g10110 , Afu5g10120 , Afu5g10130 Inglis et al. (2013) Cluster 23 Not known Afu5g12730 , Afu5g12740 , Afu5g12750 , Afu5g12760 , Afu5g12770 Inglis et al. (2013) Cluster 24 Fumipyrrole Afu6g03430 , Afu6g03440 ,...”
• Comprehensive annotation of secondary metabolite biosynthetic genes and gene clusters of Aspergillus nidulans, A. fumigatus, A. niger and A. oryzae
  Inglis, BMC microbiology 2013
  • “...cluster Afu4g14560 Afu4g14730 - Afu4g14420 Afu4g14660 - Afu4g14440 Afu4g14610 - Afu4g14450 ECS ECS This study Afu5g10120 cluster Afu5g10120 Afu5g10250 - Afu5g09970 Afu5g10240 - Afu5g10010 Afu5g10130 - Afu5g10040 ECS FA This study Afu5g12730 cluster Afu5g12730 Afu5g12840 - Afu5g12720 Afu5g12830 - Afu5g12680 Afu5g12770 - Afu5g12730 FA ECS This...”
• Advances in Aspergillus secondary metabolite research in the post-genomic era
  Sanchez, Natural product reports 2012
  • “...PR-PKS 17 Afu3g15270 AFUB_033950 pesH NRPS 18 Afu4g00210 AFUB_100730 NR-PKS 19 Afu4g14560 AFUB_071800 NR-PKS 20 Afu5g10120 AFUB_057720 NRPS-like 21 Afu5g12730 AFUB_060400 pesI 144 NRPS 22 Afu6g03480 AFUB_094810 NRPS-like 23 Afu6g08560 AFUB_074520 NRPS-like 24 Afu6g09610 AFUB_075660 pesJ NRPS 25 Afu6g09660 AFUB_075710 gliP NRPS gliotoxin (37) 74 76...”
• More

SMa2343 putative oxidoreductase from Sinorhizobium meliloti 1021
33% identity, 95% coverage

• Directed construction and analysis of a Sinorhizobium meliloti pSymA deletion mutant library
  Yurgel, Applied and environmental microbiology 2013
  • “...pK19mob (200 bp of SMa2341) pK19mob (200 bp of SMa2343) pK19mob (200 bp of SMa2349) pK19mob (200 bp of SMa5012) pK19mob (200 bp of SMa2357) pK19mob (200...”
  • “...(SMa2341 [transcriptional regulator], SMa2357 [adenylate/guanylate cyclase], and SMa2343 [oxidoreductase]) and in SMa5012 and SMa2349, genes at the beginning of...”

XF1744 oxidoreductase from Xylella fastidiosa 9a5c
32% identity, 95% coverage

• Xylella fastidiosa subsp. pauca Strains Fb7 and 9a5c from Citrus Display Differential Behavior, Secretome, and Plant Virulence
  de, International journal of molecular sciences 2020
  • “...10 6 10 31 XF1123 IV.A.2 Outer membrane protein 1.59 1.68 10 2 3 44 XF1744 IX Oxidoreductase 1.55 3.74 10 6 6 34 XF0619 VII.C Periplasmic divalent cation tolerance 1.5 9.68 10 3 2 7 XF1282 III.C.3 Carboxypeptidase-related protein 1.45 3.02 10 6 3 8...”
• Microarray analyses of Xylella fastidiosa provide evidence of coordinated transcription control of laterally transferred elements
  Nunes, Genome research 2003
  • “...also displayed similar profiles, as did ORF XF1744, a hypothetical oxidoreductase, possibly associated with invasive capability, which is also missing in...”

VCA1057 oxidoreductase, short-chain dehydrogenase/reductase family from Vibrio cholerae O1 biovar eltor str. N16961
34% identity, 96% coverage

• Thiol-Based Modification of MarR Protein VnrR Regulates Resistance Toward Nitrofuran in Vibrio cholerae By Promoting the Expression of a Novel Nitroreductase VnrA and of NO-Detoxifying Enzyme HmpA
  Yang, Antioxidants & redox signaling 2024 (PubMed) (secret)
• Mechanism of Vibrio cholerae autoinducer-1 biosynthesis
  Wei, ACS chemical biology 2011
  • “...DNA manipulations were performed following standard procedures.( 37 ) V. cholerae genes vc1059, vca0301, vca0691, vca1057, vca1108, vc1591, vc0979, and vc2021 were amplified, cloned into pET28b (Novagen) using NdeI/XbaI and Bam HI sites, and sequenced. Plasmids were transformed into E. coli BL21 (DE3). A complete strain...”
• Second-generation recombination-based in vivo expression technology for large-scale screening for Vibrio cholerae genes induced during infection of the mouse small intestine
  Osorio, Infection and immunity 2005
  • “...phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase), VCA1057 (oxidoreductase short-chain dehydrogenase), VC2373 (gltB1; glutamate synthase,...”
  • “...broth Cassetteb Allelec VCA1008 VC2487 VC2641 VC0488 VC0063 VCA1057 VCA0773 VC0622 VC1111 VC0207 VC0721 VC1658 VC2373 VC0201 VCA0529 VC0874 VC1173 VC0202 VC0203...”

lp_2851 SDR family oxidoreductase from Lactiplantibacillus plantarum WCFS1
lp_2851 short-chain dehydrogenase/oxidoreductase from Lactobacillus plantarum WCFS1
33% identity, 96% coverage

• Cranberry Proanthocyanidins and Dietary Oligosaccharides Synergistically Modulate Lactobacillus plantarum Physiology
  Özcan, Microorganisms 2021
  • “...gene, along with an adjacent locus potentially related to quercetin dioxygenase (lp_2853) and an oxidoreductase (lp_2851), were downregulated by FOS+PAC1 relative to FOS+PAC2 ( p < 0.05; Figure S13C ). These three genes were upregulated by both PAC fractions during HMO fermentations compared to oligosaccharides alone...”

ATR12_EMENI / A0A1U8QWA2 Glycine betaine reductase ATRR; Nonribosomal peptide synthetase-like protein ATRR; EC 1.2.1.-; EC 1.1.1.- from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
33% identity, 18% coverage

• function: NRPS-like enzyme with an unusual domain architecture that converts back glycine betaine to choline via a 2-step reduction mechanism, and thereby can be an alternative source of choline (PubMed:31061132). Permits direct reutilization of endogenously stored glycine betaine for on-demand biosynthesis of choline and choline derivatives, including phospholipid phosphatidylcholine (PC) which has an essential role in maintaining membrane integrity and functionality, or choline-O-sulfate, a mean for intracellular sulfate storage (PubMed:31061132). Glycine betaine is activated by the adenylation (A) domain, and transferred to the thiolation (T) domain (PubMed:31061132). Movement of the phosphopantetheine arm to the thioester reductase domain R1 then allows thioester reduction by NADPH of glycine betainoyl thioester to glycine betaine aldehyde, which is in turn reduced to choline by the aldehyde reductase domain R2 (PubMed:31061132).
  disruption phenotype: Severely impairs the hyphae growth and conidiation at high level glycine betaine (PubMed:31061132). Exhibits a choline-auxotroph character, when the phosphatidylethanolamine N- methyltransferase choA is also deleted (PubMed:31061132).

ANOM_004242 NRPS-like enzyme from Aspergillus nomiae NRRL 13137
32% identity, 18% coverage

• Aspergillus hancockii sp. nov., a biosynthetically talented fungus endemic to southeastern Australian soils
  Pitt, PloS one 2017
  • “...67/99 18 91 A-T-TE A . nomius ANOM_000859 63/98 19 319.2 A-T-R-KR A . nomius ANOM_004242 92/100 20 2835.4 A-T-C Uncinocarpus reesii UREG_04218 46/98 21 2835.4 A-T-R P . brasilianum PMG11_03954 58/96 22 990.3 A-T-R A . terreus ATEG_09068 51/98 23 21 A-T-R A . oryzae...”

lmo0432 similar to oxidoreductase from Listeria monocytogenes EGD-e
31% identity, 96% coverage

• [Characterization of a naturally atypical Listeria monocytogenes strain lacking inlAB]
  Chen, Wei sheng wu xue bao = Acta microbiologica Sinica 2009 (PubMed)
  • “...decreased pathogenicity to mice. It lacked the gene locus inlAB and their adjacent genes lmo0431, lmo0432, lmo0436 and lmo0437, but contained an almost whole set of infection-associated genes. S10 fell into the lineage I cluster and form a sister branch with 4b strain. The isolate S10...”
• Genetic markers unique to Listeria monocytogenes serotype 4b differentiate epidemic clone II (hot dog outbreak strains) from other lineages
  Evans, Applied and environmental microbiology 2004
  • “...L. innocua lin0453 (96% identity) L. monocytogenes EGD lmo0432; (91% identity); L. innocua lin0452 (92% identity)e a ORFs identified by GAMOLA, based on...”

HMPREF1120_00598 linear gramicidin synthetase subunit C from Exophiala dermatitidis NIH/UT8656
33% identity, 18% coverage

• Transcriptome Study of an Exophiala dermatitidis PKS1 Mutant on an ex Vivo Skin Model: Is Melanin Important for Infection?
  Poyntner, Frontiers in microbiology 2018
  • “...peptidase Glutamate carboxypeptidase II HMPREF1120_04355 0.35 M28 peptidase Secondary metabolites DMATS HMPREF1120_01968 3.32 Unknown NRPS HMPREF1120_00598 3.76 3.81 2.40 Linear gramicidin synthase subunit C Fatty-acid beta-oxidation FAA2 HMPREF1120_02478 0.32 Long-chain-fatty-acidCoA POT1 HMPREF1120_04123 5.81 8.94 7.11 3-oxoacyl CoA thiolase Glyoxylate cycle MDH1-3/MAE1 HMPREF1120_06385 2.84 Malate dehydrogenase HMPREF1120_0060...”
  • “...synthesis of ergot alkaloid, was upregulated in the MT experiment. Linear gramicidin synthetase subunit C (HMPREF1120_00598), a non-ribosomal peptide synthetase involved (NRPS), was upregulated in all skin experiments. Discussion In this work the CRISPR/Cas9 gene knockout method has been successfully used in E. dermatitidis . The...”
• The Transcriptome of Exophiala dermatitidis during Ex-vivo Skin Model Infection
  Poyntner, Frontiers in cellular and infection microbiology 2016 (no snippet)

lin0452 similar to oxidoreductase from Listeria innocua Clip11262
30% identity, 96% coverage

• Genetic markers unique to Listeria monocytogenes serotype 4b differentiate epidemic clone II (hot dog outbreak strains) from other lineages
  Evans, Applied and environmental microbiology 2004
  • “...L. monocytogenes EGD lmo0432; (91% identity); L. innocua lin0452 (92% identity)e a ORFs identified by GAMOLA, based on preliminary sequence data for L....”

Z0343 putative oxidoreductase from Escherichia coli O157:H7 EDL933
33% identity, 96% coverage

• LysR-type transcriptional regulator OvrB encoded in O island 9 drives enterohemorrhagic Escherichia coli O157:H7 virulence
  Liu, Virulence 2019
  • “...virulence determinants and are global regulators of pathogenicity in many bacterial pathogens [ 29 ]. Z0343 contains an adh_short superfamily domain, which is the active site of formaldehyde dehydrogenase; thus, Z0343 may be involved in metabolizing endogenous and exogenous aldehydes ( Figure 1(b) ). Z0344 and...”

3p19A / Q9F172 Improved NADPH-dependent blue fluorescent protein (see paper)
32% identity, 96% coverage

• Ligand: nadph dihydro-nicotinamide-adenine-dinucleotide phosphate (3p19A)

An02g00210 uncharacterized protein from Aspergillus niger
31% identity, 18% coverage

• Recent advances in the genome mining of Aspergillus secondary metabolites (covering 2012-2018)
  Romsdahl, MedChemComm 2019
  • “...An01g00060 An01g01130 An01g06930 An01g06950 An01g11770 An02g00210 An02g00450 An02g00840 An02g05070 An02g08290 An02g09430 An02g10140 An02g14220 An03g00650...”
• Comprehensive annotation of secondary metabolite biosynthetic genes and gene clusters of Aspergillus nidulans, A. fumigatus, A. niger and A. oryzae
  Inglis, BMC microbiology 2013
  • “...cluster An01g11770 An01g11740 - An01g11900 An01g11690 - An01g11880 An01g11760 - An01g11830 IGD, ECS ECS, IGD An02g00210 cluster An02g00210 An02g00150 - An02g00290 An02g00140 - An02g00320 An02g00210 - An02g00260 ECS ECS An02g00450 cluster An02g00450 An02g00430 - An02g00580 An02g00340 - An02g00540 - n/a n/a An02g00840 cluster An02g00840 An02g00710 -...”
• Advances in Aspergillus secondary metabolite research in the post-genomic era
  Sanchez, Natural product reports 2012
  • “...fum1 HR-PKS fumonisins 147 , 148 4 An01g06950 Aspni1:225587 PR-PKS 5 An01g11770 und NRPS-like 6 An02g00210 und NRPS-like 7 An02g00450 Aspni1:118617 HR-PKS 8 An02g00840 und NRPS-like 9 An02g05070 Aspni1:36929 NRPS 10 An02g08290 Aspni1:118624 Hybrid 11 An02g09430 Aspni1:37260 HR-PKS 12 An02g10140 und NRPS-like 13 An02g14220 und PKS-like...”

FTT_1201c oxidoreductase, short-chain dehydrogenase family protein from Francisella tularensis subsp. tularensis SCHU S4
33% identity, 95% coverage

• Immunoproteomic analysis of the human antibody response to natural tularemia infection with Type A or Type B strains or LVS vaccination
  Fulton, International journal of medical microbiology : IJMM 2011
  • “...- FTT_1103 Hypothetical lipoprotein - - - 1 - [29], [27], [38], [39], [40], [41] FTT_1201c Oxidoreductase, short-chain dehydrogenase family protein - 1 * - - - [25], [28] FTT_1269c Chaperone protein dnaK 1 5 7 5 8 [25], [29], [30], [27], [38], [39], [40], [41],...”
• The francisella tularensis proteome and its recognition by antibodies
  Kilmury, Frontiers in microbiology 2010
  • “...microarray Cytoplasmic membrane Eyles et al. ( 2007 ), Sundaresh et al. ( 2007 ) FTT_1201c Oxidoreductase Human, presumed type B; mouse 2D-Western blot Cytoplasmic Havlasova et al. ( 2002 , 2005 ) FTT_1236 Hypothetical protein Mouse Proteome microarray Unknown Eyles et al. ( 2007 )...”

SCO0522 oxidoreductase from Streptomyces coelicolor A3(2)
34% identity, 92% coverage

• Crystal structure of a putative transcriptional regulator SCO0520 from Streptomyces coelicolor A3(2) reveals an unusual dimer among TetR family proteins
  Filippova, Journal of structural and functional genomics 2011
  • “...Chromosomal mapping indicates that the sco0520 gene is located near two neighboring genes sco0521 and sco0522 , which encode for a putative transcriptional regulator (SCO0521) and a putative oxidoreductase (SCO0522), respectively. Sequence analysis shows that the oxidoreductase SCO0522 belongs to the short-chain dehydrogenase/reductase (SDRs) family [...”
  • “...genes sco0520 and sco0521 suggests the hypothesis that the gene cluster sco0520 , sco0521 and sco0522 may comprise a functional operon. Therefore, SCO0520, perhaps together with SCO0521, may regulate the sco0522 gene which encodes for the putative oxidoreductase. A similar type of gene organization and regulation,...”

PADG_02575 uncharacterized protein from Paracoccidioides brasiliensis Pb18
32% identity, 18% coverage

• Genome Diversity, Recombination, and Virulence across the Major Lineages of Paracoccidioides
  Muñoz, mSphere 2016
  • “...+ + PADG_02492 Predicted dehydrogenase + PADG_07365 Predicted dehydrogenase + + PADG_07411 Predicted dehydrogenase + PADG_02575 Predicted nonribosomal peptide synthetase + + PADG_06309 Predicted oxidoreductase + + + + PADG_02592 Predicted oxidoreductase + + + PADG_06322 Predicted peroxidase + + + PADG_02507 Predicted peroxidase; secreted +...”

BBA_04028 nonribosomal peptide synthetase 10 from Beauveria bassiana ARSEF 2860
31% identity, 18% coverage

• Hypovirulence-associated mycovirus epidemics cause pathogenicity degeneration of Beauveria bassiana in the field
  Zhang, Virology journal 2023
  • “...tenellin, bassianin 25, beauveritin and bassianolide [ 54 56 ]. Three virulence-related NRPS genes ( BBA_04028 , BBA_08222 and BBA_03671 ) were identified in B. bassiana isolated from Plutella xylostella [ 57 ]. Here, we identified four NRPS-related genes ( BBA_09856 , BBA_03616 , BBA_01841 and...”
• Genomic perspectives on the evolution of fungal entomopathogenicity in Beauveria bassiana
  Xiao, Scientific reports 2012
  • “...clusters conserved between insect pathogens and T. reesei , including two NRPS-like proteins (BBA_06997 and BBA_04028), one NRPS (BBA_05020) and one terpene cyclase (BBA_06542) ( Supplementary Fig. S4B ). Two clusters are limited to Bb, Cm and T. reesei , i.e. a type I PKS cluster...”

FGSG_06507 hypothetical protein from Fusarium graminearum PH-1
32% identity, 18% coverage

• The Fusarium graminearum histone H3 K27 methyltransferase KMT6 regulates development and expression of secondary metabolite gene clusters
  Connolly, PLoS genetics 2013
  • “...8 nps8 yes yes in high N no FGSG_10990 NRPS 9 yes no yes no FGSG_06507 NRPS 10 nps10 no no yes constitutive FGSG_03245 NRPS 11 nps11 yes yes yes in low N FGSG_11294 NRPS 12 yes yes in low N in low N FGSG_13153 NRPS...”

FFUJ_03506 related to alpha-aminoadipate reductase large subunit from Fusarium fujikuroi IMI 58289
32% identity, 18% coverage

• Genome Sequencing of Multiple Isolates Highlights Subtelomeric Genomic Diversity within Fusarium fujikuroi
  Chiara, Genome biology and evolution 2015
  • “...a SM Product B14 KSU X-10626 FGSC 8932 KSU 3368 IMI58289 UP DW UP DW FFUJ_03506 NRPS10 Unknown 0 b 0 b 1 1 1 0 0 0 1 FFUJ_00003 NRPS31 Apicidin-like 2 b 2 b 11 11 11 0 11 3 3 FFUJ_02105 PKS6 Fusaric...”

PK81I_PSEFD / M2ZIX7 Short chain dehydrogenase MYCFIDRAFT_6125; PKS8-1 gene cluster protein MYCFIDRAFT_6125; EC 1.1.1.- from Pseudocercospora fijiensis (strain CIRAD86) (Black leaf streak disease fungus) (Mycosphaerella fijiensis) (see 2 papers)
35% identity, 60% coverage

• function: Short chain dehydrogenase; part of the gene cluster that mediates the biosynthesis of an emodin derivative that may be involved in black Sigatoka disease of banana (PubMed:27388157, PubMed:30735556). The pathway begins with the synthesis of atrochrysone thioester by the polyketide synthase PKS8-1 (Probable). The atrochrysone carboxyl ACP thioesterase MYCFIDRAFT_190111 then breaks the thioester bond and releases the atrochrysone carboxylic acid from PKS8-1 (Probable). The decarboxylase MYCFIDRAFT_34057 then catalyzes the concerted decarboxylation-elimination required to convert atochrysone carboxylic acid into emodin anthrone, which is further oxidized to emodin by the anthrone oxygenase MYCFIDRAFT_34418 (Probable). The functions of the other tailoring enzymes as well as the final product of the cluster have still to be identified (Probable).

alr2142 oxidoreductase from Nostoc sp. PCC 7120
32% identity, 95% coverage

• Group 3 sigma factor gene, sigJ, a key regulator of desiccation tolerance, regulates the synthesis of extracellular polysaccharide in cyanobacterium Anabaena sp. strain PCC 7120
  Yoshimura, DNA research : an international journal for rapid publication of reports on genes and genomes 2007
  • “...alr1372 Hypothetical protein 2.27 1.56 alr1534 Hypothetical protein 2.09 0.80 alr2071 Unknown protein 2.13 2.03 alr2142 Oxidoreductase 2.09 1.36 alr2174 Transcriptional regulator 2.10 0.38 alr2256 Unknown protein 2.95 1.51 alr2310 Similar to agmatinase 2.15 0.99 alr2405 Flavodoxin, IsiB 3.36 0.74 alr2407 Hypothetical protein 2.38 0.41 alr2447...”

slr0315 hypothetical protein from Synechocystis sp. PCC 6803
30% identity, 96% coverage

• Finding novel relationships with integrated gene-gene association network analysis of Synechocystis sp. PCC 6803 using species-independent text-mining
  Kreula, PeerJ 2018
  • “...sll0208 ado aldehyde deformylating oxygenase sll0207 rfbA glucose-1-phosphate thymidylyltransferase sll0728 accA Acetyl-CoA carboxylase alpha subunit slr0315 probable oxidoreductase slr0426 folE GTP cyclohydrolase I Sigma factor Sll1689 sigE group2 RNA polymerase sigma factor SigE Case study 1novel candidates with a potential relationship to SigE SigE (sll1689) is...”
• Scavenging systems for reactive carbonyls in the cyanobacterium Synechocystis sp. PCC 6803
  Shimakawa, Bioscience, biotechnology, and biochemistry 2013 (PubMed)
  • “...lipid-derived RCs, acrolein, propionaldehyde, and crotonaldehyde. Slr0315 is a short-chain dehydrogenase/redutase (SDR), and it catalyzed only the reduction...”
  • “...Amino Acids. a, Phylogenetic tree analysis of Slr0315, Slr0886, Sll5079, and At3g04000. Bar shows branch length, reflecting evolutionary distance. b, Sequence...”

H9Q64_13605 SDR family oxidoreductase from Enterococcus faecalis
30% identity, 95% coverage

• Genetically distant bacteriophages select for unique genomic changes in Enterococcus faecalis
  Johnson, MicrobiologyOpen 2022
  • “...39 4 1079220 H9Q64_06285 Phage Infection Protein (PIP) Ser685fs 56 2520234 Intergenic region Downstream of H9Q64_13605 NA 30 240029 ccpA Catabolite control protein A Asn27Ile 58 5 1079058 H9Q64_06285 Phage Infection Protein (PIP) Ile739fs 39 1963417 sufU SufU, component of the SUF system Thr70Ile 40 Day...”

EF2956 oxidoreductase, short-chain dehydrogenase/reductase family from Enterococcus faecalis V583
30% identity, 95% coverage

• Comparative genomics and transduction potential of Enterococcus faecalis temperate bacteriophages
  Yasmin, Journal of bacteriology 2010
  • “...EF1987 EF2044 EF2083 EF2146 EF2797 EF2856 EF2935 EF2956 Relevant characteristics or sequence Lab strain, gelatinase producer (Rifr Fusr) Lab strain, gelatinase...”

AO090005000690 No description from Aspergillus oryzae RIB40
32% identity, 18% coverage

• Comparison of expression of secondary metabolite biosynthesis cluster genes in Aspergillus flavus, A. parasiticus, and A. oryzae
  Ehrlich, Toxins 2014
  • “...AFLA_079380 0.9 333.m000120 5.4 AO090005000688 8.6 8.m006319 1.8 26 1278 A-T-SDR_e1 AFLA_079400 5.2 333.m000118 7.4 AO090005000690 16.2 8.m006317 20.9 AFLA_079320 37 1055 A-R AFLA_105190 0.9 348.m000125 0.6 AO090023000082 6.0 17.m003740 13.7 AFLA_118300 45 1048 C-A-T-R AFLA_118440 0.2 137.m000247 0.0 AO090010000349 0.0 11.m006507 0.0 47 1043 A-T-R...”

MAC_06316 putative NRPS-like protein biosynthetic cluster from Metarhizium acridum
30% identity, 18% coverage

• Genome sequencing and comparative transcriptomics of the model entomopathogenic fungi Metarhizium anisopliae and M. acridum
  Gao, PLoS genetics 2011
  • “...virulence factor of the insect pathogen Beauveria bassiana [60] . The NRPS-like proteins MAA_07148 and MAC_06316 are most similar to ACE1, a PKS/NRPS hybrid that confers avirulence to M. grisea during rice infection [61] . M. anisopliae NRPS MAA_00969 is similar (43% identity) to HTS1, the...”

Dgeo_0818 short-chain dehydrogenase/reductase SDR from Deinococcus geothermalis DSM 11300
32% identity, 92% coverage

• Physiology of resistant Deinococcus geothermalis bacterium aerobically cultivated in low-manganese medium
  Liedert, Journal of bacteriology 2012
  • “...Dps (Dps) *2 Short-chain dehydrogenase (Dgeo_0818) *2 Fructose-1,6-bisphosphate aldolase (Dgeo_2083) Hypothetical protein (Dgeo_1454) *2 Thermostable...”

Pc18g00380 uncharacterized protein from Penicillium rubens
30% identity, 18% coverage

• A Penicillium rubens platform strain for secondary metabolite production
  Pohl, Scientific reports 2020
  • “...mutation (A952D) in a putative linker region between domains, which could potentially affect enzyme functionality. Pc18g00380, coding for a NRPS-like gene (NRPS-like7) was constantly expressed at 10 to 15% of the actin expression level without having acquired any mutations during CSI, and no known metabolite has...”

MAA_07148 Acyl carrier protein-like protein from Metarhizium robertsii ARSEF 23
30% identity, 18% coverage

• Genome sequencing and comparative transcriptomics of the model entomopathogenic fungi Metarhizium anisopliae and M. acridum
  Gao, PLoS genetics 2011
  • “...(MAA_07513), a virulence factor of the insect pathogen Beauveria bassiana [60] . The NRPS-like proteins MAA_07148 and MAC_06316 are most similar to ACE1, a PKS/NRPS hybrid that confers avirulence to M. grisea during rice infection [61] . M. anisopliae NRPS MAA_00969 is similar (43% identity) to...”

LOC113211558 3-oxoacyl-[acyl-carrier-protein] reductase FabG from Frankliniella occidentalis
32% identity, 85% coverage

• Comparative Proteomics of Resistant and Susceptible Strains of Frankliniella occidentalis to Abamectin
  Gholami, Electrophoresis 2025
  • “...402 XP_026277136.1 0.003 42.9 6.62/42.9 110.0 Galactokinaselike 244 XP_026286793.1 0.0512 46.0 8.14/46.0 532.4 Uncharacterized protein LOC113211558 306 XP_026285747.1 0.0002 27.0 8.60/27.0 65.5 ATPdependent RNA helicase 299 KAE8741845.1 0.0017 79.0 6.48/79.0 27.7 Hypothetical protein FOCC_FOCC017905 578 KAE8736640.1 0.0308 86.1 5.72/86.1 149.7 Putative aldehyde dehydrogenase family 7 member...”
  • “...is involved in growth regulation Galactokinaselike XP_026286793.1 +1.91 Unclassified metabolism/ galactose regulation Enzyme/Transferases Uncharacterized protein LOC113211558 XP_026285747.1 0.29 ATPdependent RNA helicase KAE8741845.1 0.30 Nucleotide metabolism/secondary structures of RNA molecules Enzyme/Hydrolases Hypothetical protein FOCC_FOCC017905 KAE8736640.1 +2.71 Putative aldehyde dehydrogenase family 7 member A1 homolog XP_026275375.1 +2.52 Carbohydrate...”

SARO_RS03965 SDR family NAD(P)-dependent oxidoreductase from Novosphingobium aromaticivorans DSM 12444
Saro_0794 short-chain dehydrogenase/reductase SDR from Novosphingobium aromaticivorans DSM 12444
32% identity, 61% coverage

• Aromatic Dimer Dehydrogenases from Novosphingobium aromaticivorans Reduce Monoaromatic Diketones
  Linz, Applied and environmental microbiology 2021
  • “...Strains containing individual in-frame deletions of ligL , ligN , ligD , and ligO (SARO_RS09390, SARO_RS03965, SARO_RS01025, and SARO_RS03960, respectively) were generated in a sacB mutant of wild-type strain DSM12444 using previously described plasmids and methods ( Table 2 ) ( 29 ). Briefly, strains of...”
  • “...CGAAAAGGCGCGAGTGATCTTCTTC ligN 09390 GCTATGCCGAATTTGCCCTGAC CTGTCGGGATATGCCATCTACATCTGG ligL In vitro enzyme assays. The genes ligL (SARO_RS09390), ligN (SARO_RS03965), and ligD (SARO_RS01025) were amplified from N. aromaticivorans DSM12444 and separately cloned into plasmid pVP302K ( 16 ) containing an N-terminal His 8 tag. The expression plasmids were transformed into...”
• Novosphingobium aromaticivorans uses a Nu-class glutathione S-transferase as a glutathione lyase in breaking the β-aryl ether bond of lignin
  Kontur, The Journal of biological chemistry 2018
  • “...-fold Saro_0205 SLG_08640, LigD (442; 78%) 11 3 Saro_0793 SLG_35880, LigO (224; 41%) 6 2 Saro_0794 SLG_35900, LigN (224; 45%) 9 1 Saro_1875 SLG_33660, LigL (261; 49%) 1 1 Saro_2091 SLG_08650, LigF (310; 59%) 8 1 Saro_2405 c SLG_08660, LigE (344; 61%) SLG_32600, LigP (391; 66%)...”

MUL_1543 ketoacyl reductase from Mycobacterium ulcerans Agy99
38% identity, 81% coverage

• Intrabacterial lipid inclusion-associated proteins: a core machinery conserved from saprophyte Actinobacteria to the human pathogen Mycobacterium tuberculosis
  Dargham, FEBS open bio 2023
  • “...synthase Nonessential MSMEG_4705 MAB_4544c MMAR_3835 MUL_3765 ML1244 RjosMsmeg Rv1544 Ketoacyl reductase Nonessential MSMEG_0737 MAB_1537c MMAR_2367 MUL_1543 ML0429c RjosMsmeg Rv0437c psd Phosphatidylserine decarboxylase Nonessential MSMEG_0861 MAB_0639c MMAR_0754 MUL_1386 ML0311c RjosMsmeg Rv3229c desA3 LinoleoylCoA desaturase Nonessential MSMEG_1743 MAB_2148 MMAR_1315 MUL_2565 RjosMsmeg Rv0154c fadE2 AcylCoA dehydrogenase Nonessential MSMEG_0102 MAB_0255...”

MMAR_2367 ketoacyl reductase from Mycobacterium marinum M
37% identity, 81% coverage

• Intrabacterial lipid inclusion-associated proteins: a core machinery conserved from saprophyte Actinobacteria to the human pathogen Mycobacterium tuberculosis
  Dargham, FEBS open bio 2023
  • “...Triacylglycerol synthase Nonessential MSMEG_4705 MAB_4544c MMAR_3835 MUL_3765 ML1244 RjosMsmeg Rv1544 Ketoacyl reductase Nonessential MSMEG_0737 MAB_1537c MMAR_2367 MUL_1543 ML0429c RjosMsmeg Rv0437c psd Phosphatidylserine decarboxylase Nonessential MSMEG_0861 MAB_0639c MMAR_0754 MUL_1386 ML0311c RjosMsmeg Rv3229c desA3 LinoleoylCoA desaturase Nonessential MSMEG_1743 MAB_2148 MMAR_1315 MUL_2565 RjosMsmeg Rv0154c fadE2 AcylCoA dehydrogenase Nonessential MSMEG_0102...”

SMb20214 putative oxidoreductase protein from Sinorhizobium meliloti 1021
35% identity, 70% coverage

• Members of the Sinorhizobium meliloti ChvI regulon identified by a DNA binding screen
  Bélanger, BMC microbiology 2013
  • “...150 132970 133119 inter SMb20119 putative site-specific recombinase F18 97 221089 221185 intra SMb20213 (upstream SMb20214) F19 67 492546 492612 intra SMb20478 putative dipeptide ABC transporter permease and ATP-binding protein F20 143 938297 938439 intra SMb21188 putative acyltransferase ( msbA2 operon) F21 141 1091213 1091353 intra...”

MAV_4791 dehydrogenase from Mycobacterium avium 104
MAV_RS23020 SDR family NAD(P)-dependent oxidoreductase from Mycobacterium avium 104
40% identity, 72% coverage

• MAV_4644 Interaction with the Host Cathepsin Z Protects Mycobacterium avium subsp. hominissuis from Rapid Macrophage Killing
  Lewis, Microorganisms 2019
  • “...MAV_4573 1G2 34.6 A0QLB4 MAV_RS21960 MAV_4644 1F2 29.0 A0QLI5 MAV_RS22305 MAV_4647 2G2 38.2 A0A0H2ZZ17 MAV_RS22320 MAV_4791 1D5 34.1 A0A0H2ZUD0 MAV_RS23020 MAV_4916 1A11 22.1 A0A0H3A2P2 MAV_RS23625 MAV_5140 1D2 40.9 A0A0H2ZXD2 MAV_RS24655 MAV_5205 2F8 38.4 A0A0H3A044 MAV_RS24970 microorganisms-07-00144-t002_Table 2 Table 2 Conserved domain analysis of MAV_4644 protein. Name...”
• MAV_4644 Interaction with the Host Cathepsin Z Protects Mycobacterium avium subsp. hominissuis from Rapid Macrophage Killing
  Lewis, Microorganisms 2019
  • “...MAV_RS21960 MAV_4644 1F2 29.0 A0QLI5 MAV_RS22305 MAV_4647 2G2 38.2 A0A0H2ZZ17 MAV_RS22320 MAV_4791 1D5 34.1 A0A0H2ZUD0 MAV_RS23020 MAV_4916 1A11 22.1 A0A0H3A2P2 MAV_RS23625 MAV_5140 1D2 40.9 A0A0H2ZXD2 MAV_RS24655 MAV_5205 2F8 38.4 A0A0H3A044 MAV_RS24970 microorganisms-07-00144-t002_Table 2 Table 2 Conserved domain analysis of MAV_4644 protein. Name Accession Description Amino Acids...”

YP_177255 3-oxoacyl-[acyl-carrier-protein] reductase from Bacillus clausii KSM-K16
32% identity, 84% coverage

• Thiopeptide biosynthesis featuring ribosomally synthesized precursor peptides and conserved posttranslational modifications
  Liao, Chemistry & biology 2009
  • “...599 Gura_3608 (YP_001232335), from Geobacter uraniireducens Rf4 27/39 radical SAM domain-containing protein tsrU 272 FabG (YP_177255), from B. clausii KSM-K16 36/51 dehydrogenase/reductase orf5 c 247 orf_L7 (CAN89623), from S. collinus 39/60 hypothetical protein orf6 c 1447 SsviA_010100017073 (ZP_03195299), from S. sviceus ATCC 29083 38/51 WD-40 repeat...”

ACP_0942 clavaldehyde dehydrogenase from Acidobacterium capsulatum ATCC 51196
29% identity, 94% coverage

• A novel metagenomic short-chain dehydrogenase/reductase attenuates Pseudomonas aeruginosa biofilm formation and virulence on Caenorhabditis elegans
  Bijtenhoorn, PloS one 2011
  • “...( Fig. 2A , lower panels). However, the Acidobacterium capsulatum homologous gene expressed on pBBR1MCS-5:: ACP_0942 in PAO1 did not affect motility (data not shown). 10.1371/journal.pone.0026278.g002 Figure 2 BpiB09 expression causes reduced motility and poor biofilm formation in PAO1. A ) Reduced swarming phenotypes (upper two...”

HVO_B0031 short-chain family oxidoreductase from Haloferax volcanii DS2
37% identity, 74% coverage

• D-xylose degradation pathway in the halophilic archaeon Haloferax volcanii
  Johnsen, The Journal of biological chemistry 2009
  • “...marker protein-30 (SMP-30) superfamily HVO_B0031, 2-deoxy-D-gluconate 3-dehydrogenase HVO_B0032, UDP-glucose 4-epimerase HVO_B0033, hypothetical protein...”

NP_001021765 DeHydrogenases, Short chain from Caenorhabditis elegans
29% identity, 91% coverage

• Domain selection combined with improved cloning strategy for high throughput expression of higher eukaryotic proteins
  Chen, BMC biotechnology 2007
  • “...Y40B1B.5 I 76-D4 254 no no 2171; 3250; 139167 139147 36%, (3251/8265, 278) (1254)# 1254 NP_001021765 Y47G6A.22 I 8-C1 142 no no 4140 no 46%, (5141/9149, 150) (1142)& 1142 NP_499813 T12D8.6 I 11-F6 327 no 209 231, 246 268 207227, 246266 5695, 1956, 95136, 136161 50%,...”

YPO1452 putative short chain dehydrogenase from Yersinia pestis CO92
28% identity, 88% coverage

• Phylogeny and Classification of Yersinia pestis Through the Lens of Strains From the Plague Foci of Commonwealth of Independent States
  Kutyrev, Frontiers in microbiology 2018
  • “...bp deletion in YPO0445 gene, ssp. ulegeica 88 bp deletion in the intergenic region between YPO1452 and YPO1453, ssp. hissarica 205 bp deletion in YPO2267, and for Talas strains 72 bp deletion in YPO2412, microtus strains 112 bp deletion in araC gene (designation of genes are...”

K7GE31 Dehydrogenase/reductase SDR family member 7B from Pelodiscus sinensis
34% identity, 61% coverage

• Genome Editing to Generate Sake Yeast Strains with Eight Mutations That Confer Excellent Brewing Characteristics.
  Chadani, Cells 2021
  • “...non-foam-forming isolate K7GE01 [ 8 ]. The genome-edited strains constructed in this study were K7GE21, K7GE31, and K7GE41. Yeast strains were cultivated at 30 C in yeast extract peptone dextrose medium containing 1% ( w/v ) Bacto yeast extract (BD Biosciences, Palo Alto, CA, USA), 2%...”
  • “...the pCAS-Pro-CAR1 plasmid to be spontaneously eliminated, producing the genome-edited strain, K7GE21. We constructed strains K7GE31 and K7GE41 in a similar manner by using pCAS-Pro-MDE1 and pCAS-Pro-FAS2 (G1250S) plasmids. 2.3. Whole-Genome Sequencing We extracted DNA from strains K7, K7GE01, K7GE21, K7GE31, and K7GE41 to determine their...”

F1LB38 3-oxoacyl-[acyl-carrier-protein reductase from Ascaris suum
33% identity, 78% coverage

• Characterisation of potential novel allergens in the fish parasite Anisakis simplex
  Fæste, EuPA open proteomics 2014
  • “...) Glucosamine-6-phosphate deaminase /PF01182 F1KZ94 2 92 10 ( Sac k ) ADP/ATP translocase /PF00153 F1LB38 5 71 15 ( Asc s ) 3-Oxoacyl-reductase AF028/PF00106 O17915 2 64 9 ( Asc s ) GTP-binding nuclear protein ran-1 /PF00071 F1KXW6 3 48 14 ( Cae e )...”

PEPE_RS00250 SDR family oxidoreductase from Pediococcus pentosaceus ATCC 25745
27% identity, 96% coverage

• Proteomic Profiling in <i>Pediococcus pentosaceus</i> SF11 Exposed to Condensed Tannins from Sainfoin
  Huang, ACS omega 2024
  • “...directly decreasing enzyme activity and reducing enzyme expression in P. pentosaceus SF11. FabG, coded by PEPE_RS00250, is involved in fatty acid biosynthesis. FabG is widely distributed in bacteria and is a key rate-limiting enzyme for fatty acid synthesis, and the structure and active center of this...”

CG31548 uncharacterized protein from Drosophila melanogaster
30% identity, 88% coverage

• Rosy Beginnings: Studying Peroxisomes in Drosophila
  Pridie, Frontiers in cell and developmental biology 2020
  • “...Acyl-CoA synthetase long-chain () B (+) H DECR2 CG3699 -Oxidation 17-Beta-estradiol 17-dehydrogenase () B DRS7B CG31548 -Oxidation 17-Beta-estradiol 17-dehydrogenase () B EPHX2 Pummelig ROS metabolism Carboxylesterase () B (+) HT HMGCL Hmgcl Amino acid metabolism Hydroxymethylglutaryl-CoA lyase (+) B HMGCR Hmgcr Isoprenoid synthesis HMG coenzyme A...”
• An RNAi Screen for Genes Required for Growth of Drosophila Wing Tissue
  Rotelli, G3 (Bethesda, Md.) 2019
  • “...screens in flies showed that CG12171 protein physically interacts with proteins encoded by CG31549 and CG31548 genes, both of which are also predicted to have steroid dehydrogenase activity ( Guruharsha et al. 2011 ). The protein products of these three genes are highly similar (6981% pairwise...”
• Glycogen branching enzyme controls cellular iron homeostasis via Iron Regulatory Protein 1 and mitoNEET
  Huynh, Nature communications 2019
  • “...2.4E-02 1.2 >0.05 146 Drat Response to hypoxia 2.9 1.6E-02 1.4 >0.05 1.6 1.1E-02 170 CG31548 Short-chain dehydrogenase/reductase 2.7 3.1E-02 1.8 >0.05 1.4 >0.05 173 CG32857 Nfu1 homolog/iron sulfur cluster assembly 2.7 3.7E-02 1.2 >0.05 1.2 >0.05 184 ance Ecdysone biosynthesis/zinc finger 2.7 3.7E-02 2.0 >0.05...”
• Neuron-specific protein interactions of Drosophila CASK-β are revealed by mass spectrometry
  Mukherjee, Frontiers in molecular neuroscience 2014
  • “...metabolism 3 TPI CG9391 INOS 0.305 Cellular homeostasis GO:0055114 Oxidation reduction 16 SOD2 IDH SSADH CG31548 PGD CG6084 TRXR CG7145 GPO GCLM SU(R) PDH CG3523 ZW GDH ADH GO:0045454 Cell redox homeostasis 6 PDI PRX5 ERP60 TRXR JAFRAC1 CG1837 0.065 Cellular process GO:0015992 Proton transport 3...”
• A protein complex network of Drosophila melanogaster
  Guruharsha, Cell 2011
  • “...Cluster #166 ( Supplemental Table S4 ) is made up of three members (CG12171, CG31549, CG31548) with a high average HGSCore (388). All three share a Glucose/ribitol dehydrogenase domain, a NAD(P)-binding domain, and Short-chain dehydrogenase/reductase (SDR) conserved sites. DPiM results suggest that these previously uncharacterized proteins...”
• Analysis of 14 BAC sequences from the Aedes aegypti genome: a benchmark for genome annotation and assembly
  Lobo, Genome biology 2007
  • “...30 AAEL007897 ENSANGG0000016631 5.1E-194 3R-29B Yes CG14928 6E-164 - 31 AAEL007893 ENSANGG00000018850 1.3E-175 2R-12C - CG31548 2.3E-137 - 32 AAEL007907 ENSANGG00000015978 1.7E-200 3R-29B Yes CG4629 1.3E-144 - 11 33 AAEL002503 ENSANGG00000015084 3.8E-092 X-1B Yes CG1989 3E-082 Yes 34 AAEL002532 ENSANGG00000015036 4.4E-250 X-1B Yes CG3707 6.3E-285 -...”

SDR-1 / D2WKD9 NADP+-dependent farnesol dehydrogenase 1 monomer (EC 1.1.1.216) from Aedes aegypti (see paper)
SDR1_AEDAE / D2WKD9 Farnesol dehydrogenase; NADP(+)-dependent farnesol dehydrogenase 1; AaSDR-1; EC 1.1.1.216 from Aedes aegypti (Yellowfever mosquito) (Culex aegypti) (see paper)
D2WKD9 farnesol dehydrogenase (NADP+) (EC 1.1.1.216) from Aedes aegypti (see paper)
27% identity, 94% coverage

• function: Mediates oxidation of farnesol into farnesal, a precursor of juvenile hormone in the corpora allata (CA), the glands that synthesize juvenile hormone. Able to oxidize C(10) to C(15) isoprenoid and aliphatic alcohols.
  catalytic activity: (2E,6E)-farnesol + NADP(+) = (2E,6E)-farnesal + NADPH + H(+) (RHEA:14697)
  subunit: Homodimer.
• Mevalonate-Farnesal Biosynthesis in Ticks: Comparative Synganglion Transcriptomics and a New Perspective
  Zhu, PloS one 2016
  • “...capitata 1e-99 XP_002068852.1 (56%) XP_004523325.1 (56%) A . aegypti 4 3e-12 A . aegypti 8e-21 D2WKD9 (25%) D2WKD9 (32%) Farnesal NA NA NA NA NA NA NA NA NA Farnesal Dehydrogenase Farnesoic acid 19251/KT602364 B . mori 4e-25 24500/KT728822 A . darlingi 4e-24 16407/KT602371 A ....”

D2WKE0 NADP+-dependent farnesol dehydrogenase 2 from Aedes aegypti
28% identity, 94% coverage

• Expression of the mevalonate pathway enzymes in the Lutzomyia longipalpis (Diptera: Psychodidae) sex pheromone gland demonstrated by an integrated proteomic approach
  González-Caballero, Journal of proteomics 2014
  • “...synthase family Rhopalosiphum padi 2 Polyprenyl synthetase (Pfam) Terpenoid synthases (SUPERFAMILY) NADP+-dependent farnesol dehydrogenase (1.1.1.216) D2WKE0 NADP+-dependent farnesol dehydrogenase 1 Belongs to the short-chain dehydrogenases/reductases (SDR) family. + LL-314 Predicted dehydrogenase/Kog database 8 Protein with putative dehydrogenase domain + Q7Q6V7 AGAP005645-PA Belongs to the short-chain dehydrogenases/reductases...”

Q71R50 Dehydrogenase/reductase SDR family member 11 from Gallus gallus
28% identity, 93% coverage

• Reconstruction of insect hormone pathways in an aquatic firefly, Sclerotia aquatilis (Coleoptera: Lampyridae), using RNA-seq.
  Chanchay, PeerJ 2019
  • “...0 0 Q2T9S4 1 0 3 1 K15890 FOHSDR 56 Q3U0B3 23 10 8 0 Q71R50 13 2 2 4 Q3ZBV9 8 14 14 23 Q6UWP2 11 3 4 3 K00128 ALDH 23 Q60HH8 3 0 1 0 P43353 2 0 0 0 P11884 2 1...”

SNOG_07126 hypothetical protein from Parastagonospora nodorum SN15
29% identity, 19% coverage

• A genome-wide survey of the secondary metabolite biosynthesis genes in the wheat pathogen Parastagonospora nodorum.
  Chooi, Mycology 2014
  • “...teres PTT_06870 (70%) SNOG_04863 C-A Pyrenophora teres PTT_16992 (62%) SNOG_07021 A-T-C Pyrenophora teres PTT_13470 (69%) SNOG_07126 A-T-R-R L. maculans Maa1 (85%) SNOG_14368 A-T-C-T-T-C L. maculans LEMA_P070680 (71%) Notes: NRPS domain abbreviation A, adenylation; T, thiolation; C, condensation; TE, thioesterase, R, reductase. See Finking and Marahiel (...”
  • “...23). On the other hand, the SNOG_07120 locus is in vicinity of a NRPS gene (SNOG_07126) and thus may be a terpene alkaloid gene cluster (Supplemental Table 2, cluster 15). Future perspectives In summary, the whole-genome survey of the SM gene inventory of P. nodorum shows...”

BOA17_BOTFB / A6SSW9 Oxidoreductase BOA17; Botcinic acid biosynthesis cluster B protein 17; EC 1.-.-.- from Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea) (see 2 papers)
34% identity, 67% coverage

• function: Oxidoreductase; part of the gene cluster B that mediates the biosynthesis of botcinic acid and its botcinin derivatives, acetate- derived polyketides that contribute to virulence when combined with the sesquiterpene botrydial (PubMed:21722295). Botcinic acid and its derivatives have been shown to induce chlorosis and necrosis during host plant infection, but also have antifungal activities (PubMed:21722295). Two polyketide synthases, BOA6 and BOA9, are involved in the biosynthesis of botcinins. BOA6 mediates the formation of the per-methylated tetraketide core by condensation of four units of malonyl-CoA with one unit of acetyl-CoA, which would be methylated in activated methylene groups to yield a bicyclic acid intermediate that could then either be converted to botrylactone derivatives or lose the starter acetate unit through a retro-Claisen type C-C bond cleavage to yield botcinin derivatives (PubMed:23203902). The second polyketide synthase, BOA9, is probably required for the biosynthesis of the tetraketide side chain of botcinins (Probable). The methyltransferase (MT) domain within BOA6 is probably responsible for the incorporation of four methyl groups (Probable). The trans-enoyl reductase BOA5 might take over the enoyl reductase function of BOA6 that misses an ER domain (Probable). The monooxygenases BOA2, BOA3 and BOA4 might be involved in further hydroxylations at C4, C5 and C8, whereas BOA7, close to BOA9, could potentially be involved in the hydroxylation at C4 in the side chain of botcinins (Probable).

lmo1976 similar to oxidoreductase from Listeria monocytogenes EGD-e
31% identity, 90% coverage

• The ABC transporter AnrAB contributes to the innate resistance of Listeria monocytogenes to nisin, bacitracin, and various beta-lactam antibiotics
  Collins, Antimicrobial agents and chemotherapy 2010
  • “...(NSL C9; ATP-binding component of an ABC transporter), lmo1976 (NSL D6; similar to oxidoreductase), lmo2115 (NSL B8; ABC transporter permease), and lmo2840 (NSL...”
  • “...mutants, including lmo0290 (E), lmo0540 (), lmo1694 (), lmo1976 (f), lmo2115 (), and lmo2840 (}) mutants (2% inoculum), in TSB-YE containing 200 g/ml Nisaplin....”
• Glycerol metabolism and PrfA activity in Listeria monocytogenes
  Joseph, Journal of bacteriology 2008
  • “...tyrA hisC lmo1926 aroB aroF gpsA lysA fhuC lmo1976 lmo1978 ilvD ilvB leuA leuBb lmo2075 lmo2110 lmo2114 lmo2152 lmo2153 lmo2192b lmo2193b lmo2194b lmo2195b...”

RLV_2389 SDR family oxidoreductase from Rhizobium leguminosarum bv. viciae
29% identity, 93% coverage

• Proteome Analysis Reveals a Significant Host-Specific Response in Rhizobium leguminosarum bv. viciae Endosymbiotic Cells
  Durán, Molecular & cellular proteomics : MCP 2021
  • “...43.9 RLV_1962 pRlvC Uptake hydrogenase small subunit hupS 12.8 RLV_2267 pRlvE Putative methylmalonyl-CoA mutase 11.8 RLV_2389 pRlvE Ribitol dehydrogenase 28.1 RLV_3444 Chr Metal ABC transporter substrate-binding 50.6 RLV_3820 Chr Molecular chaperone GroEL 24.2 RLV_4312 Chr Sugar ABC transporter substrate-binding 11.4 RLV_4318 Chr Oxidoreductase 13.5 RLV_4716 Chr...”

DHR11_HUMAN / Q6UWP2 Dehydrogenase/reductase SDR family member 11; 17-beta-hydroxysteroid dehydrogenase; 3-beta-hydroxysteroid 3-dehydrogenase; Estradiol 17-beta-dehydrogenase; Short-chain dehydrogenase/reductase family 24C member 1; EC 1.1.1.270; EC 1.1.1.62 from Homo sapiens (Human) (see paper)
27% identity, 91% coverage

• function: Catalyzes the conversion of the 17-keto group of estrone, 4- and 5-androstenes and 5-alpha-androstanes into their 17-beta- hydroxyl metabolites and the conversion of the 3-keto group of 3-, 3,17- and 3,20- diketosteroids into their 3-hydroxyl metabolites. Exhibits reductive 3-beta-hydroxysteroid dehydrogenase activity toward 5-beta-androstanes, 5-beta-pregnanes, 4-pregnenes and bile acids. May also reduce endogenous and exogenous alpha-dicarbonyl compounds and xenobiotic alicyclic ketones.
  catalytic activity: a 3beta-hydroxysteroid + NADP(+) = a 3-oxosteroid + NADPH + H(+) (RHEA:34787)
  catalytic activity: 17beta-estradiol + NAD(+) = estrone + NADH + H(+) (RHEA:24612)
  catalytic activity: 17beta-estradiol + NADP(+) = estrone + NADPH + H(+) (RHEA:24616)
  subunit: Homotetramer.
• Evaluation of Colon-Specific Plasma Nanovesicles as New Markers of Colorectal Cancer.
  Nazarova, Cancers 2021
  • “...0.78 PDCD6IP Q8WUM4 36.8 ***** 10015 5.7 4.1 ns 0.6 2.5 1.7 ns 0.66 DHRS11 Q6UWP2 38.7 ** 360583 7.7 3.2 ns 0.63 2.7 1.4 ns 0.68 1 Fold of increase in Normalized eXpression (NX) levels for specific proteins in the colon epithelium vs. any other...”
• Proteomics-Based Detection of Immune Dysfunction in an Elite Adventure Athlete Trekking Across the Antarctica.
  Nieman, Proteomes 2020
  • “...0.744 0.003 0.051 CPPED1 Q9BRF8 calcineurin like phosphoesterase domain containing 1 0.773 0.003 0.052 DHRS11 Q6UWP2 dehydrogenase/reductase 11 0.794 0.005 0.071 ADK P55263 adenosine kinase 0.837 0.002 0.043 STMN2 Q93045 stathmin 2 0.860 0.001 0.024 FSCB Q5H9T9 fibrous sheath CABYR binding protein 0.891 0.004 0.063 EEF2...”
• Reconstruction of insect hormone pathways in an aquatic firefly, Sclerotia aquatilis (Coleoptera: Lampyridae), using RNA-seq.
  Chanchay, PeerJ 2019
  • “...Q3U0B3 23 10 8 0 Q71R50 13 2 2 4 Q3ZBV9 8 14 14 23 Q6UWP2 11 3 4 3 K00128 ALDH 23 Q60HH8 3 0 1 0 P43353 2 0 0 0 P11884 2 1 1 0 Q8IZ83 2 0 0 0 Q2XQV4 2 0...”
• Proteomics-based insights into mitogen-activated protein kinase inhibitor resistance of cerebral melanoma metastases
  Zila, Clinical proteomics 2018
  • “...P53 expression, changing cell cycle and enhancing the anti-apoptotic capability of cells [ 88 ] Q6UWP2 Dehydrogenase/reductase SDR family member 11 DHRS11 2.10 1.64E07 * Involved in estrogen biosynthesis, which is part of steroid biosynthesis [ 89 ]; proposed role in sex hormone, neurosteroid, androgen, estrogen...”
• Quantitative proteomics reveals that distant recurrence-associated protein R-Ras and Transgelin predict post-surgical survival in patients with Stage III colorectal cancer
  Xu, Oncotarget 2016
  • “...1.0 1.0 0.4 0.5 1.0 1.5 1.0 0.9 0.4 36.0 33.1 3.0 14.4 25.2 40.0 Q6UWP2 Dehydrogenase/reductase SDR family member 11 GN=DHRS11 13.4 14.3 9.6 5.0 1.0 1.0 0.4 0.5 1.0 1.1 1.0 1.7 5.8 16.2 12.8 9.3 1.9 3.4 28.3 P04066 Tissue alpha-L-fucosidase GN=FUCA1 12.1...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014
• The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
  Persson, Chemico-biological interactions 2009
  • “...Methionine adenosyltransferase MAT2B_HUMAN Q9NZL9 SDR23E1 Methionine adenosyltransferase 2 subunit beta SDR24C Dehydrogenase/reductase SDR family DHR11_HUMAN Q6UWP2 SDR24C1 Dehydrogenase/reductase SDR family member 11 SDR25C Dehydrogenase/reductase SDR family DHRS2_HUMAN Q13268 SDR25C1 Dehydrogenase/reductase SDR family member 2 DHRS4_HUMAN Q9BTZ2 SDR25C2 Dehydrogenase/reductase SDR family member 4 NP_001075957 SDR25C3 Similar to...”

LOC101264635 11-beta-hydroxysteroid dehydrogenase A from Solanum lycopersicum
33% identity, 62% coverage

• A metabolome and transcriptome survey to tap the dynamics of fruit prolonged shelf-life and improved quality within Greek tomato germplasm
  Mellidou, Frontiers in plant science 2023
  • “...differences may be attributed to the up-regulation of four genes in LSL, including 11--hydroxysteroid dehydrogenase (LOC101264635), 3--hydroxysteroid-Delta(8), Delta(7)-isomerase (LOC101259646), squalene monooxygenase (LOC101250012), and a 2-oxoglutarate-dependent dioxygenase (LOC101246594) ( Supplementary Table10 ). The latter gene corresponds to GAME31 (Solyc02g062460) that catalyzes the hydroxylation of the bitter flavor...”

B0VT18 NADP-dependent 3-hydroxy acid dehydrogenase YdfG from Acinetobacter baumannii (strain SDF)
ABSDF0838 putative Oxidoreductase, short chain dehydrogenase/reductase family from Acinetobacter baumannii SDF
33% identity, 72% coverage

• Subtractive proteomics to identify novel drug targets and reverse vaccinology for the development of chimeric vaccine against Acinetobacter baumannii
  Solanki, Scientific reports 2018
  • “...B0VTY3 DB03461 2-Monophosphoadenosine 5-Diphosphoribose 2.14867E-26 100.908 233 10 Putative Oxidoreductase, short chain dehydrogenase /reductase family B0VT18 DB00157 NADH 7.13808E-28 106.301 186 11 Putative acetyl-coA synthetase/AMP-(Fatty) acid ligase B0VNG2 DB00131, DB00171, DB09395 Adenosine monophosphate, ATP, Sodium acetate 2.32E-70 236.884 568 Pathway independent protein target The 358 metabolic...”
  • “...membrane, periplasmic 439 7 B0VTM9 Pyridoxine 5-phosphate synthase 0 25.895 polxJ Cytoplasm Cytoplasm 241 8 B0VT18 Putative Oxidoreductase, short chain dehydrogenase/reductase family 0 28.797 ABSDF0838 Cytoplasm Cytoplasm, outer membrane 260 9 B0VMS1 Putative UDP-glucose 6-dehydrogenase (Ugd) (Udg) 0 47.099 ABSDF0080 Cytoplasm Cytoplasm 420 10 B0VNG2 Putative...”
• Subtractive proteomics to identify novel drug targets and reverse vaccinology for the development of chimeric vaccine against Acinetobacter baumannii
  Solanki, Scientific reports 2018
  • “...25.895 polxJ Cytoplasm Cytoplasm 241 8 B0VT18 Putative Oxidoreductase, short chain dehydrogenase/reductase family 0 28.797 ABSDF0838 Cytoplasm Cytoplasm, outer membrane 260 9 B0VMS1 Putative UDP-glucose 6-dehydrogenase (Ugd) (Udg) 0 47.099 ABSDF0080 Cytoplasm Cytoplasm 420 10 B0VNG2 Putative acetyl-coA synthetase/AMP-(Fatty) acid ligase 0 60.541 Absdf0123 Cytoplasm Periplasmic,...”

Q6IAN0 Dehydrogenase/reductase SDR family member 7B from Homo sapiens
NP_056325 dehydrogenase/reductase SDR family member 7B isoform 1 from Homo sapiens
33% identity, 65% coverage

• Secretory Carrier Membrane Protein 3 Interacts with 3A Viral Protein of Enterovirus and Participates in Viral Replication.
  Lu, Microbiology spectrum 2021
  • “...3 5.05 Q9Y394 DHRS7 Dehydrogenase/reductase SDR family member 7 38.3 123.1 2 2 2 7.08 Q6IAN0 DHRS7B Dehydrogenase/reductase SDR family member 7B 35.1 387.9 5 5 7 20.00 Q96DA6 DNAJC19 Mitochondrial import inner membrane translocase subunit TIM14 12.5 215.6 2 2 3 28.45 Q9H3H5 DPAGT1 UDP-...”
• Progression of Osteosarcoma from a Non-Metastatic to a Metastatic Phenotype Is Causally Associated with Activation of an Autocrine and Paracrine uPA Axis.
  Endo-Munoz, PloS one 2015
  • “...Q96BD0 24.13 EPDR1 Mammalian ependymin-related protein 1 Q9UM22 23.48 DHRS7B Dehydrogenase/reductase SDR family member 7B Q6IAN0 14.10 CDCP1 CUB domain-containing protein 1 Q9H5V8 10.16 NRP1 Neuropilin-1 O14786 9.35 SERPINB6 Serpin B6 P35237 7.13 SPRY4 Protein sprouty homolog 4 Q9C004 6.52 C. Secretomic analysis (RayBio Biotin Label-based...”
• The interactome of the human respiratory syncytial virus NS1 protein highlights multiple effects on host cell biology
  Wu, Journal of virology 2012
  • “...Q9Y6D5 Q9BWU1 Q05048 P24863 Q14204 Q13409 Q9Y6G9 O43237 Q6IAN0 P24928 Q9NXW2 Q9HAV4 P51648 Q9Y2I7 Q8N9F7 Q9H583 O15397 Q9Y2U9 P27544 Q16850 Q8WVP7 P33121 O95573...”
• The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
  Persson, Chemico-biological interactions 2009
  • “...SDR31E Sterol-4-alpha-carboxylate 3-dehydrogenase NSDHL_HUMAN Q15738 SDR31E1 Sterol-4-alpha-carboxylate 3-dehydrogenase SDR32C Dehydrogenase/reductase (SDR family) member 7B DRS7B_HUMAN Q6IAN0 SDR32C1 Dehydrogenase/reductase (SDR family) member 7B DRS7C_HUMAN A6NNS2 SDR32C2 Dehydrogenase/reductase SDR family member 7C precursor SDR33C Dihydropteridine reductase DHPR_HUMAN P09417 SDR33C1 Dihydropteridine reductase SDR34C Dehydrogenase/reductase SDR family DHRS7_HUMAN Q9Y394 SDR34C1...”
• The presence of plasmenyl ether lipids in Capsaspora owczarzaki suggests a premetazoan origin of plasmalogen biosynthesis in animals
  , Heliyon 2024
  • “...C. owczarzaki KJE89098, H. sapiens NP_003650; DHRS7B: L. elongata KAF9292753, C. owczarzaki XP_004348163, H. sapiens NP_056325; EPT1: F. alba XP_9494251, T. harzianum XP_024774613, Linnemannia zychae KAF9922440, Blastocladiella britannica KAI9222539, S. arctica XP_014158253, C. owczarzaki XP_011269962, H. sapiens NP_277040; CEPT1: F. alba XP_009494186, Aspergillus parasiticus KAB8205464, Irpex...”

GL50803_14626 Oxidoreductase, short chain dehydrogenase/reductase family from Giardia intestinalis
35% identity, 60% coverage

• The proteome landscape of Giardia lamblia encystation
  Faso, PloS one 2013
  • “...y GL50803_16217 UDP-N-acetylglucosamine pyrophosphorylase - - - - - - 2 6 - - - GL50803_14626 Oxidoreductase, short chain dehydrogenase - - - - - - 2 2 - y - GL50803_8377 Hypothetical protein - - - - - - 2 - - - y Total...”

Q9X248 3-oxoacyl-[acyl-carrier-protein] reductase FabG from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
29% identity, 86% coverage

• Comparative genome analysis of filamentous fungi reveals gene family expansions associated with fungal pathogenesis.
  Soanes, PloS one 2008
  • “...sterigmata protein A (Q00083) MCL3547 dynein light intermediate chain 2, cytosolic (O43237) MCL3573 3-oxoacyl-[acyl-carrier-protein] reductase (Q9X248) MCL3665 dedicator of cytokinesis protein 1 (Q14185) MCL3670 ketosamine-3-kinase (Q8K274) MCL3770 unknown MCL3945 integrin beta-1 binding protein 2 (Q9R000) MCL4010 dynactin p62 family (PF05502) MCL4033 citrate lyase beta chain (O53078)...”

AbA118F_3481 SDR family NAD(P)-dependent oxidoreductase from Acinetobacter baumannii
32% identity, 73% coverage

• Cerebrospinal fluid (CSF) augments metabolism and virulence expression factors in Acinetobacter baumannii
  Martinez, Scientific reports 2021
  • “...1.67 6.2 E-71 SSU ribosomal protein S8p (S15Ae) AbA118F_3258 bauA 1.67 1.9 E-11 Ferrichrome-iron receptor AbA118F_3481 1.67 3.4 E-14 Oxidoreductase, short-chain dehydrogenase/reductase family AbA118F_3201 1.66 2.9 E-02 hypothetical protein AbA118F_1820 1.66 9.5E-72 LSU ribosomal protein L1p (L10Ae) AbA118F_1821 1.64 2.3 E-69 LSU ribosomal protein L11p (L12e)...”

CG3699 uncharacterized protein from Drosophila melanogaster
28% identity, 92% coverage

• Phenotyping of Drosophila Melanogaster-A Nutritional Perspective
  Eickelberg, Biomolecules 2022
  • “...( CycA , brat , osk , pum , orb , tun , RnrS , CG3699 , CG10962 ) Neurophysiological mechanisms ( Fsn , lola , tyf ) Fat storage ( dob ) Rivera et al. [ 157 ] Control diet Food mix (New Horizon Foods)...”
• Dietary Macronutrient Imbalances Lead to Compensatory Changes in Peripheral Taste via Independent Signaling Pathways
  Ganguly, The Journal of neuroscience : the official journal of the Society for Neuroscience 2021 (secret)
• Rosy Beginnings: Studying Peroxisomes in Drosophila
  Pridie, Frontiers in cell and developmental biology 2020
  • “...Long-chain-fatty-acidCoA ligase () B ACSL3/4 Acsl -Oxidation Acyl-CoA synthetase long-chain () B (+) H DECR2 CG3699 -Oxidation 17-Beta-estradiol 17-dehydrogenase () B DRS7B CG31548 -Oxidation 17-Beta-estradiol 17-dehydrogenase () B EPHX2 Pummelig ROS metabolism Carboxylesterase () B (+) HT HMGCL Hmgcl Amino acid metabolism Hydroxymethylglutaryl-CoA lyase (+) B...”
• A high-fat diet impacts memory and gene expression of the head in mated female Drosophila melanogaster
  Rivera, Journal of comparative physiology. B, Biochemical, systemic, and environmental physiology 2019
  • “...as per ontology were also identified, such as Ribonucleoside diphosphate reductase small subunit ( RnrS), CG3699 and CG10962 , the downregulation of which could be contributing to pathology due to high oxidative stress associated with obesity (Shigeteda et al. 2004). In flies, neuronal overexpression of dhd,...”
  • “.... Meanwhile, while consistent downregulation between the studies was less frequent, the clearest example was CG3699 . Also in the RNA-Seq study, there was upregulation of Hsp26 and Hsp27 during HFD exposure in mated female fly heads, whereas presently we find a downregulation. Still other differentially...”
• Genomic changes associated with adaptation to arid environments in cactophilic Drosophila species
  Rane, BMC genomics 2019
  • “...excess, mainly enzymes involved in detox DBUZO2012733 NA Cytochrome P450 DBUZO2012084 NA S1 peptidase DBUZO2011594 CG3699 Short-chain dehydrogenase/reductase, involved in fatty-acid beta-oxidation DBUZO2009194 NA Cytochrome P450 DBUZO2005738 CG31087 ( DUF227 ) Involved in neurogenesis DBUZO2005447 alpha-Esterase-5 ( alpha-Est5 ) Type B carboxylesterase DBUZO2002940 Maltase A4 (...”
• Do the genes of the innate immune response contribute to neuroprotection in Drosophila?
  Cantera, Journal of innate immunity 2015
  • “...CecC, CG11459, CG13422, CG16978, CG17107, CG17760, CG33109, CG3699, CG4269, CG42807, CG6639, CG6788, CG7738, CG9616, CG9733, Cyp316a1, Cyp6g1, Def, Dpt, DptB,...”
  • “...CG13641, CG15282, CG15784, CG16718, CG34370, CG3604, CG3699, CG42351, CG4269, CG4757, CG8129, Cyp28d1, deltaTry, kn, Lsp1beta, mus209, PGRP-LC, PGRP-SD,...”
• The Genomic Basis of Postponed Senescence in Drosophila melanogaster
  Carnes, PloS one 2015
  • “...P -value exceeding a Bonferroni correction for multiple tests: CG18031 , CG42340 , CG11378 , CG3699 and mus81 in females; Insulin-like peptide 6 ( Ilp6 ), Cytochrome P450-4d1 ( Cyp4d1 ), silver ( svr ), female sterile (1) Nasrat ( fs(1)N ), CG2854 , CG13868 ,...”
  • “...functional annotation for the majority of these genes ( CG18031 , CG42340 , CG11378 , CG3699 , Cyp4d1 , CG2854 , CG13868 , CG6428 , CG7713 , CG33307 ). While the others have not been implicated to affect lifespan previously, most are plausible candidates because they...”
• Chronic low-dose γ-irradiation of Drosophila melanogaster larvae induces gene expression changes and enhances locomotive behavior
  Kim, Journal of radiation research 2015
  • “...1.5812901 NM_001015405 chr3LHet:1140421-1140362 CG3597 1.5520066 NM_134830 chr2L:2370297-2370238 dm|2L22E1 CYP4E3 2.14801 NM_078803 Cytochrome P450-4e3 chr2L:9747958-9747899 dm|2L30C7 CG3699 1.540999 NM_130519 chrX:840783-840724 dm|X1D2 FBP2 18.835476 NM_078798 Fat body protein 2 chr2L:9427743-9427802 dm|2L30B3 CG31810 1.987148 NM_165198 chr2L:16849144-16849085 dm|2L36B2 EO 1.5894746 NM_132758 Ecdysone oxidase chrX:14810875-14810816 dm|X13A1 PROPO-A1 1.5037334 NM_057464 prophenol oxidase...”
• More

1xg5C / Q6UWP2 Structure of human putative dehydrogenase mgc4172 in complex with nadp
26% identity, 91% coverage

• Ligand: nadp nicotinamide-adenine-dinucleotide phosphate (1xg5C)

Q10782 Possible ketoacyl reductase from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Rv1544 Possible ketoacyl reductase from Mycobacterium tuberculosis H37Rv
35% identity, 81% coverage

• The unfoldase ClpC1 of Mycobacterium tuberculosis regulates the expression of a distinct subset of proteins having intrinsically disordered termini
  Lunge, The Journal of biological chemistry 2020 (secret)
• Intrabacterial lipid inclusion-associated proteins: a core machinery conserved from saprophyte Actinobacteria to the human pathogen Mycobacterium tuberculosis
  Dargham, FEBS open bio 2023
  • “...MAB_2455c MMAR_3834 MUL_3764 ML1245 RjosMsmeg Rv2484c Triacylglycerol synthase Nonessential MSMEG_4705 MAB_4544c MMAR_3835 MUL_3765 ML1244 RjosMsmeg Rv1544 Ketoacyl reductase Nonessential MSMEG_0737 MAB_1537c MMAR_2367 MUL_1543 ML0429c RjosMsmeg Rv0437c psd Phosphatidylserine decarboxylase Nonessential MSMEG_0861 MAB_0639c MMAR_0754 MUL_1386 ML0311c RjosMsmeg Rv3229c desA3 LinoleoylCoA desaturase Nonessential MSMEG_1743 MAB_2148 MMAR_1315 MUL_2565 RjosMsmeg...”
  • “...(Pks13), Rv2524c (Fas), Rv0400c (FadE7), Rv0824c (DesA1), Rv2501c (AccA1), and Rv2247 (AccD6). Three additional proteins, Rv1544, Rv3720, and Rv0437c, annotated as putative ketoacyl reductase, fattyacylphospholipid synthase, and phosphatidylserine decarboxylase, respectively, were also identified. A simplified representation of the potential implication of these enzymes in Mtb lipid...”
• Dissecting the antibacterial activity of oxadiazolone-core derivatives against Mycobacterium abscessus
  Madani, PloS one 2020
  • “...- Probable methyltransferase IM/R MAB_4201c 22.905 Rv3574 WCL Transcriptional regulatory protein KstR RP MAB_4750 27.932 Rv1544 M/WCL Possible ketoacyl reductase LM In bold , the 5 proteins identified at a pFDR of 1%. a From [ 44 , 45 ]. b CF: Culture filtrate; CW: Cell...”
• One-Year Old Dormant, "Non-culturable" Mycobacterium tuberculosis Preserves Significantly Diverse Protein Profile
  Trutneva, Frontiers in cellular and infection microbiology 2020
  • “...Rv0211 130 7 Membrane Probable short-chain type oxidoreductase Rv0484c N/D 7 Membrane Possible ketoacyl reductase Rv1544 N/D 7 Membrane DNA-binding protein HU homolog HupB (histone-like protein) (HLP) (21-kDa laminin-2-binding protein) Rv2986c N/D 7 Cytosol Probable acetohydroxyacid synthase IlvX (acetolactate synthase) Rv3509c 83 8 Cytosol Probable NAD(P)...”
• Extracellular Vesicles in Mycobacterial Infections: Their Potential as Molecule Transfer Vectors
  Wang, Frontiers in immunology 2019
  • “...Rv0063, Rv0148, AtsA, MycP3, AtpA, Qor, Ag85A, FadA3, Ag85C, AccA3, Ag85B, MPT51, FadA2, EchA21, FadD13, Rv1544, FadE4, maA4, FadB, SodB, HspX, EphG, Rv3722c, Rv0831c, Rv2159c, ppe41, Rv3099c, Rv3717, Rv3169 ( 65 ) M. bovis BCG Bronchoalveolar lavage fluid of mice ( in vivo ) 19-kDa lipoprotein...”
• A novel in vitro multiple-stress dormancy model for Mycobacterium tuberculosis generates a lipid-loaded, drug-tolerant, dormant pathogen
  Deb, PloS one 2009
  • “...h of nutrient starvation but no induction was reported for the fcr2 (Rv1543) or fcr3 (Rv1544) under that starvation condition [21] . Variable expression profile of different tgs or fcr genes under different stresses raise the possibility that lipid accumulation under different stress conditions might use...”

Saro_1875 short-chain dehydrogenase/reductase SDR from Novosphingobium aromaticivorans DSM 12444
SARO_RS09390 SDR family NAD(P)-dependent oxidoreductase from Novosphingobium aromaticivorans DSM 12444
35% identity, 66% coverage

• Stereoinversion via Alcohol Dehydrogenases Enables Complete Catabolism of β-1-Type Lignin-Derived Aromatic Isomers
  Kato, Applied and environmental microbiology 2023 (secret)
• Novosphingobium aromaticivorans uses a Nu-class glutathione S-transferase as a glutathione lyase in breaking the β-aryl ether bond of lignin
  Kontur, The Journal of biological chemistry 2018
  • “...3 Saro_0793 SLG_35880, LigO (224; 41%) 6 2 Saro_0794 SLG_35900, LigN (224; 45%) 9 1 Saro_1875 SLG_33660, LigL (261; 49%) 1 1 Saro_2091 SLG_08650, LigF (310; 59%) 8 1 Saro_2405 c SLG_08660, LigE (344; 61%) SLG_32600, LigP (391; 66%) 17 9 Saro_2595 MBENS4_2527, GST3 (135; 38%)...”
• Aromatic Dimer Dehydrogenases from Novosphingobium aromaticivorans Reduce Monoaromatic Diketones
  Linz, Applied and environmental microbiology 2021
  • “...mutants. Strains containing individual in-frame deletions of ligL , ligN , ligD , and ligO (SARO_RS09390, SARO_RS03965, SARO_RS01025, and SARO_RS03960, respectively) were generated in a sacB mutant of wild-type strain DSM12444 using previously described plasmids and methods ( Table 2 ) ( 29 ). Briefly, strains...”
  • “...03965 CGCGAACTTGGTGGTATTGTAGATGC CGAAAAGGCGCGAGTGATCTTCTTC ligN 09390 GCTATGCCGAATTTGCCCTGAC CTGTCGGGATATGCCATCTACATCTGG ligL In vitro enzyme assays. The genes ligL (SARO_RS09390), ligN (SARO_RS03965), and ligD (SARO_RS01025) were amplified from N. aromaticivorans DSM12444 and separately cloned into plasmid pVP302K ( 16 ) containing an N-terminal His 8 tag. The expression plasmids were...”

ABO_1918 short-chain dehydrogenase/reductase family from Alcanivorax borkumensis SK2
35% identity, 63% coverage

• Point Mutations Lead to Increased Levels of c-di-GMP and Phenotypic Changes to the Colony Biofilm Morphology in Alcanivorax borkumensis SK2
  Prasad, Microbes and environments 2019
  • “...Position Locus tag Gene Name Strand Pos. in gene Ref. Rough Smooth Product Mutation 1253293 ABO_1918 acdS (ABO_1918) + 548 G G Ins AGGTG butyryl-CoA dehydrogenase Shorten ORF 2460898 ABO_2154 degU (ABO_2154) + 326 T A T transcriptional regulatory protein degU V109E 3041608 ABO_2691 + 2795...”

BMD_2094 short-chain dehydrogenase from Bacillus megaterium DSM319
33% identity, 71% coverage

• Advances on (+)-nootkatone microbial biosynthesis and its related enzymes
  Li, Journal of industrial microbiology & biotechnology 2021
  • “...( 2018 ), Ouyang et al. ( 2019 ), Wriessnegger et al. ( 2014 ) BMD_2094 Bacillus megaterium Milhim et al. ( 2019 ) Reductase Putidaredoxin reductase (PdR) Pseudomonas putida Girhard et al. ( 2009 ) CYP450s Cytochrome P450s (CYPs) are a common enzyme in the...”

LNN31_11860 SDR family oxidoreductase from Acetobacterium wieringae
29% identity, 80% coverage

• Anaerobic Biohydrogenation of Isoprene by Acetobacterium wieringae Strain Y
  Jin, mBio 2022
  • “...Five of 10 SDRs were closely related to the SDR family, while only one protein (LNN31_11860) was surrounded by the SDR enzymes, and two flavin reductases (LNN31_08725 and LNN31_17245) clustered closely with the quinone reductase-like ERs (QnoR) family ( Fig.S4 ). We tentatively designated all putative...”

LA_2621 short-chain dehydrogenase from Leptospira interrogans serovar lai str. 56601
34% identity, 72% coverage

• The sigma factor σ⁵⁴ is required for the long-term survival of Leptospira biflexa in water
  Zhang, Molecular microbiology 2018
  • “...binding protein LA_0274, LA_2982, LA_3713 LBL_0572, LBL_0299, LBL_2006, LBL_2140 LEPBI_I3255 2.32 COG0300R SDR family dehydrogenase/reductase LA_2621 LBL_1854 LEPBI_I2672 2.27 - Hypothetical protein LA_1273 LBL_2068 LEPBI_I0141 2.17 - Hypothetical protein No hit No hit LEPBI_I1418 2.16 COG0174E Glutamine synthetase (glutamate--ammonia ligase) LA_1313 LBL_1991 LEPBI_I3269 2.16 COG4974L Putative...”

RL0644 putative ribitol 2-dehydrogenase from Rhizobium leguminosarum bv. viciae 3841
30% identity, 92% coverage

• Rhizobium leguminosarum Glutathione Peroxidase Is Essential for Oxidative Stress Resistance and Efficient Nodulation
  Hu, Frontiers in microbiology 2021
  • “...beta subunit 54.75 0.82 0.0485 pRL90175 bdhA Cytoplasmic D-beta-hydroxybutyrate dehydrogenase like protein 27.21 0.82 0.0473 RL0644 rbtD Cytoplasmic Ribitol 2-dehydrogenase 25.73 0.8 0.0419 RL2323 Periplasmic The glucose-fructose oxidoreductase/inositol dehydrogenase/rhizopine catabolism protein (GFO/IDH/MocA) dehydrogenase 38.70 0.76 0.0091 RL0802 Cytoplasmic Deoxygenase 31.23 0.8 0.0469 RL0866 glcF Cytoplasmic Glycolate...”
  • “...membrane transport proteins, of which four were ABC-type transporters. Four genes RL4392 , pRL90175 , RL0644 , and RL2323 code for dehydrogenases. RL0802 , RL0866 , and pRL80022 code for a deoxygenase, an oxidase and a hydrolase, respectively. Many of the differentially expressed genes display similarity...”

EA682_19600 SDR family oxidoreductase from Acinetobacter baumannii
29% identity, 91% coverage

• Proteomic and Systematic Functional Profiling Unveils Citral Targeting Antibiotic Resistance, Antioxidant Defense, and Biofilm-Associated Two-Component Systems of Acinetobacter baumannii To Encumber Biofilm and Virulence Traits
  Selvaraj, mSystems 2020
  • “...FtsZ ftsZ 26 75 1.79722 0.002872 2.54E+09 55.5 19 D0C612 Oxidoreductase, short-chain dehydrogenase/reductase family protein EA682_19600 27 77 1.78907 0.0224894 533,427 25.9 19 N9LHG7 ATP synthase subunit alpha atpA 28 78 1.76984 0.0275672 4,384 20.8 12 D0CDT4 Dihydrolipoyl dehydrogenase lpdA 29 80 1.7645 0.0396424 6.58E+07 23...”

Rv2509 / I6Y9I3 Rv2509 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
Rv2509 PROBABLE SHORT-CHAIN TYPE DEHYDROGENASE/REDUCTASE from Mycobacterium tuberculosis H37Rv
I6Y9I3 Probable short-chain type dehydrogenase/reductase from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Mb2537 PUTATIVE SHORT-CHAIN TYPE DEHYDROGENASE/REDUCTASE from Mycobacterium bovis AF2122/97
38% identity, 69% coverage

• Rv0687 a Putative Short-Chain Dehydrogenase Is Required for In Vitro and In Vivo Survival of Mycobacterium tuberculosis
  Bhargavi, International journal of molecular sciences 2024
  • “...SDRs, namely Rv0148, Rv0484c, Rv0687, Rv0851c, Rv0927c, Rv0945, Rv1144, Rv1245c, Rv1865c, Rv1882c, Rv1928c, Rv1941, Rv2214c, Rv2509, Rv2766c, Rv2857c, Rv3085, Rv3174, Rv3224, Rv3485c, Rv3502c, Rv3548c and Rv3549c (as listed in Mycobrowser) and only a few of these are characterized [ 25 , 26 ]. Strikingly, a transposon...”
  • “...S. Hnisch M. Marshall R.L. Kalscheuer R. Bavro V.N. Bhatt A. The Mycolic Acid Reductase Rv2509 Has Distinct Structural Motifs and Is Essential for Growth in Slow-Growing Mycobacteria Mol. Microbiol. 2020 113 521 533 10.1111/mmi.14437 31785114 24. Chamchoy K. Pumirat P. Reamtong O. Pakotiprapha D. Leartsakulpanich...”
• Vanoxerine kills mycobacteria through membrane depolarization and efflux inhibition
  Kingdon, Frontiers in microbiology 2023
  • “...Fold change p -value p -adjusted accD6 1.4342963 8.57E-125 2.24E-123 acpM 2.0530831 6.07E-23 2.27E-22 cmrA (rv2509) 0.5538547 6.72E-26 2.76E-25 fabD 1.7924797 4.62E-79 6.13E-78 fabG1 1.7545573 1.31E-105 2.69E-104 fabH 0.394042 0.00055311 0.00082604 fadD32 0.11059707 0.37003607 0.4089094 fas 0.9664376 5.02E-52 4.06E-51 fbpA 1.402825 2.07E-77 2.66E-76 fbpB 2.3725639 2.69E-179...”
• Molecular Mechanisms of MmpL3 Function and Inhibition
  Williams, Microbial drug resistance (Larchmont, N.Y.) 2023
  • “...-ketoester to form the -alkyl -ketoacyl trehalose glycolipid. 74 In the final synthesis step, CmrA (Rv2509) reduces -alkyl -ketoacyl trehalose to form the mature MA TMM ( Fig. 2a ). 75 Several steps in the synthesis of TMM are still not understood, including double bond formation...”
• Repurposing Vanoxerine as a new antimycobacterial drug and its impact on the mycobacterial membrane
  Kingdon, 2022
• Fluorescence Imaging-Based Discovery of Membrane Domain-Associated Proteins in Mycobacterium smegmatis
  Rokicki, Journal of bacteriology 2021 (secret)
• Phylogenomic Reappraisal of Fatty Acid Biosynthesis, Mycolic Acid Biosynthesis and Clinical Relevance Among Members of the Genus Corynebacterium
  Dover, Frontiers in microbiology 2021
  • “...condensation step ( Portevin et al., 2004 ; Gavalda et al., 2014 ). Subsequently, CmrA (Rv2509) reduces the -keto group of the product from the mycolic condensation to produce mature mycolic acids, i.e., -alkyl, -hydroxy fatty acids ( Bhatt et al., 2008 ; Javid et al.,...”
  • “...Schindler S. Hanisch M. Marshall R. L. . ( 2020 ). The mycolic acid reductase Rv2509 has distinct structural motifs and is essential for growth in slow-growing mycobacteria . Mol. Microbiol. 113 , 521 533 . doi: 10.1111/mmi.14437 , PMID: 31785114 Jesse F. F. A. Odhah...”
• Applications of Transcriptomics and Proteomics for Understanding Dormancy and Resuscitation in Mycobacterium tuberculosis
  Kundu, Frontiers in microbiology 2021
  • “...genes ( fabG1 and inhA from FASII, fas, accD4, mmaA2, mmaa4, cmaA2, umaA , and Rv2509 ) were repressed during potassium depletion induced dormancy ( Salina et al., 2014 , 2019 ). fadD26 a fatty acyl AMP ligase involved in the biosynthesis of PDIMs ( Simone...”
• Tuberculosis Drug Discovery: A Decade of Hit Assessment for Defined Targets
  Oh, Frontiers in cellular and infection microbiology 2021
  • “...onto polyketide synthase Pks13 for final condensation to a -alkyl--ketoacyl derivative which is reduced by Rv2509 to generate the final mycolic acid. InhA The pro-drug isoniazid, inhibits the NADH-dependent enoyl-acyl carrier protein (ACP) reductase (InhA), encoded by inhA , but its clinical utility is hampered by...”
• More
• Phylogenomic Reappraisal of Fatty Acid Biosynthesis, Mycolic Acid Biosynthesis and Clinical Relevance Among Members of the Genus Corynebacterium
  Dover, Frontiers in microbiology 2021
  • “...MA condensation accE * 249 Biotin-dependent acetyl/propionyl-coenzyme A carboxylase subunit MA reduction cmrA Rv2059 807 i6y9i3 Dehydrogenase (putative oxidoreductase) MA, mycolic acid . * accE gene was used from Corynebacterium glutamicum . Duplicate hits with multiple queries were removed and the single best hit with the...”
• The unfoldase ClpC1 of Mycobacterium tuberculosis regulates the expression of a distinct subset of proteins having intrinsically disordered termini
  Lunge, The Journal of biological chemistry 2020 (secret)
• The mycolic acid reductase Rv2509 has distinct structural motifs and is essential for growth in slow-growing mycobacteria
  Javid, Molecular microbiology 2020
  • “...DNA regions flanking the BCG2529 start codon were amplified by PCR employing the oligonucleotide pairs Mb2537 _LL 5TTTTT CCATAAATTGG AACCGCTACCTGACATGAAACCC3 and Mb2537 _LR 5TTTTT CCATTTCTTGG GCCGATGTTCTGCGAAGCCCCGG3 as well as Mb2537 _RL 5TTTTT CCATAGATTGG ATGCCGATACCCGCGCCCAGCCC3 and Mb2537 _RR 5TTTTT CCATCTTTTGG CGGTGTGGGAGGAGATACTCAAG3 respectively. The gene BCG2528c is localised...”
  • “...PCR products (Supporting information Figure S6 ). For achieving the controlled gene expression of the Mb2537 gene, a synthetic gene ( revtetR ) derived from Tn10 tetR encoding a mutated TetR protein with reversed binding affinity to tetO sites upon the binding of tetracycline (Klotzsche, Ehrt,...”

E1VCL7 Sorbitol dehydrogenase from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
31% identity, 70% coverage

• Insights into the evolution of sorbitol metabolism: phylogenetic analysis of SDR196C family
  Sola-Carvajal, BMC evolutionary biology 2012
  • “...50 ]. Selected proteins were Uniprot codes: lineage 1, A3MHB9; lineage 2, A1WMN; lineage 3 E1VCL7; lineage 4, A5FVQ; lineage 5, A9CES4; lineage 6.1, O68112; lineage 6.2, A3K129; lineage 6.3, A3PKH5. Click here for file Additional file 8 Multiple sequence alignment of bacterial SDH proteins. ESPript...”

tsaC / P94681 4-sulfobenzyl alcohol dehydrogenase subunit (EC 1.1.1.257) from Comamonas testosteroni (see paper)
TSAC_COMTE / P94681 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2; Toluenesulfonate zinc-independent alcohol dehydrogenase TsaC; EC 1.2.1.62 from Comamonas testosteroni (Pseudomonas testosteroni) (see 2 papers)
28% identity, 89% coverage

• function: Involved in the toluene-4-sulfonate degradation pathway. Does not discriminate between the sulfonate and the carboxyl substituents and can also be involved in the p-toluenecarboxylate degradation pathway.
  catalytic activity: 4-formylbenzenesulfonate + NAD(+) + H2O = 4-sulfobenzoate + NADH + 2 H(+) (RHEA:18833)
  subunit: Homodimer.
• Biodegradation of 3-methyldiphenylether (MDE) by Hydrogenophaga atypical strain QY7-2 and cloning of the methy-oxidation gene mdeABCD.
  Yang, Scientific reports 2016
  • “...318 toluene-4-sulfonate monooxygenase system reductase subunit Q9AHG2 97 monooxygenase reductase component mdeC 267 4-formylbenzenesulfonate dehydrogenase P94681 99 dehydrogenase mdeD 477 4-(hydroxymethyl) benzenesulfonate dehydrogenase Q9AHG1 99 dehydrogenase Table 2 Enzymatic characteristics of MdeABCD. Enzyme Specific activity (nmol min 1 mg 1 ) Optimum temperature Optimum pH MdeAB...”

Q3ZBV9 Dehydrogenase/reductase SDR family member 11 from Bos taurus
27% identity, 93% coverage

• Reconstruction of insect hormone pathways in an aquatic firefly, Sclerotia aquatilis (Coleoptera: Lampyridae), using RNA-seq.
  Chanchay, PeerJ 2019
  • “...3 1 K15890 FOHSDR 56 Q3U0B3 23 10 8 0 Q71R50 13 2 2 4 Q3ZBV9 8 14 14 23 Q6UWP2 11 3 4 3 K00128 ALDH 23 Q60HH8 3 0 1 0 P43353 2 0 0 0 P11884 2 1 1 0 Q8IZ83 2 0...”

NP_001165583 dehydrogenase/reductase SDR family member 7B isoform 1 from Mus musculus
30% identity, 70% coverage

• PexRAP Inhibits PRDM16-Mediated Thermogenic Gene Expression.
  Lodhi, Cell reports 2017
  • GeneRIF: PexRAP also interacts with PPARgamma, as well as PRDM16, a critical transcriptional regulator of thermogenesis, and disrupts the PRDM16-PPARgamma complex, providing a potential mechanism for PexRAP-mediated inhibition of adipocyte browning.
• Inhibiting adipose tissue lipogenesis reprograms thermogenesis and PPARγ activation to decrease diet-induced obesity.
  Lodhi, Cell metabolism 2012
  • GeneRIF: PexRAP knockdown in mice decreased expression of PPARgamma-dependent genes and reduced diet-induced adiposity.

rbtD / P00335 ribitol dehydrogenase subunit (EC 1.1.1.56) from Klebsiella aerogenes (see paper)
P00335 Ribitol 2-dehydrogenase from Klebsiella aerogenes
31% identity, 93% coverage

• An additional regulatory gene for actinorhodin production in Streptomyces lividans involves a LysR-type transcriptional regulator
  Martínez-Costa, Journal of bacteriology 1999
  • “...exfoliatus (P19992); Ridh_Kleae, Klebsiella aerogenes (P00335); Phbb_Zoora, Zoogloea ramigera (P23238); Act3_Strco, S. coelicolor (P16544); and Dhkr_Strcm,...”

Q99J47 Dehydrogenase/reductase SDR family member 7B from Mus musculus
30% identity, 68% coverage

• Potential of electro-sprayed purified mangiferin nanoparticles for anti-aging cosmetic applications
  Chomchoei, RSC advances 2023
  • “...protein L6 (P47911 RL6_MOUSE), protein disulfide-isomerase A6 (Q922R8 PDIA6_MOUSE) and dehydrogenase/reductase SDR family member 7B (Q99J47 DRS7B_MOUSE). The detailed biological process of these proteins is presented in Table 2 . Fig. 2 Volcano plots of CM (A) and RM (B). The plot shows a negative natural...”
  • “...a role in platelet aggregation and activation by agonists such as convulxin, collagen and thrombin Q99J47 DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B Putative oxidoreductase The proteinprotein interaction map, as illustrated in Fig. 3 , indicated the >4.01 fold up-regulated proteins in CM and RM compared with...”
• Proteomic analysis reveals semaglutide impacts lipogenic protein expression in epididymal adipose tissue of obese mice.
  Zhu, Frontiers in endocrinology 2023
  • “...Q921Q3 Chitobiosyldiphosphodolichol beta-mannosyltransferase Alg1 0.60958506 1.247437542 Q923D4 Splicing factor 3B subunit 5 Sf3b5 0.821544189 1.219278931 Q99J47 Dehydrogenase/reductase SDR family member 7B Dhrs7b 0.71252128 1.269246863 Q99PJ0 Neurotrimin Ntm 0.659723271 1.360605816 Q9CW42 Mitochondrial amidoxime-reducing component 1 Mtarc1 0.547778041 1.312522546 Q9CWS0 N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 Ddah1 0.38989088 2.640649238 Q9CXT7 Transmembrane...”
• Rabbit Antidiethoxyphosphotyrosine Antibody, Made by Single B Cell Cloning, Detects Chlorpyrifos Oxon-Modified Proteins in Cultured Cells and Immunopurifies Modified Peptides for Mass Spectrometry
  Onder, Journal of proteome research 2021
  • “...diethoxyphosphate [Y2] Q62425 cytochrome c oxidase subunit NDUFA4 1357.6076 679.3086 62.7 21 VTVISPGYIHTNLSVNAVTADGSR diethoxyphosphate [Y8] Q99J47 dehydrogenase/reductase SDR family member 7B 2607.3178 869.7773 98.3 22 FASYLTFSPSEVK diethoxyphosphate [Y4] Q9Z110 delta-1-pyrroline-5-carboxylate synthase 1611.7707 806.3890 68.8 23 NVSLGNVLAVAYAAK diethoxyphosphate [Y12] Q99KK7 dipeptidyl peptidase3 1625.8662 813.4366 91.1 24 TGSIYWAAK...”

AW20_3574 glucose 1-dehydrogenase from Bacillus anthracis str. Sterne
BAS4612 glucose 1-dehydrogenase from Bacillus anthracis str. Sterne
27% identity, 87% coverage

• Beyond the spore, the exosporium sugar anthrose impacts vegetative Bacillus anthracis gene regulation in cis and trans
  Norris, Scientific reports 2023
  • “...1.19 AW20_2489 BAS0269 Undecaprenyl-diphosphatase (EC 3.6.1.27) 1.19 AW20_1586 BAS1095 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180) 1.20 AW20_3574 BAS4612 Glucose 1-dehydrogenase (EC 1.1.1.47) 1.21 AW20_125 BAS2516 GNAT family acetyltransferase BA2701 1.21 AW20_3613 BAS4574 Hypothetical protein 1.22 AW20_4494 BAS3724 UPF0701 protein YicC 1.23 AW20_4337 BAS3872 DUF1054 superfamily protein 1.23...”
• Beyond the spore, the exosporium sugar anthrose impacts vegetative Bacillus anthracis gene regulation in cis and trans
  Norris, Scientific reports 2023
  • “...AW20_2489 BAS0269 Undecaprenyl-diphosphatase (EC 3.6.1.27) 1.19 AW20_1586 BAS1095 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180) 1.20 AW20_3574 BAS4612 Glucose 1-dehydrogenase (EC 1.1.1.47) 1.21 AW20_125 BAS2516 GNAT family acetyltransferase BA2701 1.21 AW20_3613 BAS4574 Hypothetical protein 1.22 AW20_4494 BAS3724 UPF0701 protein YicC 1.23 AW20_4337 BAS3872 DUF1054 superfamily protein 1.23 AW20_5265...”

NP_572420 spidey from Drosophila melanogaster
32% identity, 62% coverage

• Drosophila Spidey/Kar Regulates Oenocyte Growth via PI3-Kinase Signaling.
  Cinnamon, PLoS genetics 2016
  • GeneRIF: a very long chain fatty-acyl-CoA reductase (FarO) and a putative lipid dehydrogenase/reductase (Spidey, also known as Kar) not only promote lipid droplet induction but also inhibit oenocyte growth. In the case of Spidey/Kar, we show that the growth suppression mechanism involves inhibition of the PI3K signaling pathway upstream of Akt activity

DR_1938 oxidoreductase, short-chain dehydrogenase/reductase family from Deinococcus radiodurans R1
36% identity, 66% coverage

• Comprehensive Temporal Protein Dynamics during Postirradiation Recovery in Deinococcus radiodurans
  Xiong, Oxidative medicine and cellular longevity 2022
  • “...they experience ( Figure 4(b) ). Oxidoreductase, which belongs to the short-chain dehydrogenase/reductase (SDR) family (DR_1938), was upregulated during PIR. Another oxidoreductase (DR_A0237), catalase (KatA), and peptide methionine sulfoxide reductase (MsrB) were differentially upregulated at both 6h and 12h. Ferredoxin-nitrite reductase (DR_A0013), thiosulfate sulfurtransferase (DR_0217), sulfate...”
• Proteomic Response of Deinococcus radiodurans to Short-Term Real Microgravity during Parabolic Flight Reveals Altered Abundance of Proteins Involved in Stress Response and Cell Envelope Functions
  Moors, Life (Basel, Switzerland) 2021
  • “...1.17 thiol-specific antioxidant protein DR_2242 0.85 LuxA-like protein DR_0611 0.79 short chain dehydrogenase/reductase family oxidoreductase DR_1938 0.79 3-hydroxyisobutyrate dehydrogenase DR_0499 0.74 Uncharacterized protein DR_1002 0.58 Oxidoreductase, short-chain dehydrogenase/reductase family DR_0113 0.54 zinc-containing alcohol dehydrogenase DR_A0005 0.51 Dihydrolipoyl dehydrogenase DR_2370 0.43 General Stress oligoendopeptidase F DR_2055 1.26...”

EHI_163540 b-keto acyl reductase, putative from Entamoeba histolytica HM-1:IMSS
27% identity, 71% coverage

• Tetraspanin-enriched microdomains play an important role in pathogenesis in the protozoan parasite Entamoeba histolytica
  Jiang, PLoS pathogens 2024
  • “...5-alpha reductase EHI_040700 2 24.0 (9.1) Coatomer subunit gamma EHI_054830 2 19.3 (6.0) Calcium-transporting ATPase EHI_163540 2 14.3 (2.9) -ketoacyl reductase EHI_020300 2 13.6 (5.7) Ribosomal protein L15 EHI_075690 2 12.5 (0) TSPAN4 EHI_163240 2 9.7 (3.4) Phosphatidate cytidylyltransferase EHI_179320 2 9.1 (3.3) Wntless-like transmembrane protein...”
• Entamoeba histolytica: Quantitative Proteomics Analysis Reveals Putative Virulence-Associated Differentially Abundant Membrane Proteins
  Ng, The American journal of tropical medicine and hygiene 2018
  • “...13 14 15 16 EHI_138080 EHI_148990 EHI_160980 EHI_163540 17 18 18 EHI_182530 EHI_199590 EHI_199590 Hypothetical protein Hypothetical protein Thioredoxin,...”
  • “...CoA ligase (EHI_025090), B-keto acyl reductase (EHI_163540), CXXC-rich protein (EHI_111990), and uncharacterized protein (EHI_138080). The decreased abundance...”

Tfu_1472 short-chain dehydrogenase/reductase (SDR) family protein from Thermobifida fusca YX
28% identity, 85% coverage

• Laboratory evolution and multi-platform genome re-sequencing of the cellulolytic actinobacterium Thermobifida fusca
  Deng, The Journal of biological chemistry 2011
  • “...Tfu_0403 Tfu_0423 Tfu_0425 Tfu_0677 Tfu_0750 Tfu_1087 Tfu_1426 Tfu_1472 Tfu_1516 Tfu_2031 Tfu_2363 Tfu_2728 155128 470157 631259 658876 771381 919790 1075652...”

7ejhA / Q6WVP7 Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
29% identity, 86% coverage

• Ligands: nadp nicotinamide-adenine-dinucleotide phosphate; 2-oxidanylisoindole-1,3-dione (7ejhA)

BQ1177_RS00925 SDR family NAD(P)-dependent oxidoreductase from Ligilactobacillus salivarius
32% identity, 81% coverage

• Investigating the Metabolism of Estrogens in Ligilactobacillus salivarius Strains Isolated from Human Milk and Vaginal Microbiota
  Aragón, Nutrients 2024
  • “...(3.1.2.-) paaI (BQ1177_RS04090) F: ACTAGCCATCGTGTTTTAGCT 55.0 207 [ 50 ] R: GCCACTAACGTATGATTCGATAC Short-chain dehydrogenase(1.3.-.-) DltE (BQ1177_RS00925) F: GGAAGAAGTGGGACCTGTCT 55.0 172 [ 51 ] R: ACCTACTTGTCTTTCGGCCA nutrients-16-00861-t004_Table 4 Table 4 Steroid-degrading enzymes in the Ligilactobacillus salivarius strains selected in this work. Presence (+) or absence () of...”

G3V978 Dehydrogenase/reductase 11 from Rattus norvegicus
26% identity, 72% coverage

• Peptidomic Analysis of Rat Plasma: Proteolysis in Hemorrhagic Shock.
  Aletti, Shock (Augusta, Ga.) 2016
  • “...Q63041 A1m SDKPDMAEIEKFDKSKLKKTET P62329 Tmsb4x SDKPDMAEIEKFDKSKLKKTETQ P62329 Tmsb4x SPMYSIITPNVLRLESEET M0RBF1 C3 TQLKRKENEIELSLLQLREQQAT D3Z8G3 Rpgrip1l TRAGMERWRDRLALVT G3V978 Dhrs11 VAQASLGEYLFERLTLKHD Q7TP54 Fam65b VKVLDAVRGSPAVD P02767 Ttr VVLARLTAQPAPSPED Q03626 Mug1 WKQQVMTTVQNMQHESAQLQEELH D4ABD7 Trip11 YPSKPDNPGEDAPAED P07808 Npy YVLLAYLTSASSRPT Q63041 A1m Table 2 List of the peptides decreased or present only in...”
  • “...x x Cystatin-C P14841 Cst3 x x Cystathionine gamma-lyase P18757 Cth x x Protein Dhrs11 G3V978 Dhrs11 x Deleted in malignant brain tumors 1 protein Q8CIZ5 Dmbt1 x x Dihydropyrimidine dehydrogenase [NADP(+)] O89000 Dpyd x x Ac2-067 Q7TPK5 Eef1b2l x x Elongation factor 1-gamma Q68FR6 Eef1g...”

Cobetia51163_080094 SDR family NAD(P)-dependent oxidoreductase from Cobetia sp. 5-11-6-3
34% identity, 72% coverage

• Cobetia sp. Bacteria, Which Are Capable of Utilizing Alginate or Waste Laminaria sp. for Poly(3-Hydroxybutyrate) Synthesis, Isolated From a Marine Environment
  Moriya, Frontiers in bioengineering and biotechnology 2020
  • “...regulator KdgR BLWJ01000008 Cobetia51163_080092 8 345 KdgF BLWJ01000008 Cobetia51163_080093 8 774 SDR family oxidoreductase BLWJ01000008 Cobetia51163_080094 8 2,160 Oligoalginate lyase BLWJ01000008 Cobetia51163_080095 8 2,142 Oligoalginate lyase BLWJ01000008 Cobetia51163_080096 8 1,788 Transporter ToaABC-1 BLWJ01000008 Cobetia51163_080097 8 693 Outer-membrane porins (kdgMN) BLWJ01000008 Cobetia51163_080098 8 1,716 Transporter ToaABC-2 BLWJ01000008...”

RADH_LENKE / Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri)
29% identity, 86% coverage

• function: NADP-dependent (R)-specific alcohol dehydrogenase (ADH) with a broad substrate specificity, able to catalyze in vitro the stereoselective reduction of several aliphatic and aromatic ketones as well as beta-keto esters to the corresponding enantiomerically pure alcohols.
  catalytic activity: a secondary alcohol + NADP(+) = a ketone + NADPH + H(+) (RHEA:19257)
  catalytic activity: acetophenone + NADPH + H(+) = (R)-1-phenylethanol + NADP(+) (RHEA:68136)
  catalytic activity: 2,5-hexanedione + 2 NADPH + 2 H(+) = (2R,5R)-hexanediol + 2 NADP(+) (RHEA:68140)
  catalytic activity: ethyl 3-oxobutanoate + NADPH + H(+) = ethyl (R)-3- hydroxybutanoate + NADP(+) (RHEA:68144)
  catalytic activity: 2-octanone + NADPH + H(+) = (2R)-octan-2-ol + NADP(+) (RHEA:68148)
  cofactor: Mg(2+)
  subunit: Homotetramer.
• Enantiocomplementary Bioreduction of 1-(Arylsulfanyl)propan-2-ones.
  Sándor, Molecules (Basel, Switzerland) 2024
  • “...on similar substrates, including optimization of the bioreductions. The codon-optimized genes of LkADH (Uniprot ID: Q6WVP7) and RaADH (Uniprot ID: N1MBR5) were purchased from GenScript (Rijswijk, the Netherlands). The genes were placed into a pET19b vector with NdeI and BamHI restriction enzyme sites. The plasmids were...”
• Discovery of New Carbonyl Reductases Using Functional Metagenomics and Applications in Biocatalysis.
  Newgas, Advanced synthesis & catalysis 2021
  • “...amino acid sequences of SDRs from Lactobacillus brevis (Uniprot ID Q84EX5), Lactobacillus kefiri (Uniprot ID Q6WVP7), and Weissella thailandensis (Uniprot ID G0UH95). These were identified as sequences of interest as they exhibit preference for ( R )alcohols.[ 23 , 24 ] The sequences were also used...”
• From Bugs to Bioplastics: Total (+)-Dihydrocarvide Biosynthesis by Engineered Escherichia coli.
  Ascue, Chembiochem : a European journal of chemical biology 2019
  • “...(CDH; UNIPROT: Q9RA05), 21 ( R )specific alcohol dehydrogenase from L . kefir (LkADH; UNIPROT: Q6WVP7) 36 and secondary alcohol dehydrogenase from R . ruber DSM 44541 (RrADH; UNIPROT: Q8KLT9). 23 Each gene was codon optimised for optimal expression in E.coli . In the case of...”

Q3U0B3 Dehydrogenase/reductase SDR family member 11 from Mus musculus
27% identity, 91% coverage

• The biochemical effects of carotenoids in orange carrots on the colonic proteome in a mouse model of diet-induced obesity
  Balbuena, Frontiers in nutrition 2024
  • “...A0A1Y7VN19 1307.0 1313.6 1384.9 1403.8 1.01 1.05 1.07 1.01 Dehydrogenase/reductase SDR family member 11 DHRS11 Q3U0B3 1021.3 1038.6 1097.7 1109.6 1.02 1.06 1.07 1.01 Dehydrogenase/reductase SDR family member 1 DHRS1 Q99L04 451.6 442.5 586.0 532.3 0.98 1.32 1.20 0.91 Scavenger receptor class B member 1 SCARB1...”
• Enhanced cardiomyocyte reactive oxygen species signaling promotes ibrutinib-induced atrial fibrillation.
  Yang, Redox biology 2020
  • “...Q9QX60 Deoxyguanosine kinase, mitochondrial 1.961555457 5.48505E-05 P48771 Cytochrome c oxidase subunit 7A2, mitochondrial 1.26056584 0.016824736 Q3U0B3 Dehydrogenase/reductase SDR family member 11 1.276419842 0.000454448 P54116 Erythrocyte band 7 integral membrane protein 1.320867614 0.004096078 Q00612 Glucose-6-phosphate 1-dehydrogenase X 1.382615444 0.003007136 P03888 NADH-ubiquinone oxidoreductase chain 1 1.437668854 0.029811979 Q3TEF1...”
• Reconstruction of insect hormone pathways in an aquatic firefly, Sclerotia aquatilis (Coleoptera: Lampyridae), using RNA-seq.
  Chanchay, PeerJ 2019
  • “...1 0 Q5F4B1 1 0 0 0 Q2T9S4 1 0 3 1 K15890 FOHSDR 56 Q3U0B3 23 10 8 0 Q71R50 13 2 2 4 Q3ZBV9 8 14 14 23 Q6UWP2 11 3 4 3 K00128 ALDH 23 Q60HH8 3 0 1 0 P43353 2 0...”
• PepT1 Expression Helps Maintain Intestinal Homeostasis by Mediating the Differential Expression of miRNAs along the Crypt-Villus Axis
  Zhang, Scientific reports 2016 (no snippet)

HSD_PINMS / A0A140FAN3 11-beta-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase; Steroleosin; EC 1.1.1.146; EC 1.1.1.62 from Pinus massoniana (Chinese red pine) (see paper)
33% identity, 61% coverage

• function: Has dehydrogenase activity against corticosterone (11 beta- hydroxysteroid) and estradiol (17 beta-hydroxysteroid) in the presence of NADP(+). May be involved in signal transduction regulated by various sterols.
  catalytic activity: an 11beta-hydroxysteroid + NADP(+) = an 11-oxosteroid + NADPH + H(+) (RHEA:11388)
  catalytic activity: corticosterone + NADP(+) = 11-dehydrocorticosterone + NADPH + H(+) (RHEA:42200)
  catalytic activity: 17beta-estradiol + NADP(+) = estrone + NADPH + H(+) (RHEA:24616)

BAB2_0975 DNA gyrase, subunit B:Short-chain dehydrogenase/reductase SDR:Glucose/ribitol dehydrogenase from Brucella melitensis biovar Abortus 2308
29% identity, 89% coverage

• Intracellular adaptation of Brucella abortus
  Lamontagne, Journal of proteome research 2009
  • “...supply at the beginning of the infection. While some of these enzymes remained low (BAB1_1109, BAB2_0975, BAB1_0925), the others reverted at later times to pre-infection levels. In addition, the levels of glycerol-3-phosphate dehydrogenase (BAB2_0371), which is involved in the synthesis of glycerophospholipids was also reduced early...”
  • “...BAB1_0486 Lipid metabolism FabF 75 BAB1_2185 Lipid metabolism Ech 76 BAB1_2174 Lipid metabolism FabA 77 BAB2_0975 Lipid metabolism FabC 78 BAB2_1008 Cell division MepA 79 BAB1_1530 Cell division UvrB 80 BAB2_0475 Cell division XseA 81 BAB1_0640 Cell division PleC 82 BAB1_0075 Unknown Conserved 83 BAB1_1612 Unknown...”

MAP1716 hypothetical protein from Mycobacterium avium subsp. paratuberculosis str. k10
32% identity, 86% coverage

• Genomic variations associated with attenuation in Mycobacterium avium subsp. paratuberculosis vaccine strains
  Bull, BMC microbiology 2013
  • “...Metabolism MAP1714 fadA_2 Acyl-CoA dehydrogenase Fatty Acid Metabolism MAP1715 fadB_2 Acyl-CoA dehydrogenase Fatty Acid Metabolism MAP1716 Short chain dehydrogenase Fatty Acid Metabolism MAP1717 Unknown *MAP1718c Low identity to MTB immunogen MPT63 Cell internalization factor *MAP1719c Transcriptional regulator *MAP1720 Nucleoside-diphosphate-sugar epimerases Cell envelope biosynthesis *MAP1721c Transcriptional regulator...”

A0A068FPP9 glucose 1-dehydrogenase [NAD(P)+] (EC 1.1.1.47) from Bacillus sp. (in: Bacteria) (see paper)
26% identity, 87% coverage

MA0479 cyclohexanol dehydrogenase from Methanosarcina acetivorans C2A
27% identity, 86% coverage

• Pyruvate-dependent growth of Methanosarcina acetivorans
  Richter, Journal of bacteriology 2024 (secret)

CG12171 uncharacterized protein from Drosophila melanogaster
30% identity, 88% coverage

• Bradysia (Sciara) coprophila larvae up-regulate DNA repair pathways and down-regulate developmental regulators in response to ionizing radiation
  Urban, Genetics 2024 (secret)
• An RNAi Screen for Genes Required for Growth of Drosophila Wing Tissue
  Rotelli, G3 (Bethesda, Md.) 2019
  • “...disordered CG8132 I - II mild disorder, hair tufts CG9547 II mild disorder, denser anterior CG12171 II - III mild disorder CG34174 II - III disorder CG34177 I - III Mild disorder CG42516 I - II Mild disorder, hair tufts 1: See Table S1 for FlyBase...”
  • “...Tumor Suppressor? CG9547 Glutaryl-CoA dehydrogenase; mitochondrial matrix; lysine and tryptophan metabolism GCDH (15) Glutaric Acidemia CG12171 Steroid dehydrogenase HSD17B14 (4) CG34174 Cdc7 and Cdk2 associated protein; DNA replication; ATR checkpoint signaling; transcription factor CINP (3) Cancer CG34177 Von Willebrand factor type C domain: predicted secreted protein;...”
• Systematic imaging reveals features and changing localization of mRNAs in Drosophila development
  Jambor, eLife 2015
  • “...the perinuclear space ( spoon ). Apical enrichment ( CG43693 ) or basal localization ( CG12171 ) was detected in late epithelial somatic cells. Anterior and posterior RNA localization varied between diffuse ( fs(1)N, yemalpha ) and tight cortical enrichments ( Lcp65Ac, mus210 ). ( C...”
  • “...subcellular domains of the nurse ( msk, spoon ) and somatic epithelial cells ( CG43693, CG12171 ). For few mRNAs, we observed previously unknown ovary accumulations, for example mRNAs in cytoplasmic granules ( CG17494 ), depleted from the oocyte ( Nacalpha ), showing cortical enrichment (...”
• Genome-wide expression analysis identifies a modulator of ionizing radiation-induced p53-independent apoptosis in Drosophila melanogaster
  van, PloS one 2012
  • “...2 hr after irradiation ( Table 2 ). These are CD6272, escl, mre11, eIF6, CG17836, CG12171, CG18596, CG11897, CG6171, rpr, corp, skl, hid, egr, CG9836, mus205, CG5664 and mus210. In addition, our list includes GstD4, GstE3, GstE5, GstE6 and GstE7 whereas the published list includes GstD5;...”
• A protein complex network of Drosophila melanogaster
  Guruharsha, Cell 2011
  • “...For example: Cluster #166 ( Supplemental Table S4 ) is made up of three members (CG12171, CG31549, CG31548) with a high average HGSCore (388). All three share a Glucose/ribitol dehydrogenase domain, a NAD(P)-binding domain, and Short-chain dehydrogenase/reductase (SDR) conserved sites. DPiM results suggest that these previously...”
• RNA polymerase is poised for activation across the genome
  Muse, Nature genetics 2007
  • “...exposure, the UV-inducible genes W (also known as hid), CG12171 and Hsp70 had substantial enrichment of Pol II at their promoters compared to the downstream...”
  • “...+58 +379 3 +59 +447 1.5 +99 +445 4 -12 +477 2.0 CG12171 eIF-5c Hsp70 Primer location with respect to gene start site 1510 - + UV S2 cells 60" 2.5 A+G ladder DNA...”

BMEII0514 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE from Brucella melitensis 16M
28% identity, 89% coverage

• RNA-seq reveals the critical role of OtpR in regulating Brucella melitensis metabolism and virulence under acidic stress
  Liu, Scientific reports 2015
  • “...most importantly in generating the cell envelope. Five genes for fatty-acid biosynthesis (BMEI1180; BMEI1473; fabG, BMEII0514; BMEI1521; BMEI1522; fadD, BMEI1632; cfa, BMEI1484) were down-regulated in the 16M otpR , suggesting that OtpR up-regulates these five fatty-acid biosynthesis genes. In addition to fatty-acid biosynthesis genes, OtpR regulates...”
• Comparative proteomics analyses reveal the virB of B. melitensis affects expression of intracellular survival related proteins
  Wang, PloS one 2009
  • “...gapA glyceraldehyde-3-phosphate dehydrogenase 36/38 6.13/6.91 0.71 G C 2.7 Lipid transport and metabolism Q63 gi|17988859 BMEII0514 fabG 3-ketoacyl-(acyl-carrier-protein) reductase 27/31 5.44/5.52 0.59 IQR C 3.2 Q73 gi|17988206 BMEI1923 caiA isovaleryl-CoA dehydrogenase 42/42 5.36/5.33 0.53 I U 2.2 Q44 gi|17986323 BMEI0039 accA acetyl-CoA carboxylase carboxyltransferase subunit alpha...”

CGS9114_RS09725 oxidoreductase from Corynebacterium glutamicum S9114
33% identity, 66% coverage

• Microbial tolerance engineering for boosting lactic acid production from lignocellulose
  Shan, Biotechnology for biofuels and bioproducts 2023
  • “...increase the production of cellulosic LA. For instance, Qiu et al. overexpressed a short-chain dehydrogenase CGS9114_RS09725 from Corynebacterium glutamicum in P. acidilactici , showing enhanced vanillin degradation rate. Finally, based on SSCF process, engineered P. acidilactici can produce 115g/L D-LA production with the productivity of 1.6g/L/h...”
• A short-chain dehydrogenase plays a key role in cellulosic D-lactic acid fermentability of Pediococcus acidilactici
  Qiu, Bioresource technology 2020 (PubMed)
  • “...of a short-chain dehydrogenase encoded by the gene CGS9114_RS09725 from Corynebacterium glutamicum was identified to play a key role in D-lactic acid...”
  • “...P. acidilactici with the genome integration of CGS9114_RS09725 showed the accelerated vanillin reduction and improved cellulosic D-lactic acid production. This...”

xecD / Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase subunit (EC 1.1.1.268) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 5 papers)
HCDR1_XANP2 / Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 7 papers)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase (EC 1.1.1.268) from Xanthobacter autotrophicus (see 4 papers)
2cfcA / Q56840 Structural basis for stereo selectivity in the (r)- and (s)- hydroxypropylethane thiosulfonate dehydrogenases (see paper)
30% identity, 75% coverage

• function: Involved in aliphatic epoxide carboxylation (PubMed:10411892, PubMed:11851420, PubMed:9405410). Catalyzes the reversible oxidation of (R)-2-hydroxypropyl-coenzyme M (R-HPC) to 2-oxopropyl-coenzyme M (2- KPC) (PubMed:10411892, PubMed:11851420, PubMed:15157110, PubMed:20302306). The enzyme is highly specific for the R enantiomers (PubMed:10411892, PubMed:15157110, PubMed:20302306). In vitro can also use achiral 2-propanol and short-chain (R)- and (S)-2-alkanols (PubMed:15157110).
  catalytic activity: (R)-2-hydroxypropyl-coenzyme M + NAD(+) = 2-oxopropyl-coenzyme M + NADH + H(+) (RHEA:13249)
  subunit: Homodimer in solution (PubMed:11851420, PubMed:9405410). Homotetramer (PubMed:16846226). Component III of the aliphatic epoxide carboxylation complex together with components I, II and IV (PubMed:10411892, PubMed:9405410).
• Ligands: nicotinamide-adenine-dinucleotide; (2-[2-ketopropylthio]ethanesulfonate (2cfcA)

BC351_17295 SDR family NAD(P)-dependent oxidoreductase from Paenibacillus ferrarius
31% identity, 73% coverage

• High-quality-draft genomic sequence of Paenibacillus ferrarius CY1^T with the potential to bioremediate Cd, Cr and Se contamination
  Li, Standards in genomic sciences 2017
  • “...regulator BC351_32260 ArsR family transcriptional regulator BC351_02635 Arsenate reductase ArsC BC351_15540 Antimony Oxidoreductase (putative AnoA) BC351_17295 Catalase BC351_40130 Catalase BC351_06195 Catalase BC351_15905 Catalase BC351_07965 Catalase BC351_29865 Chromate ChrA protein BC351_26450 Chromate transporter BC351_15935 Chromate transporter BC351_29720 Chromate transporter BC351_29725 Cadmium, lead and zinc Cobalt-zinc-cadmium resistance protein...”

RPA3631 putative glucose dehydrogenase from Rhodopseudomonas palustris CGA009
32% identity, 91% coverage

• Anaerobic Degradation of Syringic Acid by an Adapted Strain of Rhodopseudomonas palustris
  Oshlag, Applied and environmental microbiology 2020
  • “...rpa0319 Hypothetical protein 5.90 7.58* rpa3329 Hypothetical protein 5.87 3.42 rpa1475 Hypothetical protein 5.56 0.59 rpa3631 3-Oxoacyl-ACP reductase 5.52* 1.20 rpa4285 Malonic semialdehyde reductase 5.51* 1.73 rpa3565 l,d -Transpeptidase 5.39 2.17* rpa3943 Ferritin-like domain-containing protein 5.09* 0.55* rpa4394 Isocitrate lyase 5.05* 6.21* rpa3308 Ferritin-like domain-containing protein...”

6vspB / H9XP47 Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
27% identity, 93% coverage

• Ligand: adenosine-5'-diphosphate (6vspB)

DH12A_DANRE / Q6P3L6 Very-long-chain 3-oxoacyl-CoA reductase-A; 17-beta-hydroxysteroid dehydrogenase 12-A; 17-beta-HSD 12-A; zf3.1; zfHSD17B12A; 3-ketoacyl-CoA reductase; KAR; Estradiol 17-beta-dehydrogenase 12-A; EC 1.1.1.330; EC 1.1.1.62 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
30% identity, 59% coverage

• function: Catalyzes the second of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme has a 3-ketoacyl-CoA reductase activity, reducing 3-ketoacyl-CoA to 3- hydroxyacyl-CoA, within each cycle of fatty acid elongation. Thereby, it may participate in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. May also catalyze the transformation of estrone (E1) into estradiol (E2) and play a role in estrogen formation.
  catalytic activity: a very-long-chain (3R)-3-hydroxyacyl-CoA + NADP(+) = a very- long-chain 3-oxoacyl-CoA + NADPH + H(+) (RHEA:48680)
  catalytic activity: 17beta-estradiol + NAD(+) = estrone + NADH + H(+) (RHEA:24612)
  catalytic activity: 17beta-estradiol + NADP(+) = estrone + NADPH + H(+) (RHEA:24616)

budC / H9XP47 meso-butanediol dehydrogenase [(R)-acetoin-forming] (EC 1.1.1.304; EC 1.1.1.76) from Serratia marcescens (see paper)
MBDH_SERMA / H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see 3 papers)
AN479_RS23455 SDR family NAD(P)-dependent oxidoreductase from Serratia ureilytica
27% identity, 93% coverage

• function: Catalyzes the NAD-dependent oxidation of meso-2,3-butanediol to (3R)-acetoin, and of (2S,3S)-2,3-butanediol to (3S)-acetoin, with much lower efficiency (PubMed:23666479). Can also oxidize several primary alcohols such as glycerol, 1-2-pentanediol and 1,2-propanediol, with lower activity (PubMed:23666479). Cannot use (2R,3R)-2,3- butanediol (PubMed:23666479). In the presence of NADH, catalyzes the reduction of (3R)-acetoin to meso-2,3-butanediol, of (3S)-acetoin to (2S,3S)-2,3-butanediol and of diacetyl to (3S)-acetoin (PubMed:23666479). No activity is detected with NADPH/NADP(+) (PubMed:23666479).
  catalytic activity: (R,S)-butane-2,3-diol + NAD(+) = (R)-acetoin + NADH + H(+) (RHEA:75423)
  catalytic activity: (S,S)-butane-2,3-diol + NAD(+) = (S)-acetoin + NADH + H(+) (RHEA:12184)
  catalytic activity: (S)-acetoin + NAD(+) = diacetyl + NADH + H(+) (RHEA:27286)
  subunit: Homotetramer; dimer of dimers.
  disruption phenotype: Knockout of the gene causes the accumulation of the intermediate product acetoin inside the bacterial cells.
• Vanillic acid from Actinidia deliciosa impedes virulence in Serratia marcescens by affecting S-layer, flagellin and fatty acid biosynthesis proteins
  Sethupathy, Scientific reports 2017
  • “...3.20 0.004 1486 78 24 A0A0P0QAE1 Molecular chaperone (OsmY) SM10 3.01 0.001 3094 90 2 H9XP47 2,3- butanediol dehydrogenase (budC) SM11 2.84 0.000 140 70 2 Q8GHK9 Multiple stress resistant protein (bhSA) SM13 2.70 0.001 694 78 1 A0A0N2A3T4 Putative oxidoreductase SM14 2.59 0.001 6159 94...”
• Complete genome analysis of Serratia marcescens RSC-14: A plant growth-promoting bacterium that alleviates cadmium stress in host plants
  Khan, PloS one 2017
  • “...the bdh and gdh genes. We found that the products of locus tags AN479_RS12935 and AN479_RS23455 present 95% and 93% aa sequence identity with the BDH1 and GDH enzymes, respectively. This suggests that the corresponding genes are involved in 2,3-butanediol biosynthesis.Phosphorus (P) is required for plant...”

CHADH_ASPFM / D3J0Z1 Chanoclavine-I dehydrogenase; ChaDH; EC 1.1.1.332 from Aspergillus fumigatus (Neosartorya fumigata) (see paper)
EASD_ASPFU / Q4WZ66 Chanoclavine-I dehydrogenase easD; ChaDH; Ergot alkaloid synthesis protein A; EC 1.1.1.332 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see 8 papers)
D3J0Z1 chanoclavine-I dehydrogenase (EC 1.1.1.332) from Aspergillus fumigatus (see paper)
Q4WZ66 chanoclavine-I dehydrogenase (EC 1.1.1.332) from Aspergillus fumigatus (see paper)
AFUA_2G18000, Afu2g18000 short chain dehydrogenase/oxidoreductase CpoX2 from Aspergillus fumigatus Af293
27% identity, 91% coverage

• function: Oxidoreductase involved in the biosynthesis of ergot alkaloid biosynthesis. Catalyzes the oxidation of chanoclavine-I in the presence of NAD(+) resulting in the formation of chanoclavine-I aldehyde. Ergot alkaloids, which are produced by endophyte fungi, can enhance plant host fitness, but also cause livestock toxicosis to host plants.
  catalytic activity: chanoclavine-I + NAD(+) = chanoclavine-I aldehyde + NADH + H(+) (RHEA:33891)
  subunit: Homotetramer.
• function: Chanoclavine-I dehydrogenase; part of the gene cluster that mediates the biosynthesis of fumiclavanine C, a fungal ergot alkaloid (PubMed:15933009, PubMed:26972831). DmaW catalyzes the first step of ergot alkaloid biosynthesis by condensing dimethylallyl diphosphate (DMAP) and tryptophan to form 4-dimethylallyl-L-tryptophan (PubMed:15870460). The second step is catalyzed by the methyltransferase easF that methylates 4-dimethylallyl-L-tryptophan in the presence of S-adenosyl-L-methionine, resulting in the formation of 4-dimethylallyl-L-abrine (By similarity). The catalase easC and the FAD-dependent oxidoreductase easE then transform 4-dimethylallyl-L- abrine to chanoclavine-I which is further oxidized by EasD in the presence of NAD(+), resulting in the formation of chanoclavine-I aldehyde (PubMed:20039019, PubMed:20526482, PubMed:21409592). EasA reduces chanoclavine-I aldehyde to dihydrochanoclavine-I aldehyde that spontaneously dehydrates to form 6,8-dimethyl-6,7-didehydroergoline (PubMed:20526482). EasG then catalyzes the reduction of 6,8-dimethyl- 6,7-didehydroergoline to form festuclavine (PubMed:20526482). Hydrolysis of festuclavine by easM then leads to the formation of fumigaclavine B which is in turn acetylated by easN to fumigaclavine A (PubMed:26972831). Finally, easL catalyzes the conversion of fumigaclavine A into fumigaclavine C by attaching a dimethylallyl moiety to C-2 of the indole nucleus (PubMed:19672909).
  catalytic activity: chanoclavine-I + NAD(+) = chanoclavine-I aldehyde + NADH + H(+) (RHEA:33891)
• A possible role for fumagillin in cellular damage during host infection by Aspergillus fumigatus
  Guruceaga, Virulence 2018
  • “...one a dehydrogenase involved in the biosynthesis of the ergot alkaloid fumigaclavine, ( fgaDH gene, Afu2g18000) [ 25 ], one oxidase (Afu3g09500), one acetyltransferase (Afu1g09260) and an ankyrin repeat protein (Afu7g08610) (Table S1) (Table S4). 10.1080/21505594.2018.1526528-F0003 Figure 3. Gene ontology enrichment of differential expressed genes (DEGs)...”
  • “...maiA 3.72 3.79 Hypothetical protein Afu2g16440 3.35 0.58 3.66 0.73 Short chain dehydrogenase/ oxidoreductase CpoX2 Afu2g18000 fgaDH 3.43 1.01 3.31 0.17 Hypothetical protein Afu3g00410 3.47 0.06 MFS sugar transporter Afu3g03700 3.39 2.31 3.77 3.65 C6 sexual development transcription factor NosA Afu4g09710 rosA 3.87 6.59 C6 transcription...”
• Regulation of Secondary Metabolism by the Velvet Complex Is Temperature-Responsive in Aspergillus
  Lind, G3 (Bethesda, Md.) 2016
  • “...Tsai et al. (1999) Cluster 8 Fumigaclavine Afu2g17960 , Afu2g17970 , Afu2g17980 , Afu2g17990 , Afu2g18000 , Afu2g18010 , Afu2g18020 , Afu2g18030 , Afu2g18040 , Afu2g18050 , Afu2g18060 Robinson and Panaccione (2012) Cluster 9 Not known Afu3g01400 , Afu3g01410 , Afu3g01420 , Afu3g01430 , Afu3g01440 ,...”
• Perturbations in small molecule synthesis uncovers an iron-responsive secondary metabolite network in Aspergillus fumigatus
  Wiemann, Frontiers in microbiology 2014
  • “...* PKS 0.56 1.27 FUMIGACLAVINE (11 GENES) AFUA_2G17980 * fgaPT1 / easL Fumigaclavine 0.13 1.04 AFUA_2G18000 * fgaDH / easD 0.43 1.31 AFUA_2G18010 * fgaP450-2 / easM 0.06 1.75 UNCHARACTERIZED PKS CLUSTER AFUA_3G01400 Transporter Unknown 2.15 2.34 AFUA_3G01460 Hydroxylase 1.49 2.30 AFUA_3G01500 Hypothetical protein 1.17 1.79...”

G0HY85 acetoacetyl-CoA reductase (EC 1.1.1.36) from Haloarcula hispanica (see paper)
33% identity, 57% coverage

4bmvC / B9U359 Short-chain dehydrogenase from sphingobium yanoikuyae in complex with NADPH
37% identity, 72% coverage

• Ligand: nadp nicotinamide-adenine-dinucleotide phosphate (4bmvC)

6y0sAAA / Q84EX5 6y0sAAA (see paper)
27% identity, 91% coverage

• Ligand: magnesium ion (6y0sAAA)

CG7601 uncharacterized protein from Drosophila melanogaster
Q9Y140 Dehydrogenase/reductase SDR family protein 7-like from Drosophila melanogaster
29% identity, 67% coverage

• From sub-Saharan Africa to China: Evolutionary history and adaptation of Drosophila melanogaster revealed by population genomics
  Chen, Science advances 2024
  • “...such as Eglp2 (involved in renal system processes), shep (associated with neuron remodeling and metamorphosis), CG7601 (with nicotinamide adenine dinucleotideretinol dehydrogenase activity), alph (involved in response to oxidative stress and paraquat), CG9747 (related to lipid metabolic processes), and CG15533 (participating in sphingomyelin catabolic processes), are within...”
  • “...0.25 1.65 10 15 alph 10 0 Response to oxidative stress 0.28 6.30 10 17 CG7601 5 1 Putative oxidoreductase 0.30 6.81 10 19 CG9747 4 0 Lipid metabolic process 0.21 3.18 10 19 CG15533 7 0 Sphingomyelin catabolic process 0.17 4.42 10 17 DISCUSSION Here,...”
• Determinants of Endoplasmic Reticulum-to-Lipid Droplet Protein Targeting
  Olarte, Developmental cell 2020
  • “...aa RLCSLVNFVCWAVFSLSCIFYYVITSLLAANWTAFITALSVLGLFYWLMGQAINK LD Proteome ( Krahmer et al., 2013 ) ER 5 Q9Y140 D. melanogaster CG7601 SDR reductase 1084 aa APSSDWNVLYWVLGTVLMPVALPLAIINIWQRFQAQKFRNQLPGKVVLITGASSGLGESLAHVFYRAGCRVILAA LD Proteome ( Krahmer et al., 2013 ) A 6 B7Z0W3 D. melanogaster CG1021 Dementin 555638 aa GIDNSNARALVVKLINVVLTILQVVLLLVATAAGIIMPFLKTRVRVLTTFLSICFVIFVIRQWPDVQDIGSGLVRHLKQSLVVK LD Proteome ( Krahmer et al., 2013...”
• Determinants of Endoplasmic Reticulum-to-Lipid Droplet Protein Targeting
  Olarte, Developmental cell 2020
  • “...CG4729 AGPAT3 315369 aa RLCSLVNFVCWAVFSLSCIFYYVITSLLAANWTAFITALSVLGLFYWLMGQAINK LD Proteome ( Krahmer et al., 2013 ) ER 5 Q9Y140 D. melanogaster CG7601 SDR reductase 1084 aa APSSDWNVLYWVLGTVLMPVALPLAIINIWQRFQAQKFRNQLPGKVVLITGASSGLGESLAHVFYRAGCRVILAA LD Proteome ( Krahmer et al., 2013 ) A 6 B7Z0W3 D. melanogaster CG1021 Dementin 555638 aa GIDNSNARALVVKLINVVLTILQVVLLLVATAAGIIMPFLKTRVRVLTTFLSICFVIFVIRQWPDVQDIGSGLVRHLKQSLVVK LD Proteome ( Krahmer...”

BL01177 (S)-acetoin forming diacetyl reductase from Bacillus licheniformis DSM 13 = ATCC 14580
Q65J08 Diacetyl reductase [(S)-acetoin forming] from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
28% identity, 84% coverage

• Metabolic engineering of Bacillus subtilis for growth on overflow metabolites
  Kabisch, Microbial cell factories 2013
  • “...biomass. This is most probably also supported by the butanediol/acetoin reductase encoded by the budC (BL01177) gene of B. licheniformis , which catalyzes the irreversible reduction of 2.3-butanediol to acetoin [ 20 ]. Interestingly, the subspecies B. subtilis subsp. spizizenii, which is of a different lineage...”
• Adaptation to cold and proteomic responses of the psychrotrophic biopreservative Lactococcus piscium strain CNCM I-4031
  Garnier, Applied and environmental microbiology 2010 (secret)

ACIAD1828 putative short-chain dehydrogenase/reductase SDR protein from Acinetobacter sp. ADP1
28% identity, 43% coverage

• Novel metabolic features in Acinetobacter baylyi ADP1 revealed by a multiomics approach
  Stuani, Metabolomics : Official journal of the Metabolomic Society 2014
  • “...( dcaH ) ACIAD1691 ( dcaC ) 4 3 4 ACIAD1822 Putative transcriptional regulator ACIAD1827 ACIAD1828 ACIAD1829 ACIAD1830 3 4 3 4 ACIAD0985 ( pcaU -like) Putative transcriptional regulator ACIAD0979 ( vanB ) ACIAD0980 ( vanA ) ACIAD0984 ( salA -like) 4 4 4 Intergenic sequences...”

B7HR44 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from Bacillus cereus (strain AH187)
28% identity, 91% coverage

• Heme A Synthase Deficiency Affects the Ability of Bacillus cereus to Adapt to a Nutrient-Limited Environment
  Chateau, International journal of molecular sciences 2022
  • “...growth phase are linked to the iron acquisition system ( Table S3 ). The proteins B7HR44 (DhbA/BacA), B7HR45 (DhbB/BacC), B7HR46 (DhbC/BacE), B7HR47 (DhbE/BacB) and B7HR48 (DhbF/BacF) are involved in synthesizing the iron-binding bacillibactin siderophore [ 22 , 23 ]. Related proteins were also down-regulated, including FeuA...”

CC2966, CC_2966 short chain dehydrogenase family protein from Caulobacter crescentus CB15
32% identity, 81% coverage

• Regulatory response to carbon starvation in Caulobacter crescentus
  Britos, PloS one 2011
  • “...superfamily protein 4.72 No CC_1106 Ice nucleation protein 2.30 No CC_2869 Hypothetical protein 2.32 No CC_2966 3-oxoacyl-[acyl-carrier protein] reductase 3.45 No CC_1892 aspartyl-tRNA synthetase 0.09 No CC_2451 DNA topoisomerase I 0.11 No CC_3155 chemotaxis receiver domain protein cheYIII 0.39 No CC_2241 heat shock protein hsp33 0.30...”
• Proteomic identification of tmRNA substrates
  Hong, Proceedings of the National Academy of Sciences of the United States of America 2007
  • “...CC3219 AtpF, GabD, MutB, PpdK, PutA, SdhA, CC2274, CC2966 GlpQ, CC1352, CC1733 LeuD, MetE RibF RfaE CckA,* KatG, CC2484 PhoC, CC0063, CC0617 CgpA, CC0587...”

Cobetia52542_060129 SDR family NAD(P)-dependent oxidoreductase from Cobetia sp. 5-25-4-2
33% identity, 72% coverage

• Cobetia sp. Bacteria, Which Are Capable of Utilizing Alginate or Waste Laminaria sp. for Poly(3-Hydroxybutyrate) Synthesis, Isolated From a Marine Environment
  Moriya, Frontiers in bioengineering and biotechnology 2020
  • “...lyase BLWK01000006 Cobetia52542_060127 6 2,160 Oligoalginate lyase BLWK01000006 Cobetia52542_060128 6 774 SDR family oxidoreductase BLWK01000006 Cobetia52542_060129 6 345 Alginate and pectin degradation protein (Kdgf) BLWK01000006 Cobetia52542_060130 6 801 DNA-binding transcriptional regulator (KdgR) BLWK01000006 Cobetia52542_060131 6 1,059 Polysaccharide lyase family 7 protein BLWK01000006 Cobetia52542_060132 1 663 2-Dehydro-3-deoxy-phosphogluconate...”

barS1 / Q9LBV3 A-factor type γ-butyrolactone 6-reductase (6S-forming) monomer (EC 1.1.1.413) from Streptomyces virginiae (see paper)
BARS1_STRVG / Q9LBV3 A-factor type gamma-butyrolactone 1'-reductase (1S-forming); 6-dehydro-VB-A reductase; Butyrolactone autoregulator synthesis; EC 1.1.1.413 from Streptomyces virginiae (Streptomyces cinnamonensis) (see 2 papers)
30% identity, 89% coverage

• function: Involved in the biosynthesis of virginiae butanolide (VB), which regulates the production of antibiotic virginiamycin. Catalyzes the reduction of 6-dehydro-VB-A to VB-A, the last catalytic step in VB biosynthesis. In vitro, can use various synthetic A-factor-type analogs.
  catalytic activity: a (3R,4R)-3-[(1S)-1-hydroxyalkyl]-4-(hydroxymethyl)oxolan-2- one + NADP(+) = a (3R,4R)-3-alkanoyl-4-(hydroxymethyl)oxolan-2-one + NADPH + H(+) (RHEA:18941)
  subunit: Homodimer.
  disruption phenotype: Deletion mutant cannot produce VB or virginiamycin.

KP22_02890 SDR family oxidoreductase from Pectobacterium betavasculorum
34% identity, 71% coverage

• Comparative genomics, pangenomics, and phenomic studies of Pectobacterium betavasculorum strains isolated from sugar beet, potato, sunflower, and artichoke: insights into pathogenicity, virulence determinants, and adaptation to the host plant
  Borowska-Beszta, Frontiers in plant science 2024
  • “...synthase modules and related proteins), KP22_02935 (putative malonyl CoA-acyl carrier protein transacylase), KP22_RS02850 (hypothetical protein), KP22_02890 (phenazine antibiotic biosynthesis protein) Iron uptake systems Achromobactin uptake cluster 5 cbrD, cbrC, cbrB, cbrA, acr Enterobactin synthesis cluster 8 entD, cirA (cir, feuA) , KP22_19820 (putative iron transporter), entC,...”

Elen_0666 short-chain dehydrogenase/reductase SDR from Eggerthella lenta DSM 2243
35% identity, 55% coverage

• A biosynthetic pathway for a prominent class of microbiota-derived bile acids
  Devlin, Nature chemical biology 2015
  • “...of the 17 proteins expressed in soluble form ( Supplementary Fig. 3a ); one protein (Elen_0666) was insoluble and was not characterized further ( Supplementary Fig. 3b ). Biochemical characterization of candidate HSDH enzymes To assess the ability of the heterologously expressed proteins to convert DCA...”

BT_1911 7-alpha-hydroxysteroid dehydrogenase from Bacteroides thetaiotaomicron VPI-5482
28% identity, 88% coverage

• Loss of Bacteroides thetaiotaomicron bile acid-altering enzymes impacts bacterial fitness and the global metabolic transcriptome
  McMillan, Microbiology spectrum 2024
  • “...requires further study ( 34 ). B. theta also encodes a 7-hydroxysteroid dehydrogenase or HSDH (BT_1911 referred to in this paper as HSDHa) that has not been well studied. HSDHs act on the sterol core of bile acids to convert the hydroxyl to a ketone that...”
  • “...from multiple publications for deeper annotation ( 40 47 ). Protein cloning and expression Codon-optimized BT_1911 and BT_1259 were synthesized from IDT and amplified by PCR with the Phusion Flash High-Fidelity PCR Master Mix (Thermo) using the custom oligonucleotide primers (IDT) listed in the primer table....”
• Microbial bile acid metabolites modulate gut RORγ⁺ regulatory T cell homeostasis
  Song, Nature 2020
  • “...created by removal of the genes encoding BSHs (BT_1259 and BT_2086), the gene encoding 7-HSDH (BT_1911), or all three genes. Deletion mutants of B. fragilis 638R were created by removal of the gene encoding BSH (BF638R_3610), the gene encoding 7-HSDH (BF638R_3349), or both genes. DNA segments...”
  • “...up-forward: 5- TTTGTCGACCATCCAAACCCAGTGTGAAC-3; BT_2086 up-reverse: 5- ATAACTAACTATCGAATTACTTCCAAATTAAATAG-3; BT_2086 down-forward: 5- TAATTTGGAAGTAATTCGATAGTTAGTTATGTGGT-3; BT_2086 down-reverse: 5- TTTGGATCCAAGAGCATAAAGAGCTGTTG-3; BT_1911 up-forward: 5- TTTGTCGACTAGGAAAAGAAAAAGTGATC-3; BT_1911 up-reverse: 5- CTGTCCGGGGTATATATATGTTGAGAATTTGATGA-3; BT_1911 down-forward: 5- AAATTCTCAACATATATATACCCCGGACAGTACAT-3; BT_1911 down-reverse: 5- TTTGGATCCAATTTGATATAAGCGTACGA-3; BF638R_3610 up-forward: 5- TTTGTCGACTATAGCTGGATGGCTGTTGC-3; BF638R_3610 up-reverse: 5- CCTCGGTAGACATTTACTCTTTATATTAAAATGGT-3; BF638R_3610 down-forward: 5- TTTAATATAAAGAGTAAATGTCTACCGAGGCAGAT-3; BF638R_3610 down-reverse: 5-...”

3BHD2_EGGLE / C8WGQ3 3beta-hydroxysteroid dehydrogenase 2; 3beta-HSDH 2; 3beta-hydroxycholanate 3-dehydrogenase (NAD(+)) 2; NAD-dependent bile acid 3beta-dehydrogenase; EC 1.1.1.-; EC 1.1.1.391 from Eggerthella lenta (strain ATCC 25559 / DSM 2243 / CCUG 17323 / JCM 9979 / KCTC 3265 / NCTC 11813 / VPI 0255 / 1899 B) (Eubacterium lentum) (see paper)
C8WGQ3 3beta-hydroxycholanate 3-dehydrogenase (NAD+) (EC 1.1.1.391) from Eggerthella lenta (see paper)
Elen_1325 short-chain dehydrogenase/reductase SDR from Eggerthella lenta DSM 2243
29% identity, 90% coverage

• function: Involved in the modification of secondary bile acids into iso-bile acids (3beta-bile acids) via epimerization of the 3-OH group through a 3-oxo-intermediate. Catalyzes the reduction of 12-alpha- hydroxy-3-oxo-5-beta-cholan-24-oate (3-oxo-DCA) and 3-oxo-5-beta- cholan-24-oate (3-oxo-LCA) to yield isodeoxycholate (isoDCA) and isolithocholate (isoLCA), respectively. Is also able to catalyze the reduction of 3-dehydrocholate (3-oxo-CA or 7alpha,12alpha-dihydroxy-3- oxo-5beta-cholan-24-oate) and 7-alpha-hydroxy-3-oxo-5-beta-cholan-24- oate (3-oxo-CDCA), into isocholate (isoCA) and isochenodeoxycholate (isoCDCA), respectively. Accepts both NADH and NADPH as cosubstrates. The conversion of the abundant bile acid deoxycholate (DCA) into isoDCA by the gut bacterium E.lenta favors the growth of the keystone commensal genus Bacteroides, since isoDCA is less cytotoxic than its parent compound, DCA; iso-bile acids have thus a potential role in modulating gut community composition.
  catalytic activity: 3-oxo-5beta-cholan-24-oate + NADH + H(+) = isolithocholate + NAD(+) (RHEA:47508)
  catalytic activity: 12alpha-hydroxy-3-oxo-5beta-cholan-24-oate + NADH + H(+) = isodeoxycholate + NAD(+) (RHEA:47492)
  catalytic activity: 12alpha-hydroxy-3-oxo-5beta-cholan-24-oate + NADPH + H(+) = isodeoxycholate + NADP(+) (RHEA:47488)
  catalytic activity: 7alpha,12alpha-dihydroxy-3-oxo-5beta-cholan-24-oate + NADH + H(+) = isocholate + NAD(+) (RHEA:47512)
  catalytic activity: 3-oxochenodeoxycholate + NADH + H(+) = isochenodeoxycholate + NAD(+) (RHEA:47516)
• Human gut bacteria produce Τ_Η17-modulating bile acid metabolites
  Paik, Nature 2022
  • “...incubation with LCA or 3-oxoLCA revealed that Elen_0690 and Rumgna_02133 convert LCA to 3-oxoLCA while Elen_1325 and Rumgna_00694 convert 3-oxoLCA to isoLCA ( Fig. 3c d and Extended Data Fig. 4a , b ). Thus, we propose that the former genes are 3-HSDHs and the latter...”
  • “...Microbial Genomes and Microbiomes database (version 5.0 in March 2020) 40 , 41 with 3-HSDHs Elen_1325 and Rumgna_00694 as query sequences using an E value cutoff of 1E-2. All candidate genes with E values below 1E-15 were selected for heterologous expression assays. Secondary structure prediction analysis...”
• Targeted Synthesis and Characterization of a Gene Cluster Encoding NAD(P)H-Dependent 3α-, 3β-, and 12α-Hydroxysteroid Dehydrogenases from Eggerthella CAG:298, a Gut Metagenomic Sequence
  Mythen, Applied and environmental microbiology 2018
  • “...2243T was shown to express two 3-HSDHs (Elen_0198 and Elen_1325) in the SDR family, which share 38.1% amino acid sequence identity and are involved in iso-DCA...”
  • “...amino acid sequence identity with the 3-HSDHs Elen_0198 and Elen_1325. The pH optimum of CDD59473 in the oxidative direction was between pH 9 and 10, as...”
• Bile acid oxidation by Eggerthella lenta strains C592 and DSM 2243^T
  Harris, Gut microbes 2018
  • “...lenta DSM 2243, but excluded Elen_0198, Elen_0690, and Elen_1325, which were previously shown to recognize the C3 position.12 Surprisingly, we did not detect...”
  • “...corresponding to 3b-HSDHs Elen_0198 (CAB18_RS014915) and Elen_1325 (CAB18_RS09005).12 A homolog of new characterized 12a-HSDH, Elen_2515, was also identified...”
• A biosynthetic pathway for a prominent class of microbiota-derived bile acids
  Devlin, Nature chemical biology 2015
  • “...enzymes assayed, we identified two candidate 3-HSDHs (Elen_0690 and Rumgna_02133) and three candidate 3-HSDHs (Elen_0198, Elen_1325, and Rumgna_00694) ( Fig. 2a ). In order to confirm the results of the cell lysate assay, these five enzymes were overexpressed in E. coli and purified using Ni-NTA affinity...”
  • “...11 ). Notably, the putative 3-HSDHs including two enzymes from the same genome, Elen_0198 and Elen_1325, are found in separate clades and have relatively low pairwise sequence identity (3638%). Furthermore, these three genes reside in clades with other enzymes with different functions; while Elen_1325 is found...”

Q84EX5 R-specific alcohol dehydrogenase from Levilactobacillus brevis
27% identity, 91% coverage

• Discovery of New Carbonyl Reductases Using Functional Metagenomics and Applications in Biocatalysis.
  Newgas, Advanced synthesis & catalysis 2021
  • “...querying the Pfam database using amino acid sequences of SDRs from Lactobacillus brevis (Uniprot ID Q84EX5), Lactobacillus kefiri (Uniprot ID Q6WVP7), and Weissella thailandensis (Uniprot ID G0UH95). These were identified as sequences of interest as they exhibit preference for ( R )alcohols.[ 23 , 24 ]...”
• Neutron and X-ray crystal structures of Lactobacillus brevis alcohol dehydrogenase reveal new insights into hydrogen-bonding pathways
  Hermann, Acta crystallographica. Section F, Structural biology communications 2018
  • “...encoding the LbADH (UniProt ID Q84EX5) gene Forward primer GTGTCCATGGGCCACCACCACCACCACCAC GGATCAGGATCTAACCGTTTGGATGGTA AGGTA AGTGCGGCCGCAAGCTTTTATTG Reverse...”

SLG_12640 SDR family oxidoreductase from Sphingobium sp. SYK-6
31% identity, 61% coverage

• Stereoinversion via Alcohol Dehydrogenases Enables Complete Catabolism of β-1-Type Lignin-Derived Aromatic Isomers
  Kato, Applied and environmental microbiology 2023
  • “...were sought from C -dehydrogenase and ldpA-neighboring SDR genes. The gene products of SLG_12690 (ldpC) and SLG_12640 (ldpB) catalyzed the NADPH-dependent conversion of DGPD-keto I to DGPD III and DGPD-keto II to DGPD IV, respectively. Mutational analysis further indicated that ldpC and ldpB are predominantly involved in...”
• Stereoinversion via alcohol dehydrogenases enables complete catabolism of β-1-type lignin-derived aromatic isomers
  Kato, 2023

4qecA / I6ZQW6 Elxo with NADP bound (see paper)
25% identity, 89% coverage

• Ligand: nadp nicotinamide-adenine-dinucleotide phosphate (4qecA)

YfeF / b2426 oxidoreductase UcpA (EC 1.1.1.304) from Escherichia coli K-12 substr. MG1655 (see 6 papers)
ucpA / P37440 oxidoreductase UcpA (EC 1.1.1.304) from Escherichia coli (strain K12) (see 6 papers)
b2426 putative oxidoreductase from Escherichia coli str. K-12 substr. MG1655
NP_416921 oxidoreductase UcpA from Escherichia coli str. K-12 substr. MG1655
P37440 Oxidoreductase UcpA from Escherichia coli (strain K12)
36% identity, 71% coverage

• An expanded genome-scale model of Escherichia coli K-12 (iJR904 GSM/GPR)
  Reed, Genome biology 2003
  • “...ydgJ Putative NAD(P)-binding dehydrogenase D-Galactose 1-dehydrogenase 1.1.1.48 b3440 yhhX Putative NAD(P)-binding dehydrogenase D-Galactose 1-dehydrogenase 1.1.1.5 b2426 ucpA Putative oxidoreductase, NAD(P)-binding Acetoin dehydrogenase, diacetyl reductase 1.1.1.5 b2137 yohF Putative oxidoreductase Acetoin dehydrogenase, diacetyl reductase 1.1.1.5 b4266 idnO 5-Keto-D-gluconate-5-reductase Acetoin dehydrogenase, diacetyl reductase 1.2.1.19 b1385 feaB Phenylacetaldehyde dehydrogenase...”
• Increased furan tolerance in Escherichia coli due to a cryptic ucpA gene.
  Wang, Applied and environmental microbiology 2012
  • GeneRIF: Plasmid expression of ucpA increased furan tolerance in ethanologenic strain LY180 and wild-type strain W.
• The Thioredoxin Fold Protein (TFP2) from Extreme Acidophilic Leptospirillum sp. CF-1 Is a Chaperedoxin-like Protein That Prevents the Aggregation of Proteins under Oxidative Stress
  Muñoz-Villagrán, International journal of molecular sciences 2024
  • “...0.011 P0AEK4 enoyl-[acyl-carrier-protein] reductase fabI 7.56 0.048 P0A9Q5 acetyl-CoA carboxyltransferase subunit beta accD 4.80 0.038 P37440 oxidoreductase UcpA ucpA 1.55 0.039 P. Inorganic ion transport and metabolism P13036 ferric citrate outer membrane transporter fecA 4.28 0.009 J. Translation. ribosomal structure and biogenesis P0A8I8 23S rRNA m(3)psi1915...”
• The Protein Interactome of Glycolysis in Escherichia coli
  Chowdhury, Proteomes 2021
  • “...2 PfkA P0A796 MoeA P12281 Butland/Rajagopala [ 25 , 2 ] 2 PfkA P0A796 UcpA P37440 Hu/Rajagopala [ 3 , 2 ] 3 FbaA P0AB71 TreA P13482 Hu/Shatsky [ 3 , 27 ] 5 GapA P0A9B2 YidC P25714 Babu/Bloois [ 26 , 28 ] 6 Pgk...”
• Antimicrobial Mechanism and Identification of the Proteins Mediated by Extracts from Asphaltum punjabianum and Myrtus communis
  Aabed, ACS omega 2020
  • “...DOWN 2.27 DOWN 19 P08200 isocitrate dehydrogenase [NADP](3) IDH_ECOLI 2.1010 5 N.S. 3.8 DOWN 20 P37440 oxidoreductase UcpA UCPA_ECOLI 0.041 N.S. 2.36 DOWN 21 P0AC41 succinate dehydrogenase flavoprotein subunit SDHA_ECOLI 0.025 1.5 UP 1.64 DOWN 22 P61889 malate dehydrogenase MDH_ECOLI 2.5910 4 N.S. 3.21 DOWN 23...”
• Comprehensively Characterizing the Thioredoxin Interactome In Vivo Highlights the Central Role Played by This Ubiquitous Oxidoreductase in Redox Control
  Arts, Molecular & cellular proteomics : MCP 2016
  • “...P0ACD4 Description P0AE08 P0AE52 P13029 P0A746 P76270 P0AGD3 P0A862 P0A9P4 P37440 Uniprot ID TABLE I--continued Experience 2 1 2 14 10 13 13 9 14 2 13 10 10...”
• The Escherichia coli proteome: past, present, and future prospects
  Han, Microbiology and molecular biology reviews : MMBR 2006
  • “...TyrS P0AGJ9 UbiE P0A887 UcpA Udk P37440 P0A8F4 Aromatic amino acid aminotransferase Transcriptional regulatory protein Tyrosyl-tRNA synthetase Ubiquinone/...”

SGO_1096 acetoin dehydrogenase from Streptococcus gordonii str. Challis substr. CH1
A8AX75 Diacetyl reductase [(S)-acetoin forming] from Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
28% identity, 88% coverage

• Streptococcus gordonii Type I Lipoteichoic Acid Contributes to Surface Protein Biogenesis
  Lima, mSphere 2019
  • “...4-Methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein SGO_1860 5'-Nucleotidase, lipoprotein e(P4) family SGO_1342 ABC transporter, ATP-binding protein ButA SGO_1096 Acetoin dehydrogenase SGO_1862 Alkaline shock protein SGO_0578 Amino acid ABC transporter, permease protein SGO_0982 Amino acid ABC transporter, amino acid-binding protein SGO_0104 Arabinogalactan oligomer/maltooligosaccharide transport system substrate-binding protein ArcA SGO_1593...”
• Intracellular Ser/Thr/Tyr phosphoproteome of the oral commensal Streptococcus gordonii DL1
  Robertsson, BMC microbiology 2020
  • “...synthetase nadE (SGO_0583) A8AVT9 5.4/5.11 35,000/30248 268 3 16% Acetoin catabolism aced-1 Acetoin dehydrogenase butA(SGO_1096) A8AX75 5.4/5.20 26,000/26547 1008 15 77% - aced-2 a) 5.7/5.20 26,000/26547 1247 17 75% - aced-3 a) 5.7/5.20 24,000/26547 809 13 62% - Carbohydrate catabolism dera a) Deoxyribose-phosphate aldolase deoC (SGO_1080)...”

Z3691 short chain dehydrogenase from Escherichia coli O157:H7 EDL933
36% identity, 71% coverage

• RcsB contributes to the distinct stress fitness among Escherichia coli O157:H7 curli variants of the 1993 hamburger-associated outbreak strains
  Carter, Applied and environmental microbiology 2012
  • “...phoH Z0278 Z2624 Z2848 Z3604 Z3605 Z3608 Z3691 Z5366 Z5367 Z5668 Z1522 Putative acyl-CoA dehydrogenase NAD-dependent 7--hydroxysteroid dehydrogenase Acyl-CoA...”
• Characterizing the Escherichia coli O157:H7 proteome including protein associations with higher order assemblies
  Pieper, PloS one 2011
  • “...11166 CY, Ho-6 1.95E-02 25095 9957 2079 mRNA degradosome component C1 putative acetoin dehydrogenase UcpA Z3691 ucpA 27831 CY 2.73E-03 4843 5038 1953 (oxidoreductive) sulfate metabolism C1 short chain dehydrogenase YbbO Z0646 ybbO 29428 CY 1.95E-02 377 253 0 oxidoreductive processes C2 conserved protein YicC Z5069...”

CPS_RS07445 SDR family NAD(P)-dependent oxidoreductase from Colwellia psychrerythraea 34H
28% identity, 89% coverage

• Effect of cerulenin on fatty acid composition and gene expression pattern of DHA-producing strain Colwellia psychrerythraea strain 34H
  Wan, Microbial cell factories 2016
  • “...the crotonyl-CoA carboxylase-reductase (CCR) family, involved in extender-unit biosynthesis of polyketides [ 28 ]. Moreover, CPS_RS07445, upregulated 11-fold, codes for a short chain dehydrogenase/reductase family oxidoreductase (Fig. 6 b). CPS_RS07440, upregulated sixfold, codes for a FMN-dependent NADH-azoreductase. Genes CPS_RS18085 (11-fold) and CPS_RS18095 (fourfold), also code for...”
  • “...12 : Table S4). Fig.6 Structural prediction analysis of the CPS_RS06205 ( a ) and CPS_RS07445 ( b ) revealed their similarity to old yellow enzyme reductase OYE4 and short chain dehydrogenase/reductase, respectively Discussion Complexity of C. psychrerythraea fatty acid profile Although the major fatty acids...”

1xkqA / Q9N5G4 Crystal structure of short-chain dehydrogenase/reductase of unknown function from caenorhabditis elegans with cofactor
28% identity, 83% coverage

• Ligand: nadph dihydro-nicotinamide-adenine-dinucleotide phosphate (1xkqA)

LBL_1854 Short chain dehydrogenase from Leptospira borgpetersenii serovar Hardjo-bovis L550
33% identity, 72% coverage

• The sigma factor σ⁵⁴ is required for the long-term survival of Leptospira biflexa in water
  Zhang, Molecular microbiology 2018
  • “...protein LA_0274, LA_2982, LA_3713 LBL_0572, LBL_0299, LBL_2006, LBL_2140 LEPBI_I3255 2.32 COG0300R SDR family dehydrogenase/reductase LA_2621 LBL_1854 LEPBI_I2672 2.27 - Hypothetical protein LA_1273 LBL_2068 LEPBI_I0141 2.17 - Hypothetical protein No hit No hit LEPBI_I1418 2.16 COG0174E Glutamine synthetase (glutamate--ammonia ligase) LA_1313 LBL_1991 LEPBI_I3269 2.16 COG4974L Putative integrase...”

BCAS0713 putative short-chain oxidoreductase from Burkholderia cenocepacia J2315
32% identity, 75% coverage

• Burkholderia cenocepacia differential gene expression during host-pathogen interactions and adaptation to the host environment
  O'Grady, Frontiers in cellular and infection microbiology 2011
  • “...Aminopyrrolnitrin oxidase PrnD (fragment) 2.33 BCAS0588 Putative membrane protein (fragment) 1.52 BCAS0672 Hypothetical protein 1.91 BCAS0713 Putative short-chain oxidoreductase 1.66 BCAS0730 Putative Na+ dependent nucleoside transporter 2.13 BCAS0750 Putative exported protein 1.82 pBCA001 Putative partition protein 1.93 pBCA002 Putative partitioning protein 1.52 pBCA008 Conserved hypothetical protein...”

ABE785_01835 SDR family oxidoreductase from Levilactobacillus brevis
Q03TF9 Short-chain alcohol dehydrogenase from Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
26% identity, 91% coverage

• Whole genome sequence data of ZEN-degrading strain Levilactobacillus brevis PYN10_6_2 isolated from Tenebrio molitor larval feces
  Zhao, Data in brief 2024
  • “...of COG are known to have three coding sequences capable of producing 3-/3-HSD (ABE785_00920, ABE785_01750, ABE785_01835) present in the bacterial chromosome ( Fig. 3 ). This genome annotation data is valuable for elucidating the molecular mechanism of the biotransformation process of L. brevis PYN10_6_2 to ZEN...”
• Comprehensive characterization of γ-aminobutyric acid (GABA) production by Levilactobacillus brevis CRL 2013: insights from physiology, genomics, and proteomics
  Cataldo, Frontiers in microbiology 2024
  • “...number Gene Description Expression a ratio (CDMgYE/CDMg) p value Q03U32 adhE Aldehyde-alcohol dehydrogenase 11.4 0.002 Q03TF9 cpnA_1 Short-chain alcohol dehydrogenase 7.7 0.000 Q03TY7 fabG 3-oxoacyl-acyl carrier protein reductase 6.6 0.002 Q03PB4 rtpR Adenosylcobalamin-dependent ribonucleoside-triphosphate reductase 5.0 0.026 Q03RY6 pepA Dipeptidase 4.3 0.030 Q03NK2 gpmA1 Phosphoglycerate mutase...”

LOC101112590 estradiol 17-beta-dehydrogenase 12-B-like from Ovis aries
31% identity, 59% coverage

• Transcriptomic analysis reveals the molecular mechanisms of rumen wall morphological and functional development induced by different solid diet introduction in a lamb model
  Sun, Journal of animal science and biotechnology 2021
  • “...LOC101106720 ), and fatty acid metabolism ( OXSM , ACAA2 , ACADS , HADH , LOC101112590 , and HACD1 ). Discussion In the present study, a 42-day-old liquid feeding lamb model was established to eliminate the effect of age on the experiment. Meanwhile, lambs in MH...”

MSMEG_4722 short-chain dehydrogenase from Mycobacterium smegmatis str. MC2 155
35% identity, 69% coverage

• Association of Mycobacterium Proteins with Lipid Droplets
  Armstrong, Journal of bacteriology 2018
  • “...hup MSMEG_0863 MSMEG_3767 atpD MSMEG_6207 gapA MSMEG_4722 rpsQ MSMEG_4533 MSMEG_1028 MSMEG_0946 dxs MSMEG_0625 MSMEG_5430 MSMEG_3204 MSMEG_1981 MSMEG_4632...”

MAB_1537c Putative short chain dehydrogenase/reductase from Mycobacterium abscessus ATCC 19977
39% identity, 67% coverage

• Intrabacterial lipid inclusion-associated proteins: a core machinery conserved from saprophyte Actinobacteria to the human pathogen Mycobacterium tuberculosis
  Dargham, FEBS open bio 2023
  • “...Rv2484c Triacylglycerol synthase Nonessential MSMEG_4705 MAB_4544c MMAR_3835 MUL_3765 ML1244 RjosMsmeg Rv1544 Ketoacyl reductase Nonessential MSMEG_0737 MAB_1537c MMAR_2367 MUL_1543 ML0429c RjosMsmeg Rv0437c psd Phosphatidylserine decarboxylase Nonessential MSMEG_0861 MAB_0639c MMAR_0754 MUL_1386 ML0311c RjosMsmeg Rv3229c desA3 LinoleoylCoA desaturase Nonessential MSMEG_1743 MAB_2148 MMAR_1315 MUL_2565 RjosMsmeg Rv0154c fadE2 AcylCoA dehydrogenase Nonessential...”

GALLO_1207 putative short chain dehydrogenase from Streptococcus gallolyticus UCN34
33% identity, 65% coverage

• Biofilm formation and transcriptome analysis of Streptococcus gallolyticus subsp. gallolyticus in response to lysozyme
  Grimm, PloS one 2018
  • “...p. -1.07 0.02 0.48 GALLO_1493 hypothetical protein n. r. - n. r. -1.06 0.04 0.48 GALLO_1207 short chain dehydrogenase n. r. - n. r. -1.04 0.02 0.49 GALLO_1447 hypothetical protein n. r. - n. r. -1.02 0.04 0.49 n = 3; n. r. = no differences...”

CHCB2_SINCY / P0DXE1 Cis-4-hydroxycyclohexanecarboxylate dehydrogenase; Cis-4-hydroxyCHCA dehydrogenase; EC 1.1.1.438 from Sinomonas cyclohexanicum (Corynebacterium cyclohexanicum) (see paper)
29% identity, 91% coverage

• function: Dehydrogenase involved in a cyclohexanecarboxylate (CHCA) degradation pathway (PubMed:34583900). Catalyzes the NAD(+)-dependent dehydrogenation of cis-4-hydroxycyclohexanecarboxylate (cis-4- hydroxyCHCA) to form 4-oxocyclohexanecarboxylate (4-oxoCHCA) (PubMed:34583900). Is highly specific for the cis-4-hydroxy derivative and shows only weak activity with trans-4-hydroxyCHCA (PubMed:34583900). Cannot use NADP(+) (PubMed:34583900).
  catalytic activity: cis-4-hydroxycyclohexane-1-carboxylate + NAD(+) = 4- oxocyclohexane-1-carboxylate + NADH + H(+) (RHEA:79147)
  subunit: Homotetramer.

swb2 / D2KTX1 3-hydroxykynurenate reductase/dehydratase from Streptomyces sp. SNA15896 (see paper)
35% identity, 74% coverage

VK055_1916 SDR family NAD(P)-dependent oxidoreductase from Klebsiella pneumoniae subsp. pneumoniae
32% identity, 86% coverage

• A Serendipitous Mutation Reveals the Severe Virulence Defect of a Klebsiella pneumoniae fepB Mutant
  Palacios, mSphere 2017
  • “...family protein VK055_1919 Helix-turn-helix family protein VK055_1918 Hypothetical protein VK055_1917 Plasmid stabilization system family protein VK055_1916 Short-chain dehydrogenase family protein VK055_1915 Iron-containing alcohol dehydrogenase family protein VK055_1914 ABC transporter family protein VK055_1913 Branched-chain amino acid transport system/permease component family protein VK055_1912 Periplasmic binding and sugar binding...”

ZMO0318 short-chain dehydrogenase/reductase SDR from Zymomonas mobilis subsp. mobilis ZM4
28% identity, 89% coverage

• Systems biology analysis of Zymomonas mobilis ZM4 ethanol stress responses
  Yang, PloS one 2013
  • “...3 1.7 3.20E-03 0.1 6.31E-01 0 ZMO1334 YceI family protein 1.7 4.30E-05 1.4 3.98E-18 1 ZMO0318 short-chain dehydrogenase/reductase SDR 1.7 2.80E-08 1.1 8.51E-26 1 ZMO0948 Endopeptidase Clp 1.7 6.30E-08 0.6 3.47E-14 1 ZMO1424 ATPase 1.7 1.20E-11 0.5 3.31E-05 1 ZMO0921 hypothetical protein 1.7 1.20E-03 0.3 1.55E-13...”
  • “...heat shock protein DnaJ domain-containing gene (ZMO1690), protease ClpA gene (ZMO0405), short-chain dehydrogenase/reductase SDR gene (ZMO0318), alcohol dehydrogenase (ZMO1236) etc., which had a reduced gene expression (ca 1.6-fold to more than 2-fold change) but an increased protein expression (ca 1.6- to more than 8-fold change) levels...”

P39482 glucose 1-dehydrogenase [NAD(P)+] (EC 1.1.1.47) from Priestia megaterium (see paper)
27% identity, 86% coverage

• Cereulide synthetase gene cluster from emetic Bacillus cereus: structure and location on a mega virulence plasmid related to Bacillus anthracis toxin plasmid pXO1.
  Ehling-Schulz, BMC microbiology 2006
  • “...erythraea (GenBank accession no. M63676 ). GlcDh: Glucose 1-dehydrogenase from B. megaterium (Swissprot accession no. P39482). Figure 4 Hybridization of emetic and emetic-like B. cereus with probes targeting the ces operon (a) and a pXO1 related CDS (b) . Total DNA was separated by PFGE, transferred...”

VDAG_07187 3-oxoacyl-[acyl-carrier-protein] reductase from Verticillium dahliae VdLs.17
33% identity, 84% coverage

• The bZip Transcription Factor VdMRTF1 is a Negative Regulator of Melanin Biosynthesis and Virulence in Verticillium dahliae
  Lai, Microbiology spectrum 2022
  • “...in oxidoreductase activity were upregulated, the expression of the rest of DEGs (VDAG_01286, VDAG_03335, VDAG_03969, VDAG_07187, VDAG_07587, VDAG_08214, VDAG_10051, VDAG_10407, and VDAG_10485) were downregulated ( Fig.6D ). These results indicated that VdMRTF1 disrupted the expression of genes involved in oxidoreductase activity and hydrogen peroxide catabolic process...”

1g6kA / P40288 Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
27% identity, 86% coverage

• Ligand: nicotinamide-adenine-dinucleotide (1g6kA)

Q7Q6V7 AGAP005645-PA from Anopheles gambiae
25% identity, 94% coverage

• Expression of the mevalonate pathway enzymes in the Lutzomyia longipalpis (Diptera: Psychodidae) sex pheromone gland demonstrated by an integrated proteomic approach
  González-Caballero, Journal of proteomics 2014
  • “...dehydrogenases/reductases (SDR) family. + LL-314 Predicted dehydrogenase/Kog database 8 Protein with putative dehydrogenase domain + Q7Q6V7 AGAP005645-PA Belongs to the short-chain dehydrogenases/reductases (SDR) family. Anopheles gambiae 1 2 2 Short-chain dehydrogenase/reductase SDR (Pfam) SCP2 sterol-binding domain (SUPERFAMILY) Protein with putative dehydrogenase domain + E3WXS6 Uncharacterized protein...”

CHLNCDRAFT_53139 hypothetical protein from Chlorella variabilis
41% identity, 41% coverage

• Role of Mitochondria in Regulating Lutein and Chlorophyll Biosynthesis in Chlorella pyrenoidosa under Heterotrophic Conditions
  Liu, Marine drugs 2018
  • “...with binding function or cofactor requirement gi|307109894 Chlorella variabilis 38,764.5/6.68 9 51 U7 Hypothetical protein CHLNCDRAFT_53139 Antioxidant activity, Cell rescue, defense and virulence gi|307106076 Chlorella variabilis 21,778.9/8.35 1 40 U8 Hypothetical protein BAL199_15803 Unknown, Unknown gi|163792326 alpha proteobacterium 42,102.3/5.49 12 88 U9 Hypothetical protein CHLNCDRAFT_48477 Membrane...”

Rv1050 PROBABLE OXIDOREDUCTASE from Mycobacterium tuberculosis H37Rv
NP_215566 oxidoreductase from Mycobacterium tuberculosis H37Rv
32% identity, 61% coverage

• Characterization of a Novel Oxidative Stress Responsive Transcription Regulator in Mycobacterium bovis
  Jiang, Biomedicines 2024
  • “...in Mtb, and the oxidized MosR regulates the expression of a short-chain dehydrogenase encoded by rv1050 [ 11 ]. Similarly, OxyS in Mtb senses H 2 O 2 via cysteines (Cys25) and subsequently regulates the expression of the catalase KatG [ 11 , 46 ]. Also,...”
• Whole genome sequencing, analyses of drug resistance-conferring mutations, and correlation with transmission of Mycobacterium tuberculosis carrying katG-S315T in Hanoi, Vietnam
  Hang, Scientific reports 2019
  • “...Rv0740, Rv0790c, Rv0842, Rv0845, Rv0874c, Rv0876c, Rv0921, Rv0939, Rv0996, Rv1004c, Rv1024, Rv1043c, Rv1045, Rv1047, Rv1048c, Rv1050, Rv1069c, Rv1085c, Rv1178, Rv1225c, Rv1273c, Rv1313c, Rv1318c, Rv1372, Rv1395, Rv1425, Rv1455, Rv1488, Rv1498A, Rv1499, Rv1526c, Rv1610, Rv1667c, Rv1683, Rv1702c, Rv1707, Rv1714, Rv1725c, Rv1726, Rv1728c, Rv1729c, Rv1739c, Rv1749c, Rv1815, Rv1825, Rv1828,...”
• N-methylation of a bactericidal compound as a resistance mechanism in Mycobacterium tuberculosis
  Warrier, Proceedings of the National Academy of Sciences of the United States of America 2016
  • “...DNA and subsequent upregulation of the putative oxidoreductase Rv1050 (38). Rv1404 was involved in Mtb's response to acid and hypoxia by up-regulating 10 genes,...”
• Thiol-based redox switches in prokaryotes
  Hillion, Biological chemistry 2015
  • “...(GTGTAnnTACAC) in its target promoters and represses its own transcription and that of the adjacent rv1050 gene, encoding an exported oxidoreductase of unknown function ( Brugarolas et al, 2012 ). The rv1050 gene was most strongly induced by H 2 O 2 and 352-fold derepressed in...”
  • “...et al, 2003 ). In addition, arachidonic acid and linoleic acid were found to induce rv1050 indicating that Rv1050 could also function in fatty acid metabolism in macrophages. MosR contains four Cys residues (Cys10, 12, 96, 147), but only Cys12 is conserved. The Cys10 and Cys12...”
• The oxidation-sensing regulator (MosR) is a new redox-dependent transcription factor in Mycobacterium tuberculosis
  Brugarolas, The Journal of biological chemistry 2012
  • “...main role of MosR is to up-regulate expression of rv1050 (a putative exported oxidoreductase that has not yet been characterized) in response to oxidants and...”
  • “...unveiled similar sequences in the promoter regions of rv1050, ndhA, narL, narX, ndhA, and esxR (Fig. 4B). We then tested for bindJOURNAL OF BIOLOGICAL...”
• The oxidation-sensing regulator (MosR) is a new redox-dependent transcription factor in Mycobacterium tuberculosis.
  Brugarolas, The Journal of biological chemistry 2012
  • GeneRIF: Data show that the main role of the oxidation-sensing regulator, Rv1049 or MosR, is to up-regulate expression of rv1050 (a putative exported oxidoreductase) in response to oxidants.

AT3G55310 binding / catalytic/ oxidoreductase from Arabidopsis thaliana
31% identity, 67% coverage

• The DNA methylation landscape of the root-knot nematode-induced pseudo-organ, the gall, in Arabidopsis, is dynamic, contrasting over time, and critically important for successful parasitism
  Silva, The New phytologist 2022
  • “...CHH 15 1.3 AT3TE48840 HELITRON AT3G45160 Putative membrane lipoprotein CHH 22 1.22 AT3TE67015 HELITRON 1.72 AT3G55310 NAD(P)binding Rossmannfold superfamily protein CG 29 1.97 AT3TE83365 COPIA AT4G00755 Fbox family protein CHH 27 0.88 AT4TE01700 HELITRON AT4G13110 BSD domaincontaining protein CG 18 0.59 AT4G13160 Zeinbinding protein (Protein of...”
• Genome-Wide Mapping of Histone H3 Lysine 4 Trimethylation (H3K4me3) and Its Involvement in Fatty Acid Biosynthesis in Sunflower Developing Seeds
  Moreno-Pérez, Plants (Basel, Switzerland) 2021
  • “...Yes Yes KAR (Ketoacyl-ACP Reductase) At1g24360 At1g62610 At3g46170 HanXRQChr17g0536131 Yes Yes At3g55290 HanXRQChr10g0318431 Yes Yes At3g55310 HAD (Hydroxyacyl-ACP Dehydrase) At2g22230 HanXRQChr03g0066951 Yes Yes At5g10160 ER (Enoyl-ACP Reductase) At2g05990 HanXRQChr02g0056711 No Yes HanXRQChr17g0564011 Yes Yes HACPS (Holo-ACP Synthase) At3g11470 HanXRQChr08g0212801 Yes Yes HanXRQChr07g0194021 No Yes SAD (Stearoyl-ACP...”
• In silico identification and comparative genomics of candidate genes involved in biosynthesis and accumulation of seed oil in plants
  Sharma, Comparative and functional genomics 2012
  • “...Glyma15g00550 Glyma18g44350 1215 186 1233 1194 831 1254 Elongase 3-Ketoacyl- acp- dehydrase At1g62610 At3g46170 At3g55290 At3g55310 AF382146 30147.m013777 Glyma08g10760 Glyma18g01280 924 867 822 822 735 924 963 3-Ketoacyl- Co-A reductase (KAR) At1g24360 AY196197 29929.m004732 Glyma11g37320 927 960 987 963 Enoyl-ACP reductase (ENR) At2g05990 AJ243087 AJ243088 AJ243089...”
  • “...ACP dehydrase 30200.m000354 Caleosin At5g55240 Glyma20g34300 Leaves FatB 29848.m004677 LPAAT Glyma07g07580 3-Ketoacyl- acp- dehydrase At3g55290 At3g55310 Flowers DGD1 28726.m000069 Beta- carboxyl transferase 28890.m000006 ACCase 29908.m005991 Roots Stearoyl desaturase At3g02620 Roots + flowers Stearoyl desaturase At3g02610 Seed + flowers Oleosin At1g48990 Leaves + flowers FAD 7 At3g11170...”

XP_006246534 dehydrogenase/reductase SDR family member 7B isoform X1 from Rattus norvegicus
29% identity, 70% coverage

• Comparison of predicted and experimental subcellular localization of two putative rat steroid dehydrogenases from the short-chain dehydrogenase/reductase protein superfamily.
  Keller, Molecular and cellular endocrinology 2009 (PubMed)
  • GeneRIF: The localization studies on rat short-chain dehydrogenases/reductases dhrs7b and dhrs8, are shown.

LOC110736399 dehydrogenase/reductase SDR family member 7-like from Chenopodium quinoa
27% identity, 77% coverage

• Single-cell transcriptomic analysis reveals the developmental trajectory and transcriptional regulatory networks of quinoa salt bladders
  Liu, Stress biology 2024
  • “...related to lipid metabolism (Bazihizina et al. 2022 ). S hort chain-dehydrogenase/reductases ( SDR / LOC110736399 ) are specifically expressed in clusters 4, 6, and 9, and salt stress in quinoa can be alleviated by up-regulated expression of SDR genes (Al-Mushhin et al. 2021 ). Fig.3...”

SF5M90T_2416 SDR family oxidoreductase UcpA from Shigella flexneri 5a str. M90T
36% identity, 69% coverage

• RNA-seq analysis of the influence of anaerobiosis and FNR on Shigella flexneri
  Vergara-Irigaray, BMC genomics 2014
  • “...metabolism SF5M90T_1094 acpP acyl carrier protein 1.70 -3.04 SF5M90T_2272 menE o-succinylbenzoate-CoA ligase 1.60 -1.54 -1.80 SF5M90T_2416 ucpA putative oxidoreductase 1.45 -0.56 SF5M90T_339 sbmA sensitivity to microcin B17, possibly envelope protein -1.64 Inorganic ion transport and metabolism SF5M90T_2903 hypothetical lipoprotein 3.41 SF5M90T_929 ycbO alkanesulfonate transporter substrate-binding subunit...”

A0R723 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100); acetoacetyl-CoA reductase (EC 1.1.1.36) from Mycolicibacterium smegmatis (see paper)
MSMEG_6753 oxidoreductase, short chain dehydrogenase/reductase family protein from Mycobacterium smegmatis str. MC2 155
29% identity, 91% coverage

• Association of Mycobacterium Proteins with Lipid Droplets
  Armstrong, Journal of bacteriology 2018
  • “...dxs MSMEG_0625 MSMEG_5430 MSMEG_3204 MSMEG_1981 MSMEG_4632 MSMEG_6753 MSMEG_0220 cwsA MSMEG_0424 MSMEG_6291 asnB rpsG MSMEG_1882 MSMEG_3287 atpA icd2 MSMEG_0918...”
• Binding of NADP⁺ triggers an open-to-closed transition in a mycobacterial FabG β-ketoacyl-ACP reductase
  Blaise, The Biochemical journal 2017 (PubMed)
  • “...the Mycobacterium smegmatis genome uncovered several putative FabG-like proteins. Among them, we identified M. smegmatis MSMEG_6753 whose gene was found adjacent to MSMEG_6754, encoding a recently characterized enoyl-CoA dehydratase, and to MSMEG_6755, encoding another potential reductase. Recombinantly expressed and purified MSMEG_6753 exhibits ketoacyl reductase activity in...”
  • “...in a fabG thermosensitive Escherichia coli mutant. Furthermore, comparison of the apo and the NADP+-bound MSMEG_6753 crystal structures showed that cofactor binding induces a closed conformation of the protein. A MSMEG_6753 deletion mutant could be generated in M. smegmatis, indicating that this gene is dispensable for...”

EHI_165070 short chain dehydrogenase family protein from Entamoeba histolytica HM-1:IMSS
29% identity, 70% coverage

• Tetraspanin-enriched microdomains play an important role in pathogenesis in the protozoan parasite Entamoeba histolytica
  Jiang, PLoS pathogens 2024
  • “...TSPAN12 and TSPAN13 in E . histolytica ( Table 1 ). TBP55 also pulled down EHI_165070 at the mean QV of 17.1 in all three trials. EHI_165070 is annotated as short chain dehydrogenase, and was identified to be involved in fatty acid elongation [ 23 ]....”
  • “...EHI_001100 3 267.8 (0.9) TBP55 EHI_107790 3 62.8 (0) TSPAN13 EHI_091490 3 17.7 (0) TSPAN12 EHI_165070 3 17.1 (4.3) Short chain dehydrogenase EHI_076870 2 54.9 (20.0) Steroid 5-alpha reductase EHI_040700 2 24.0 (9.1) Coatomer subunit gamma EHI_054830 2 19.3 (6.0) Calcium-transporting ATPase EHI_163540 2 14.3 (2.9)...”
• Entamoeba histolytica: Proteomics Bioinformatics Reveal Predictive Functions and Protein-Protein Interactions of Differentially Abundant Membrane and Cytosolic Proteins
  Azmi, Membranes 2021
  • “...Uncharacterized protein - 2.3102 EHI_129750 Rho family GTPase - 2.0333 EHI_198580 Uncharacterized protein Yes 2.4443 EHI_165070 Estradiol 17-beta-dehydrogenase putative - 2.6115 EHI_023360 Alpha-amylase family protein - 3.6739 EHI_065790 Rab family GTPase (Fragment) - 2.3510 EHI_152280 Serine palmitoyltransferase putative Yes 2.6371 EHI_199590 70 kDa heat shock protein...”
• Lipids in Entamoeba histolytica: Host-Dependence and Virulence Factors
  Castellanos-Castro, Frontiers in cellular and infection microbiology 2020
  • “...acid elongation cycle (FAE) (Ramakrishnan et al., 2013 ): (i) the very-long-chain 3-oxoacyl CoA reductase (EHI_165070), (ii) the very-long-chain-3-hydroxyl-CoA dehydratase (EHI_110570) and (iii) the very-long-chain enoyl-CoA reductase (EHI_045030). Moreover, studies using proteomic approaches, reported the presence of two 3-ketoacyl-CoA synthases (EHI_158240 and EHI_112870) in purified trophozoite...”
  • “...Enzymes involved in fatty acid elongation. Name Entry EC 17 beta-estradiol 17-dehydrogenase/very-long- chain 3-oxoacyl-CoA reductase EHI_165070 1.1.1.330 Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase EHI_110570 4.2.1.134 Very-long-chain enoyl-CoA reductase EHI_045030 1.3.1.93 Fatty acid elongase (3-ketoacyl-CoA synthase EHI_158240 * na Fatty acid elongase (3-ketoacyl-CoA synthase EHI_112870 * EHI_111000 EHI_092190 EHI_009370 na...”

5t2uA / A0R723 Short chain dehydrogenase/reductase family protein (see paper)
29% identity, 91% coverage

• Ligand: nadp nicotinamide-adenine-dinucleotide phosphate (5t2uA)

DRS7B_RAT / Q5RJY4 Dehydrogenase/reductase SDR family member 7B; Short-chain dehydrogenase/reductase family 32C member 1; Protein SDR32C1; EC 1.1.-.- from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 68% coverage

• function: Putative oxidoreductase.
• Brown Adipose Tissue Sheds Extracellular Vesicles That Carry Potential Biomarkers of Metabolic and Thermogenesis Activity Which Are Affected by High Fat Diet Intervention.
  Camino, International journal of molecular sciences 2022
  • “...2.87 S100B_RAT P04631 Protein S100-B 0.018 2.78 CLYBL_RAT Q5I0K3 Citramalyl-CoA lyase. mitochondrial 0.019 2.67 DRS7B_RAT Q5RJY4 Dehydrogenase/reductase SDR family member 7B 0.027 2.65 UCP1_RAT P04633 Mitochondrial brown fat uncoupling protein 1 0.053 2.64 ALBU_RAT P02770 Albumin 0.038 2.59 ODBB_RAT P35738 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 0.029...”
• Preliminary quantitative profile of differential protein expression between rat L6 myoblasts and myotubes by stable isotope labeling with amino acids in cell culture.
  Cui, Proteomics 2009
  • “...thioesterase 7 IPI00213571.1 1.84NA 1 Q64559 26759 Dehydrogenase/reductase (SDR family) member 7B IPI00369545.2 3.09NA 1 Q5RJY4 287380 11 kDa protein IPI00390086.2 1.83NA 1 Q6IBB3(h) 690441 Ubiquinol-cytochrome c reductase complex 11 kDa protein, mitochondrial precursor IPI00369093.1 2.48NA 1 Q5M9I5 366448 20alpha-hydroxysteroid dehydrogenase IPI00189189.2 23.55NA 1 Q91XV8 171516...”

V9NF79 diacetyl reductase [(R)-acetoin forming] (EC 1.1.1.303) from Paenibacillus polymyxa (see paper)
28% identity, 92% coverage

CG9150 uncharacterized protein from Drosophila melanogaster
25% identity, 94% coverage

• Homeostatic maintenance and age-related functional decline in the Drosophila ear
  Keder, Scientific reports 2020
  • “...8186.2 CG8086 Odf3 8186.2 CG8369 157754.2 CG8407 Dnal4 204.2 CG8419 Trim45 155.7 CG8560 Cpb1 23.6 CG9150 Dhrs11 258.9 CG9317 Slc22a1 73.3 cpx Cplx1, Clpx2 complexin 9601.1 Dhc36C Dnah7b, Dnah7a, Dnah7c Dynein heavy chain at 36C 656.9 dila Cep131 dilatory 282.5 eys Agrn eyes shut 972.6 Fer1...”
• Glass promotes the differentiation of neuronal and non-neuronal cell types in the Drosophila eye
  Morrison, PLoS genetics 2018
  • “...levels are high in the wild type brain compared to the eye disc. CG18765 and CG9150 are induced specifically in the wing and the brain, respectively, despite low basal levels in the other tissue. Cyp4p2 is induced by ectopic Gl but is not enriched in the...”
  • “..., Ekar , inaC , chp , nrm ) and 6 in cone cells ( CG9150 , cd , CG5653 , sls , CG11498 , Cad88C ). (TIF) Click here for additional data file. S4 Fig Somatic CRISPR effectively mutates gl . (A) Schematic showing the...”
• Genetic complexity in a Drosophila model of diabetes-associated misfolded human proinsulin
  Park, Genetics 2014
  • “...(GMR-Gal4, WT-6, WT-24, M-101, and M-1) for five genes sets (CG3966, CG7130, CG10420, CG10160, and CG9150) whose expression was upregulated in males ( Figure 2C ). The results showed excellent correspondence between microarray and qRT-PCR ( Table S6 ). Expression of wild-type and mutant hINS in...”

BPHY_RS37740, Bphy_7637 SDR family oxidoreductase from Paraburkholderia phymatum STM815
27% identity, 93% coverage

• Metabolomics and Dual RNA-Sequencing on Root Nodules Revealed New Cellular Functions Controlled by Paraburkholderia phymatum NifA
  Bellés-Sancho, Metabolites 2021
  • “...protein Bphy_7751 7.11 BPHY_RS38170 protein FixC Bphy_7737 fixC 7.11 BPHY_RS37030 ISL3 family transposase Bphy_7486 7.17 BPHY_RS37740 SDR family NAD(P)-dependent oxidoreductase Bphy_7637 7.21 BPHY_RS38230 IS630 family transposase Bphy_7749 7.34 BPHY_RS38255 nitrogenase iron protein Bphy_7753 nifH 7.40 BPHY_RS36670 aldehyde dehydrogenase family protein Bphy_7406 7.41 BPHY_RS38525 LysR family transcriptional...”
  • “...FixC Bphy_7737 fixC 7.11 BPHY_RS37030 ISL3 family transposase Bphy_7486 7.17 BPHY_RS37740 SDR family NAD(P)-dependent oxidoreductase Bphy_7637 7.21 BPHY_RS38230 IS630 family transposase Bphy_7749 7.34 BPHY_RS38255 nitrogenase iron protein Bphy_7753 nifH 7.40 BPHY_RS36670 aldehyde dehydrogenase family protein Bphy_7406 7.41 BPHY_RS38525 LysR family transcriptional regulator Bphy_7810 7.42 BPHY_RS36065 carbamoyltransferase...”

BAB1_0483 Short-chain dehydrogenase/reductase SDR:Glucose/ribitol dehydrogenase from Brucella melitensis biovar Abortus 2308
34% identity, 73% coverage

• Brucella abortus choloylglycine hydrolase affects cell envelope composition and host cell internalization
  Marchesini, PloS one 2011
  • “...5.42 29.3 27.1 5.7 BAB2_0883 C 39 3-ketoacyl-(acyl-carrier-protein) reductase gi|17987760 6.44 6.44 26.7 26.0 3.1 BAB1_0483 C 51 Chaperone protein DNAJ gi|17988284 6.34 6.51 42.6 41.1 2.3 BAB1_2130 C 59 Transcription antitermination protein NusG1 gi|17987027 5.99 6.64 20.9 19.7 2.6 BAB1_1269 U Exp.: experimental; Theor.: theoretical;...”
  • “...6.13 47.2 36.3 2.8 BAB1_1741 C 31 3-ketoacyl-(acyl-carrier-protein) reductase gi|17987760 6.25 6.44 25.0 26.0 6.7 BAB1_0483 C 32 22 kDa Omp gi|17987000 6.19 8.59 23.3 19.4 2.7 BAB1_1302 OM 45 Argininosuccinate synthase gi|17988153 6.15 6.06 57.9 45.3 4.5 BAB1_0071 C 48 ATP synthase alpha chain 4...”
• Intracellular adaptation of Brucella abortus
  Lamontagne, Journal of proteome research 2009
  • “...the inner membrane proteins 3-hydroxydecanoyl-ACP dehydratase FabA (BAB1_2174), Acetyl-CoA carboxylase (BAB1_0925) and 3-ketoacyl-acyl-carrier reductase FabG (BAB1_0483), as well as the glutaryl-CoA dehydrogenase GcdH (BAB1_1109), involved in the synthesis of fatty acids for membrane lipids, were all reduced early after infection, suggesting that Acetyl-CoA may be in...”
  • “...71 BAB2_0233 Iron metabolism Ton B, Fiu-like 72 BAB2_0505 LPS synthesis BA14 lectin like 73 BAB1_0483 Lipid metabolism FabG 74 BAB1_0486 Lipid metabolism FabF 75 BAB1_2185 Lipid metabolism Ech 76 BAB1_2174 Lipid metabolism FabA 77 BAB2_0975 Lipid metabolism FabC 78 BAB2_1008 Cell division MepA 79 BAB1_1530...”

7w61A Crystal structure of farnesol dehydrogenase from helicoverpa armigera (see paper)
25% identity, 94% coverage

• Ligand: nadp nicotinamide-adenine-dinucleotide phosphate (7w61A)

PG2069 oxidoreductase, short chain dehydrogenase/reductase family from Porphyromonas gingivalis W83
HMPREF1322_RS07305 SDR family NAD(P)-dependent oxidoreductase from Porphyromonas gingivalis W50
29% identity, 87% coverage

• Hemin availability induces coordinated DNA methylation and gene expression changes in Porphyromonas gingivalis
  Costeira, mSystems 2023
  • “...were over-expressed in excess hemin including the SDR family oxidoreductase HMPREF1322_RS07305 ( P. gingivalis W83: PG2069) and the Ppx/GppA family phosphatase HMPREF1322_RS06180 ( P. gingivalis W83: PG1739) genes ( Table 5 ). In all the eight cases, the DMA was on the same strand as the...”
• Hemin availability induces coordinated DNA methylation and gene expression changes in Porphyromonas gingivalis
  Costeira, 2022
• A Novel Regulation of K-antigen Capsule Synthesis in <i>Porphyromonas gingivalis</i> Is Driven by the Response Regulator PG0720-Directed Antisense RNA
  Kim, Frontiers in oral health 2021
  • “...synthase QueC 0.74 PG1435 Site-specific integrase 0.64 PG2014 cas1b Type I-B CRISPR-associated endonuclease Cas1 3.79 PG2069 SDR family oxidoreductase 0.59 Others PG0217 Hypothetical protein 1.20 PG0218 Hypothetical protein 0.86 PG0987 DUF4252 domain-containing protein 1.04 PG1492 GLPGLI family protein 1.14 PG1493 Hypothetical protein 0.81 PG1508 Hypothetical protein...”
• Studies of the extracytoplasmic function sigma factor PG0162 in Porphyromonas gingivalis
  Dou, Molecular oral microbiology 2016
  • “...3.17886E-15 PG1221 short chain dehydrogenase/reductase family oxidoreductase 2.1 4.91002E-11 PG1545 superoxide dismutase, Fe-Mn 2.7 0.000957244 PG2069 short chain dehydrogenase/reductase family oxidoreductase 1.6 9.94896E-16 Table 4 Real-time quantitative PCR analysis of differentially expressed genes in FLL391 Gene Annotation Fold-change (FLL391/W83) Real-time PCR DNA microarray PG0245 universal stress...”
• Hemin availability induces coordinated DNA methylation and gene expression changes in Porphyromonas gingivalis
  Costeira, mSystems 2023
  • “...synthase (HMPREF1322_RS02110), electron transport complex subunits (e.g., HMPREF1322_RS04875, HMPREF1322_RS04865, and HMPREF1322_RS04880), SDR family/ferredoxin oxidoreductases (e.g., HMPREF1322_RS07305 and HMPREF1322_RS04445), and several dehydrogenases ( Table 1 ; Table S1 ). Most of these genes encode proteins that contain iron as part of their tertiary structure. Three operonic genes,...”
  • “...7.17E-21 rpsO 30S ribosomal protein S15 HMPREF1322_RS07695 18,257.75 2.38 0.26 1.73E-20 50S ribosomal protein L28 HMPREF1322_RS07305 39,671.02 3.52 0.38 3.70E-20 SDR family oxidoreductase HMPREF1322_RS06590 3,693.30 2.34 0.26 7.00E-20 Lipoprotein signal peptidase HMPREF1322_RS04880 1,646.03 2.96 0.33 7.77E-20 Electron transport complex subunit E HMPREF1322_RS07315 10,873.97 2.21 0.24 2.04E-19...”

HSDA_SESIN / Q93W57 11-beta-hydroxysteroid dehydrogenase A; 17-beta-hydroxysteroid dehydrogenase A; Seed oil body protein 2; Steroleosin-A; EC 1.1.1.-; EC 1.1.1.62 from Sesamum indicum (Oriental sesame) (Sesamum orientale) (see 3 papers)
32% identity, 55% coverage

• function: Has dehydrogenase activity against corticosterone (11 beta- hydroxysteroid) and estradiol (17 beta-hydroxysteroid), with higher activity against estradiol. Possesses higher dehydrogenase activity with NADP(+) than NAD(+) regardless of the sterol substrate. May be involved in signal transduction regulated by various sterols.
  catalytic activity: an 11beta-hydroxysteroid + NADP(+) = an 11-oxosteroid + NADPH + H(+) (RHEA:11388)
  catalytic activity: an 11beta-hydroxysteroid + NAD(+) = an 11-oxosteroid + NADH + H(+) (RHEA:53116)
  catalytic activity: corticosterone + NADP(+) = 11-dehydrocorticosterone + NADPH + H(+) (RHEA:42200)
  catalytic activity: corticosterone + NAD(+) = 11-dehydrocorticosterone + NADH + H(+) (RHEA:42204)
  catalytic activity: 17beta-estradiol + NADP(+) = estrone + NADPH + H(+) (RHEA:24616)
  catalytic activity: 17beta-estradiol + NAD(+) = estrone + NADH + H(+) (RHEA:24612)

AT3G55290 short-chain dehydrogenase/reductase (SDR) family protein from Arabidopsis thaliana
30% identity, 67% coverage

• A peroxisomal heterodimeric enzyme is involved in benzaldehyde synthesis in plants
  Huang, Nature communications 2022
  • “...Two (CS868457 and SALK_136638C) and three (SALK_209249C, CS862843, and CS866390) T-DNA insertion lines of AtBS (At3g55290) and AtBS (At3g01980), respectively, (Supplementary Fig. 15a ) were obtained from ABRC and their homozygosity was confirmed by genomic PCR analysis with gene-specific primers flanking the insertion sites, which failed...”
• Genome-Wide Mapping of Histone H3 Lysine 4 Trimethylation (H3K4me3) and Its Involvement in Fatty Acid Biosynthesis in Sunflower Developing Seeds
  Moreno-Pérez, Plants (Basel, Switzerland) 2021
  • “...HanXRQChr05g0148701 Yes Yes HanXRQChr17g0550351 Yes Yes KAR (Ketoacyl-ACP Reductase) At1g24360 At1g62610 At3g46170 HanXRQChr17g0536131 Yes Yes At3g55290 HanXRQChr10g0318431 Yes Yes At3g55310 HAD (Hydroxyacyl-ACP Dehydrase) At2g22230 HanXRQChr03g0066951 Yes Yes At5g10160 ER (Enoyl-ACP Reductase) At2g05990 HanXRQChr02g0056711 No Yes HanXRQChr17g0564011 Yes Yes HACPS (Holo-ACP Synthase) At3g11470 HanXRQChr08g0212801 Yes Yes HanXRQChr07g0194021...”
• Interference with jasmonic acid-regulated gene expression is a general property of viral suppressors of RNA silencing but only partly explains virus-induced changes in plant-aphid interactions
  Westwood, The Journal of general virology 2014
  • “...anti-insect defence. Also monitored was an N. benthamiana orthologue of the JA-inducible A. thaliana transcript AT3G55290 , which encodes a putative protein of no known function in the NAD(P)-binding Rossmann-fold superfamily ( Lewsey et al. , 2010 ). PCR primer information is provided in Table S1...”
  • “...coupled to quantitative PCR was performed to measure the transcript abundance of the JA-regulated transcripts AT3G55290 (a), lipoxygenase 2 ( LOX2 ) (b), DEFENSIN 2.2 ( DEF2.2 ) (c) and TRYPSIN PROTEINASE INHIBITOR ( TPI ) (d). Transcript accumulation levels were compared with those in mock-inoculated...”
• In silico identification and comparative genomics of candidate genes involved in biosynthesis and accumulation of seed oil in plants
  Sharma, Comparative and functional genomics 2012
  • “...Glyma09g41380 Glyma15g00550 Glyma18g44350 1215 186 1233 1194 831 1254 Elongase 3-Ketoacyl- acp- dehydrase At1g62610 At3g46170 At3g55290 At3g55310 AF382146 30147.m013777 Glyma08g10760 Glyma18g01280 924 867 822 822 735 924 963 3-Ketoacyl- Co-A reductase (KAR) At1g24360 AY196197 29929.m004732 Glyma11g37320 927 960 987 963 Enoyl-ACP reductase (ENR) At2g05990 AJ243087 AJ243088...”
  • “...Hydroxyacyl ACP dehydrase 30200.m000354 Caleosin At5g55240 Glyma20g34300 Leaves FatB 29848.m004677 LPAAT Glyma07g07580 3-Ketoacyl- acp- dehydrase At3g55290 At3g55310 Flowers DGD1 28726.m000069 Beta- carboxyl transferase 28890.m000006 ACCase 29908.m005991 Roots Stearoyl desaturase At3g02620 Roots + flowers Stearoyl desaturase At3g02610 Seed + flowers Oleosin At1g48990 Leaves + flowers FAD 7...”
• The plant short-chain dehydrogenase (SDR) superfamily: genome-wide inventory and diversification patterns
  Moummou, BMC plant biology 2012
  • “...S alutaridine reductase, Menthone reductase, Isopiperitenone reductase ViridP 45,4 AT5G50600 SDR119C Hydroxysteroid Dehydrogenase LandP 44,4 AT3G55290 SDR132C Solanum tuberosum TDF511 ViridP 62,4 AT1G24360 SDR152C FAS-II- -ketoacyl reductase (FabG) ViridP 68,3 AT1G10310 SDR357C Pterin aldehyde reductase (folate salvage) TracheoP 70,0 AT5G10050 SDR368C - ViridP 45,8 AT4G27760 SDR369C...”
• Defining the plant peroxisomal proteome: from Arabidopsis to rice
  Kaur, Frontiers in plant science 2011
  • “...al. ( 2007 , 2009 ), Lisenbee et al. ( 2005 ) LOC_Os08g44340 AKV SDR At3g55290 Short-chain dehydrogenase/reductase SSL LOC_Os08g39960 SSL Eubel et al. ( 2008 ), Reumann et al. ( 2007 , 2009 ) ZnDH At3g56460 Zinc-binding dehydrogenase SKL LOC_Os05g24880 SRL Eubel et al. (...”

MT1283 oxidoreductase, short-chain dehydrogenase/reductase family from Mycobacterium tuberculosis CDC1551
Rv1245c PROBABLE SHORT-CHAIN TYPE DEHYDROGENASE/REDUCTASE from Mycobacterium tuberculosis H37Rv
31% identity, 78% coverage

• Metronidazole lacks activity against Mycobacterium tuberculosis in an in vivo hypoxic granuloma model of latency
  Klinkenberg, The Journal of infectious diseases 2008
  • “...HF 2.07 MT0909 Rv0886 fprB R,Mo HF,Mo Aero 3.57 MT1161 Rv1129c - R,Mo HF 2.00 MT1283 Rv1245c - R,Mo HF 2.56 MT1449 Rv1405c - R <1 MT1944 Rv1894c - R,Mo HF,GP Aero 36.92 MT2084 Rv2025c - R,GP HF,GP Aero <1 MT2090 Rv2031c hspX/acr R,Mo HF 8.30...”
• Rv0687 a Putative Short-Chain Dehydrogenase Is Required for In Vitro and In Vivo Survival of Mycobacterium tuberculosis
  Bhargavi, International journal of molecular sciences 2024
  • “...The genome of Mtb possess 23 SDRs, namely Rv0148, Rv0484c, Rv0687, Rv0851c, Rv0927c, Rv0945, Rv1144, Rv1245c, Rv1865c, Rv1882c, Rv1928c, Rv1941, Rv2214c, Rv2509, Rv2766c, Rv2857c, Rv3085, Rv3174, Rv3224, Rv3485c, Rv3502c, Rv3548c and Rv3549c (as listed in Mycobrowser) and only a few of these are characterized [ 25...”
• Genome-wide screen identifies host loci that modulate Mycobacterium tuberculosis fitness in immunodivergent mice
  Meade, G3 (Bethesda, Md.) 2023
  • “...144.184 3.97 30.593 145.321 3.46E02 hp061 Rv3698 Rv3698 7 144.309 3.41 12.026 145.321 3.60E02 hp062 Rv1245c Rv1245c 7 144.446 3.97 40.289 145.321 2.62E03 hp063 Rv2092c helY 7 144.687 5.34 144.533 145.321 2.50E02 hp064 Rv0458 Rv0458 7 145.321 3.92 144.448 145.321 2.93E02 hp065 Rv0538 Rv0538 8 11.279...”
• Mycobacterium tuberculosis pellicles express unique proteins recognized by the host humoral response
  Kerns, Pathogens and disease 2014
  • “...polymerase RpsE 30S ribosomal protein S5 Rv0721 10.8 22.9 + + + + Protein translation Rv1245c Probable short-chain type dehydrogenase/reductase Rv1245c 8.0 29.2 + + + + Unknown Rv1771 L-gulono-1,4-lactone dehydrogenase Rv1771 7.6 48.0 + + + + Possibly vitamin C synthesis SodA Superoxide dismutase Rv3846...”
• Metronidazole lacks activity against Mycobacterium tuberculosis in an in vivo hypoxic granuloma model of latency
  Klinkenberg, The Journal of infectious diseases 2008
  • “...2.07 MT0909 Rv0886 fprB R,Mo HF,Mo Aero 3.57 MT1161 Rv1129c - R,Mo HF 2.00 MT1283 Rv1245c - R,Mo HF 2.56 MT1449 Rv1405c - R <1 MT1944 Rv1894c - R,Mo HF,GP Aero 36.92 MT2084 Rv2025c - R,GP HF,GP Aero <1 MT2090 Rv2031c hspX/acr R,Mo HF 8.30 MT2137...”
• Global transcriptional profile of Mycobacterium tuberculosis during THP-1 human macrophage infection
  Fontán, Infection and immunity 2008
  • “...infection Ratiob Description Functional category(ies)c ORF08416 Rv0692 Rv1245c Rv1285 Rv1665 Rv1687c Hypothetical protein Rv0692 Rv1245c cysD pks11 Rv1687c 2.08...”
• Surviving the acid test: responses of gram-positive bacteria to low pH
  Cotter, Microbiology and molecular biology reviews : MMBR 2003
  • “...Rv3616c Rv1130 Rv1131 (gltA1) Rv2428 (ahpC) Rv2429 (ahpD) Rv1245C Rv2007c (fdxA) Rv1404 Predicted protein VOL. 67, 2003 RESPONSES OF GRAM-POSITIVE BACTERIA TO...”
• Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes
  Fisher, Journal of bacteriology 2002
  • “...Hypothetical protein Conserved hypothetical protein (resuscitation-promoting factor) Rv1245c Rv2007c Rv1404 MT0196 Rv1169c Rv0582 Rv2450c fdxA PE (rpfE) a Genes...”

LOC103713735 11-beta-hydroxysteroid dehydrogenase A-like from Phoenix dactylifera
33% identity, 54% coverage

• Biochemical, Transcriptional, and Bioinformatic Analysis of Lipid Droplets from Seeds of Date Palm (Phoenix dactylifera L.) and Their Use as Potent Sequestration Agents against the Toxic Pollutant, 2,3,7,8-Tetrachlorinated Dibenzo-p-Dioxin
  Hanano, Frontiers in plant science 2016
  • “...CLO_like5_DATE XP_008796441 LOC103711900 103 11.92 5.14 Steroleosins STEROLEO_Like1_DATE XP_008811369 LOC103722549 330 37.09 5.92 STEROLEO_Like2_DATE XP_008798974 LOC103713735 349 38.48 6.72 STEROLEO_Like3_DATE XP_008806995 LOC103719497 336 37.84 6.20 STEROLEO_Like4_DATE XP_008788738 LOC103706421 195 21.34 7.22 STEROLEO_Like5_DATE XP_008798975 LOC103713735 256 28.38 7.56 Statistical Analysis All data are expressed as mean standard...”

OP10G_1224 SDR family NAD(P)-dependent oxidoreductase from Fimbriimonas ginsengisoli Gsoil 348
34% identity, 74% coverage

• The first complete genome sequence of the class Fimbriimonadia in the phylum Armatimonadetes
  Hu, PloS one 2014
  • “...S1 ). Noteworthy, a 1,587 bp fragment composed of two short-chain dehydrogenase/reductase SDR encoding genes (OP10G_1224 and OP10G_1225) showed 86% identity with Mesorhizobium loti MAFF303099 genome, indicating a possible close inhabiting environment. Strain Gsoil 348 T contained one prophage (45.5 Kb, Table S10 in File S1...”

NP_663399 cis-retinol/3alpha hydroxysterol short-chain dehydrogenase-like precursor from Mus musculus
34% identity, 57% coverage

• A novel 3-hydroxysteroid dehydrogenase that regulates reproductive development and longevity
  Wollam, PLoS biology 2012
  • “...NP_598767; Mm RD16: NP_033066; Mm RD9: NP_694773; Mm RD9: NP_694773; Mm RD2: NP_671755; Mm R3aHSD: NP_663399; Mm SDR9: NP_780721; Hs SDR9C7: NP_683695; Hs HSD17B6: NP_003716; Hs RD16: NP_003699; Hs SDR9: NP_005762; Hs 11cRD: NP_002896. (B) Multiple Sequence Alignment of the DHS-16 protein with putative orthologs in...”

6b9uA / Q2YJS1 Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis complexed with nadh
29% identity, 89% coverage

• Ligand: 1,4-dihydronicotinamide adenine dinucleotide (6b9uA)

HSDA_ARAHY / A7LB60 11-beta-hydroxysteroid dehydrogenase A; 17-beta-hydroxysteroid dehydrogenase A; Steroleosin-A; EC 1.1.1.146; EC 1.1.1.- from Arachis hypogaea (Peanut) (see paper)
30% identity, 57% coverage

• function: Has dehydrogenase activity against 11 beta-hydroxysteroid and 17 beta-hydroxysteroid. May be involved in signal transduction regulated by various sterols.
  catalytic activity: an 11beta-hydroxysteroid + NADP(+) = an 11-oxosteroid + NADPH + H(+) (RHEA:11388)
• Antioxidant Properties of Protein-Rich Plant Foods in Gastrointestinal Digestion-Peanuts as Our Antioxidant Friend or Foe in Allergies
  Prodić, Antioxidants (Basel, Switzerland) 2023
  • “...type 1 family C9W981 Phosphoenolpyruvate carboxylase 116.4 0 0 / 19. Short chain dehydrogenase Oxidoreductase A7LB60 Steroleosin-A 38.8 20. Glutathione peroxidase family B4UW79 Glutathione peroxidase 24.4 21. Redoxin Q06H32 Glutaredoxin-dependent peroxiredoxin 17.5 22. Glyceraldehyde 3-phosphate dehydrogenase C A0A0A6ZDP1 Glyceraldehyde-3-phosphate dehydrogenase C2 20.1 0 0 4.8 A0A0A6ZDT0...”
• Development of a novel strategy to isolate lipophilic allergens (oleosins) from peanuts
  Schwager, PloS one 2015
  • “...S1 Fig ) and verified the presence of two peanut steroleosins (Uniprot accession no. A7LB59, A7LB60) ( S2 Fig ). Immunological recognition of peanut oleosins For the assessment of the allergenic properties of the oleosin prototypes, roasted peanuts were chosen, following the developed isolation strategy, because...”

PMI2168 probable short-chain dehydrogenase from Proteus mirabilis HI4320
28% identity, 87% coverage

• Transcriptional analysis of the MrpJ network: modulation of diverse virulence-associated genes and direct regulation of mrp fimbrial and flhDC flagellar operons in Proteus mirabilis
  Bode, Infection and immunity 2015
  • “...PMI2956 PMI0244 PMI3698 PMI2761 PMI1023 PMI0825 PMI1313 PMI3141 PMI2360 PMI2168 PMI1405 hydN argI trkH purD hipA dapD fsaA moeA exbD chbB; celA eda ndpA pyrF...”

EASD_ARTOC / C5FTN0 Chanoclavine-I dehydrogenase easD; ChaDH; Ergot alkaloid synthesis protein D; EC 1.1.1.332 from Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) (Microsporum canis) (see paper)
29% identity, 91% coverage

• function: Chanoclavine-I dehydrogenase; part of the gene cluster that mediates the biosynthesis of fungal ergot alkaloid (PubMed:22403186). DmaW catalyzes the first step of ergot alkaloid biosynthesis by condensing dimethylallyl diphosphate (DMAP) and tryptophan to form 4- dimethylallyl-L-tryptophan (PubMed:22403186). The second step is catalyzed by the methyltransferase easF that methylates 4- dimethylallyl-L-tryptophan in the presence of S-adenosyl-L-methionine, resulting in the formation of 4-dimethylallyl-L-abrine (PubMed:22403186). The catalase easC and the FAD-dependent oxidoreductase easE then transform 4-dimethylallyl-L-abrine to chanoclavine-I which is further oxidized by easD in the presence of NAD(+), resulting in the formation of chanoclavine-I aldehyde (PubMed:22403186). Chanoclavine-I aldehyde is the precursor of ergoamides and ergopeptines in Clavicipitaceae, and clavine-type alcaloids such as fumiclavine in Trichocomaceae (PubMed:22403186). However, the metabolites downstream of chanoclavine-I aldehyde in Arthrodermataceae have not been identified yet (PubMed:22403186).
  catalytic activity: chanoclavine-I + NAD(+) = chanoclavine-I aldehyde + NADH + H(+) (RHEA:33891)
  subunit: Homotetramer.

BRADO6616 putative oxidoreductase; putative Glucose/ribitol oxidoreductase from Bradyrhizobium sp. ORS278
28% identity, 91% coverage

• Identification and Validation of Reference Genes for Expression Analysis in Nitrogen-Fixing Bacteria under Environmental Stress
  Parks, Life (Basel, Switzerland) 2022
  • “...For ORS278, three genes BRADO6535, encoding a hypothetical protein, BRADO0162, encoding a phospholipid N-methyltransferase, and BRADO6616, encoding a putative oxidoreductase, were constitutively expressed during the day and night cycle ( Table 2 ). The target window of gene expression is a range of 0.8 < x...”
  • “...( blr3561 ) hypothetical protein 0.8 0.3 BRADO0162 ( bll8166 ) phospholipid N-methyltransferase 1.0 0.1 BRADO6616 ( blr6358 ) putative oxioreducatase; putative glucose/ribitol oxioreductase 1.1 0.0 BRADO3450 (blr6296) hypothetical protein 1.6 0.1 a Gene names in parenthesis represent B. diazoefficiens USDA110 gene locus. Bold letters indicate...”

CV_1482 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from Chromobacterium violaceum ATCC 12472
38% identity, 70% coverage

• Ferric Uptake Regulator Fur Coordinates Siderophore Production and Defense against Iron Toxicity and Oxidative Stress and Contributes to Virulence in Chromobacterium violaceum
  Santos, Applied and environmental microbiology 2020 (secret)

DHG_PRIMG / P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see paper)
P40288 glucose 1-dehydrogenase [NAD(P)+] (EC 1.1.1.47) from Priestia megaterium (see 9 papers)
26% identity, 86% coverage

• catalytic activity: D-glucose + NAD(+) = D-glucono-1,5-lactone + NADH + H(+) (RHEA:14293)
  catalytic activity: D-glucose + NADP(+) = D-glucono-1,5-lactone + NADPH + H(+) (RHEA:14405)
  subunit: Homotetramer.

CC2337 oxidoreductase, short-chain dehydrogenase/reductase family from Caulobacter crescentus CB15
34% identity, 68% coverage

• ExbBD-dependent transport of maltodextrins through the novel MalA protein across the outer membrane of Caulobacter crescentus
  Neugebauer, Journal of bacteriology 2005
  • “...Kmr Tetr Spcr Strr pNPTS138Tet, exbB exbD, cc2334Gmr cc2337 Kmr Tetr pNPTS138Tet, tolR tolQ, cc3231Gmr cc3234 Kmr Tetr pNPTS138Tet, tolR tolQ, cc3231cc3234, Kmr...”

BTH_I1719 3-oxoacyl-(acyl-carrier-protein) reductase from Burkholderia thailandensis E264
29% identity, 92% coverage

• Combining functional and structural genomics to sample the essential Burkholderia structome
  Baugh, PloS one 2013
  • “...3EZO B. pseudomallei BTH_I1718 Q8IVS2 32.6, 91.3 Yes BURPS1710b_2905 3-ketoacyl-ACP reductase (fabG) 3FTP B. pseudomallei BTH_I1719 Q92506 43.2, 99.6 Yes BURPS1710b_A1014 Acetoacetyl-CoA reductase 3GK3 B. pseudomallei 37.2, 97.6 Yes Bcep1808_4002 3-oxoacyl-ACP synthase II 4DDO, 4F32 B.vietnamiensis BTH_I1721 Q9NWU1 45.6, 96.1 Yes Bphy_0703 Beta-ketoacyl synthase 4EWG B....”

LINX_SPHIU / D4Z260 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX; 2,5-DDOL dehydrogenase; EC 1.1.1.- from Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S) (Sphingobium japonicum) (see paper)
33% identity, 70% coverage

• function: Catalyzes the degradation of 2,5-dichloro-2,5-cyclohexadiene- 1,4-diol (2,5-DDOL) into 2,5-dichlorohydroquinone (2,5-DCHQ) in vitro. LinX appears not to be involved in gamma-hexachlorocyclohexane (gamma- HCH) degradation pathway, in contrast to LinC which has the same enzymatic activity.
  catalytic activity: 2,5-dichlorocyclohexa-2,5-dien-1,4-diol + NAD(+) = 2,5- dichlorohydroquinone + NADH + H(+) (RHEA:15741)

AT2G17845 short-chain dehydrogenase/reductase (SDR) family protein from Arabidopsis thaliana
31% identity, 60% coverage

• Bioinformatic analysis of short-chain dehydrogenase/reductase proteins in plant peroxisomes
  Zhang, Frontiers in plant science 2023
  • “...PTS1-like sequences, among them 6 are known peroxisomal proteins. Proteins encoded by AT3G59710, At3g46170, At1g62610, At2g17845, and AT1G63380 had not been experimentally determined to be peroxisomal ( Figure1A ). We named these 5 new SDR proteins SDRf (AT3G46170), SDRg (AT1G62610), SDRh (AT1G63380), SDRi (AT2G17845) and SDRj...”
• Genetic and Biochemical Investigation of Seed Fatty Acid Accumulation in Arabidopsis
  Nwafor, Frontiers in plant science 2022
  • “...involved in TAG biosynthetic (LPP2, LPAT2, ATPAP1, PAP1, GDSL-motif esterase, FTM1, and PLIP1) and elongation (AT2G17845 and AT2G37540 coding for NAD(P)-binding Rossmann-fold superfamily protein, and KCR2) were significantly induced in the non-photosynthetic seeds ( Figure 6E ; Supplementary Table S5 ). A similar trend was observed...”
• In silico analysis of high affinity potassium transporter (HKT) isoforms in different plants
  Zamani, Aquatic biosystems 2014
  • “...AtMYB57 DNA binding-jasmonic & giberellic acid response At5g05280 Zinc finger (C3HC4-type RING finger) family protein At2g17845 Short-chain dehydrogenase/reductase (SDR) family protein At3g23460 Cyclopropane fatty acid synthase-related At3g44250 Electron carrier/ heme binding / monooxygenase/ At1g13070 Putative cytochrome P450 The designed co-expressed network in this study, based on...”
• High throughput generation of promoter reporter (GFP) transgenic lines of low expressing genes in Arabidopsis and analysis of their expression patterns
  Xiao, Plant methods 2010
  • “...GFP expression were detected in floral organs, such as petal expression from promoter-report construct of AT2G17845 (Figure 3G ) and carpel expression from that of AT2G40250 (Figure 3H ). A listing of all genes assigned to each PO code is provided in additional file 3 :...”
  • “...expression from promoter-report construct of gene AT4G13985; G. petal expression from promoter-report construct of gene AT2G17845; H. carpel expression from promoter-report construct of gene AT2G40250; I. pollen expression from promoter-report construct of gene AT2G24370; J. expression from promoter-report construct of gene AT4G18395 in the region of...”
• Assessing the influence of adjacent gene orientation on the evolution of gene upstream regions in Arabidopsis thaliana
  He, Genetics 2010
  • “...AT1G19680 AT5G66410 AT3G46550 AT3G09480 AT1G73980 AT2G42670 AT2G17845 AT3G24495 AT2G28190 AT5G64930 AT1G77480 AT5G47120 AT5G50375 770 AT4G35770 570 AT4G02570...”

LOC103706421 11-beta-hydroxysteroid dehydrogenase A-like from Phoenix dactylifera
33% identity, 54% coverage

• Biochemical, Transcriptional, and Bioinformatic Analysis of Lipid Droplets from Seeds of Date Palm (Phoenix dactylifera L.) and Their Use as Potent Sequestration Agents against the Toxic Pollutant, 2,3,7,8-Tetrachlorinated Dibenzo-p-Dioxin
  Hanano, Frontiers in plant science 2016
  • “...5.92 STEROLEO_Like2_DATE XP_008798974 LOC103713735 349 38.48 6.72 STEROLEO_Like3_DATE XP_008806995 LOC103719497 336 37.84 6.20 STEROLEO_Like4_DATE XP_008788738 LOC103706421 195 21.34 7.22 STEROLEO_Like5_DATE XP_008798975 LOC103713735 256 28.38 7.56 Statistical Analysis All data are expressed as mean standard deviation (SD). Statistical analysis was performed using STATISTICA software, version10 (StatSoft, Inc.)....”

VC1591 oxidoreductase, short-chain dehydrogenase/reductase family from Vibrio cholerae O1 biovar eltor str. N16961
30% identity, 88% coverage

• Alterations in glucose metabolism in Vibrio cholerae serogroup O1 El Tor biotype strains
  Lee, Scientific reports 2020
  • “...of 3 genesVC1589 ( alsD , acetolactate decarboxylase), VC1590 ( alsS , acetolactate synthase), and VC1591 ( alsO , oxidoreductase)that regulte the neutral fermentation that produces 2,3-butanediol in El Tor biotype strains. The classical biotype strains are unable to generate neutral fermentation products, perhaps due to...”
• (p)ppGpp, a Small Nucleotide Regulator, Directs the Metabolic Fate of Glucose in Vibrio cholerae
  Oh, The Journal of biological chemistry 2015
  • “...VC0018 VC0150 VC0854 VC0855 VC0856 VC1588 VC1589 VC1590 VC1591 VC2464 VC2465 VC2466 VC2467 VC2662 VC2664 VC2665 VCA0819 VCA0820 VCA0821 Fold change vs....”
  • “...complementary experiments. A striking increase in VC1590 and VC1591 transcripts was identified by RNA-seq analysis, and this finding was later confirmed by...”
• Mechanism of Vibrio cholerae autoinducer-1 biosynthesis
  Wei, ACS chemical biology 2011
  • “...following provision of DK-CAI-1, NADPH, and one of the recombinant proteins: VCA0301 (), VCA0691 (), VC1591 (), VC2021 (), and VC1059 (). NADPH decreases were monitored. At each time point, relative absorbance at 340 nm was calculated by subtracting the initial absorbance at time zero. The...”
  • “...were performed following standard procedures.( 37 ) V. cholerae genes vc1059, vca0301, vca0691, vca1057, vca1108, vc1591, vc0979, and vc2021 were amplified, cloned into pET28b (Novagen) using NdeI/XbaI and Bam HI sites, and sequenced. Plasmids were transformed into E. coli BL21 (DE3). A complete strain list can...”
• Brucella microti: the genome sequence of an emerging pathogen
  Audic, BMC genomics 2009
  • “...BMI_II939). The conversion of acetoin to 2,3-butanediol is performed by the homolog of als O (VC1591) in Vibrio cholera which is BMI_I1134. A gene apparently missing from this pathway is the homolog of als D (VC1589) in V. cholera , the alpha-acetolactate decarboxylase. However, as reported...”
• 2,3-butanediol synthesis and the emergence of the Vibrio cholerae El Tor biotype
  Yoon, Infection and immunity 2006
  • “...Smr Smr Smr N16961, als::TnKGL3 N16961, ald N16961, VC1591 O395, pgi::TnKGL3 supE44 lacU169 (80dlacZM15) hsdR17 recA1 endA1 gyrA96 thi-1 relA1 Kmr thi-1 thr leu...”
  • “...In-frame deletion mutants of ald (VC1589) and VC1591 were constructed following a gene replacement procedure involving sucrose counterselection (46). Phenol red...”

CBG09704 Protein CBG09704 from Caenorhabditis briggsae
29% identity, 80% coverage

• Comparative Transcriptome Analysis of the Pinewood Nematode Bursaphelenchus xylophilus Reveals the Molecular Mechanism Underlying Its Defense Response to Host-Derived α-pinene
  Li, International journal of molecular sciences 2019
  • “...in the AG sample, suggesting its participation in detoxification processes. In addition, the genes encoding CBG09704 [ 42 ] and T08H10.1 [ 43 ] were also upregulated in the AG samples. Given our results, certain PWN genes were upregulated and genes for certain channels were downregulated...”

A6N8S2 glucose 1-dehydrogenase [NAD(P)+] (EC 1.1.1.47) from Bacillus subtilis (see paper)
26% identity, 85% coverage

C1O30_RS04475 SDR family oxidoreductase from Dickeya zeae
27% identity, 90% coverage

• Genomic and Functional Dissections of Dickeya zeae Shed Light on the Role of Type III Secretion System and Cell Wall-Degrading Enzymes to Host Range and Virulence
  Hu, Microbiology spectrum 2022
  • “...that deletion of C1O30_RS01370-01390 , C1O30_RS02130 , C1O30_RS02370 , C1O30_RS02510 , C1O30_RS03460 , C1O30_RS04230 , C1O30_RS04475 , C1O30_RS05105 , C1O30_RS06880 , C1O30_RS07840 , C1O30_RS08725 , C1O30_RS12525 , and C1O30_RS14540 significantly reduced the virulence of MS2 on potato slices ( Fig.10 ). Among them, C1O30_RS01370-1390 , C1O30_RS02510...”

MSMEG_0737 dehydrogenase from Mycobacterium smegmatis str. MC2 155
36% identity, 75% coverage

• Intrabacterial lipid inclusion-associated proteins: a core machinery conserved from saprophyte Actinobacteria to the human pathogen Mycobacterium tuberculosis
  Dargham, FEBS open bio 2023
  • “...RjosMsmeg Rv2484c Triacylglycerol synthase Nonessential MSMEG_4705 MAB_4544c MMAR_3835 MUL_3765 ML1244 RjosMsmeg Rv1544 Ketoacyl reductase Nonessential MSMEG_0737 MAB_1537c MMAR_2367 MUL_1543 ML0429c RjosMsmeg Rv0437c psd Phosphatidylserine decarboxylase Nonessential MSMEG_0861 MAB_0639c MMAR_0754 MUL_1386 ML0311c RjosMsmeg Rv3229c desA3 LinoleoylCoA desaturase Nonessential MSMEG_1743 MAB_2148 MMAR_1315 MUL_2565 RjosMsmeg Rv0154c fadE2 AcylCoA dehydrogenase...”

PSPTO_4065 oxidoreductase, short-chain dehydrogenase/reductase family from Pseudomonas syringae pv. tomato str. DC3000
32% identity, 71% coverage

• The ECF sigma factor, PSPTO_1043, in Pseudomonas syringae pv. tomato DC3000 is induced by oxidative stress and regulates genes involved in oxidative stress response
  Butcher, PloS one 2017
  • “...chrR PSPTO_1042 35% transcriptional activator ChrR RSP_1087 PSPTO_1119 35% short chain dehydrogenase/reduc-tase family oxidoreductase " PSPTO_4065 35% short-chain dehydrogenase/reduc-tase family oxidoreductase " PSPTO_1861 31% short chain dehydrogenase RSP_1088 PSPTO_2515 32% lipoprotein RSP_1090 PSPTO_1117 35% hypothetical protein RSP_1091 PSPTO_1118 39% amine oxidase, flavin-containing protein RSP_2143 phrB PSPTO_1121...”

NP_001086077 estradiol 17-beta-dehydrogenase 12-B-like L homeolog from Xenopus laevis
29% identity, 57% coverage

• Functional characterization of two 20β-hydroxysteroid dehydrogenase type 2 homeologs from Xenopus laevis reveals multispecificity.
  Tokarz, The Journal of steroid biochemistry and molecular biology 2021 (PubMed)
  • GeneRIF: Functional characterization of two 20beta-hydroxysteroid dehydrogenase type 2 homeologs from Xenopus laevis reveals multispecificity.

XCC1018 3-oxoacyl-[ACP] reductase from Xanthomonas campestris pv. campestris str. ATCC 33913
28% identity, 92% coverage

• A novel 3-oxoacyl-ACP reductase (FabG3) is involved in the xanthomonadin biosynthesis of Xanthomonas campestris pv. campestris
  Yu, Molecular plant pathology 2019
  • “...Yu et al. , 2016 ; Zhou et al. , 2015 ). Four genes, fabG1 (XCC1018), fabG2 (XCC0416), fabG3 (XCC4003) and fabG4 (XCC0384), encode putative OARs in the Xcc genome (Qian et al. , 2005 ). FabG1 plays the major role in catalysing the reduction of...”
• Novel Xanthomonas campestris Long-Chain-Specific 3-Oxoacyl-Acyl Carrier Protein Reductase Involved in Diffusible Signal Factor Synthesis
  Hu, mBio 2018
  • “...( 6 ). The X. campestris pv. campestris genome carries four putative OAR genes: fabG1 (XCC1018), fabG2 (XCC0416), fabG3 (XCC4003), and fabG4 (XCC0384) ( Fig.1C ). XCC1018 ( fabG1 ) is located within a cluster of fatty acid synthesis genes, and 69.1% of the residues of...”
• The Multiple DSF-family QS Signals are Synthesized from Carbohydrate and Branched-chain Amino Acids via the FAS Elongation Cycle
  Zhou, Scientific reports 2015
  • “...the genes required for the FAS elongation cycle, including Xcc0582 (FabA), Xcc0581 (FabB), Xcc1020 (FabF), Xcc1018 (FabG), Xcc0115 (FabV) and Xcc1362 (FabZ) ( Fig. 6a ). This led us to further investigate whether DSF-family signals are synthesized via the FAS elongation cycle in Xcc. Since the...”
  • “...cycle ( Fig. 6a ) 22 , we first attempted to delete the FabG-encoding gene Xcc1018 . However, these experiments were not successful probably due to the fact that Xcc1018 is an essential gene. As an alternative approach, we overexpressed Xcc1018 in the rpfC strain, and...”

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.