PaperBLAST
PaperBLAST Hits for sp|Q9HUM6|PURA_PSEAE Adenylosuccinate synthetase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=purA PE=3 SV=1 (430 a.a., MGKNVVVLGT...)
Show query sequence
>sp|Q9HUM6|PURA_PSEAE Adenylosuccinate synthetase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=purA PE=3 SV=1
MGKNVVVLGTQWGDEGKGKIVDLLTEQAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGI
LREGVQCLIGNGVVLAPDALLREITKLEEKGVPVRERLRISPSCPLILSYHVALDQAREK
ARGEAKIGTTGRGIGPAYEDKVARRGLRVGDLFHRERFAAKLGELLDYHNFVLQHYYKEP
AIDFQKTLDEAMEYAELLKPMMADVAATLHDLRKHGKDIMFEGAQGSLLDIDHGTYPYVT
SSNTTAGGTATGSGFGPLYLDYVLGITKAYTTRVGSGPFPTELFDDVGAYLAKRGHEFGA
TTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLDVVRLCVGYKNADGDVLEAPT
DADSYIGLQPVYEEMPGWSESTVGAKTLEELPANARAYIKRVEELVGAPIDIISTGPDRN
ETIILRHPFA
Running BLASTp...
Found 159 similar proteins in the literature:
PA4938 adenylosuccinate synthetase from Pseudomonas aeruginosa PAO1
100% identity, 100% coverage
- A systems-level approach for investigating Pseudomonas aeruginosa biofilm formation
Xu, PloS one 2013 - “...glmM ),PA4750( folP ), PA4759( dapB ),PA4847( accB ),PA4848( accC ),PA4854( purH ), PA4920( nadE ),PA4938( purA ),PA4988( waaA ),PA4996( rfaE ), PA5009( waaP ),PA5010( waaG ),PA5011( waaC ),PA5012( waaF )PA5034( hemE ),PA5162( rmlD ),PA5163( rmlA ),PA5175( cysQ ), PA5243( hemB ),PA5259( hemD ),PA5260( hemC ),PA5278(...”
- Bis-(3'-5')-cyclic dimeric GMP regulates antimicrobial peptide resistance in Pseudomonas aeruginosa
Chua, Antimicrobial agents and chemotherapy 2013 - “...PA4138 PA4236 PA0139 PA5322 PA2944 PA3186 PA0036 PA4560 PA4938 PA0077 PA4266 PA4829 PA3328 PA3666 PA2391 PA0956 PA5131 PA3213 PA1833 PA0548 PA5497 PA1342 PA0067...”
- The novel Pseudomonas aeruginosa two-component regulator BfmR controls bacteriophage-mediated lysis and DNA release during biofilm development through PhdA
Petrova, Molecular microbiology 2011 - “...- - - 2-oxoglutarate dehydrogenase (E1 subunit) PA5210 - - - probable secretion pathway ATPase PA4938 purA - - - adenylosuccinate synthetase PA0266 gabT - - - 4-aminobutyrate aminotransferase Protein detected on a silver stained 2D-PAGE gel; - Protein not detected on a silver stained 2D-PAGE...”
PSPTO4937 adenylosuccinate synthetase from Pseudomonas syringae pv. tomato str. DC3000
90% identity, 100% coverage
PP4889 adenylosuccinate synthetase from Pseudomonas putida KT2440
88% identity, 100% coverage
plu4577 adenylosuccinate synthetase (IMP--aspartate ligase) (ADSS) (AMPSASE) from Photorhabdus luminescens subsp. laumondii TTO1
72% identity, 99% coverage
FQP81_10690 adenylosuccinate synthase from Pseudoalteromonas distincta
72% identity, 98% coverage
y0635 adenylosuccinate synthetase from Yersinia pestis KIM
71% identity, 98% coverage
AdeK / b4177 adenylosuccinate synthetase (EC 6.3.4.4) from Escherichia coli K-12 substr. MG1655 (see 6 papers)
purA / P0A7D4 adenylosuccinate synthetase (EC 6.3.4.4) from Escherichia coli (strain K12) (see 24 papers)
PURA_ECOLI / P0A7D4 Adenylosuccinate synthetase; AMPSase; AdSS; IMP--aspartate ligase; EC 6.3.4.4 from Escherichia coli (strain K12) (see 3 papers)
purA / PDB|1NHT adenylosuccinate synthetase; EC 6.3.4.4 from Escherichia coli (see 13 papers)
b4177 adenylosuccinate synthetase from Escherichia coli str. K-12 substr. MG1655
NP_418598 adenylosuccinate synthetase from Escherichia coli str. K-12 substr. MG1655
UTI89_C4777 PurA, subunit of adenylosuccinate synthase from Escherichia coli UTI89
ECs5153 adenylosuccinate synthetase from Escherichia coli O157:H7 str. Sakai
70% identity, 99% coverage
- function: Plays an important role in the de novo pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) Note=Binds 1 Mg(2+) ion per subunit
subunit: Homodimer. - Structural systems pharmacology: A framework for integrating metabolic network and structure-based virtual screening for drug discovery against bacteria
Nazarshodeh, PloS one 2021 - “...transporter complex GO:0005886 Plasma membrane GO:1990351 Transporter complex b3843 P0AAB4 3-octaprenyl-4-hydroxybenzoate decarboxylase GO:0005886 Plasma membrane b4177 P0A7D4 adenylosuccinate synthetase GO:0016020 Membrane b0182 P10441 lipid A disaccharide synthase GO:0019897 Extrinsic component of plasma membrane b3619 P67910 ADP-L-glycero-D-mannoheptose 6-epimerase GO:0016020 Membrane b0586 P11454 apo-serine activating enzyme GO:0005886 Plasma...”
- 5-azacytidine induces transcriptome changes in Escherichia coli via DNA methylation-dependent and DNA methylation-independent mechanisms
Militello, BMC microbiology 2016 - “...4.87E-05 b3175 secG SecYEG inner membrane translocon secA-interacting subunit; preprotein translocase secAYEG subunit 2.43 3.43E-04 b4177 purA Adenylosuccinate synthase, purine synthesis 2.37 6.70E-04 b4314 fimA Fimbrin type 1, major structural subunit; phase variation 2.11 1.33E-03 b3231 rplM 50S ribosomal subunit protein L13; binds Zn(II) 2.00 1.12E-03...”
- Gap-filling analysis of the iJO1366 Escherichia coli metabolic network reconstruction for discovery of metabolic functions
Orth, BMC systems biology 2012 - “...none identified argB (b3959) none identified hemE (b3997) none identified ubiC (b4039) none identified purA (b4177) none identified Computational prediction of gap-filling reactions One cause of model gaps and false negative phenotypic predictions is that some realistic reactions may be missing from the i JO1366 model....”
- Membrane stresses induced by overproduction of free fatty acids in Escherichia coli
Lennen, Applied and environmental microbiology 2011 - “...b3508 b3509 b3510 b3624 b3625 b3800 b3908 b3924 b4025 b4062 b4177 b4396 b4637 ybaO acrA nfsB fur fldA ybiS ybjC nfsA rimK ybjN poxB pqiA pqiB putA mdtG ptsG...”
- Genome-scale analysis to the impact of gene deletion on the metabolism of E. coli: constraint-based simulation approach
Xu, BMC bioinformatics 2009 - “...b4160 b2323 b2499, b2507 s0001 b3958 b3255 b2557, b2780 b3959 b3256 b3642, b4005 b3960 b4006, b4177 s0001 b4244, b4245 SS NSP CAC GSM TTPM TIM genes b0639 b0720 b0907 b0908, b1260 b0914 b1098 b1136 b1261, b1262 s0001 b2827 b1263, b1264 b3648 b1693, b2329 s0001 b2599, b2600...”
- Experimental and computational assessment of conditionally essential genes in Escherichia coli
Joyce, Journal of bacteriology 2006 - “...Gene (Blattner no.) guaA (b2507) guaB (b2508) purA (b4177) purC (b2476) purD (b4005) purE (b0523) purF (b2312) purH (b4006) purK (b0522) purL (b2557) purM...”
- Combined, functional genomic-biochemical approach to intermediary metabolism: interaction of acivicin, a glutamine amidotransferase inhibitor, with Escherichia coli K-12
Smulski, Journal of bacteriology 2001 - “...b1896 b1897 b0134 b3403 b4107 b4101 b0242 b2297 b1101 b4177 b4051 b2616 b1662 b0611 b4396 b3461 b1814 b3506 b1642 b3349 b3129 b4062 b2521 b4148 b3616 b3706...”
- Selection markers for transformation of the sequenced reference monokaryon Okayama 7/#130 and homokaryon AmutBmut of Coprinopsis cinerea
Dörnte, Fungal biology and biotechnology 2020 - “...Ade17, NP_013839 CC1G_08365T0 Chr_7:2,467,1632,464,958 FAICAR to IMP IMP cyclohydrolase IMP to SAMP Adenylosuccinate synthase PurA, NP_418598 Ade12, NP_014179 CC1G_10072T0 Chr_2:407,487405,875 SAMP to AMP Adenylosuccinate lyase BifunctionalPurB, THI73349 Bifunctional Ade13, NP_013463 CC1G_08733T0, bifunctional Ade5 Chr_10:936,450934,462 GTP to DHNTP GTP cyclohydrolase FolE, NP_416658 Fol2, P51601 CC1G_14672T0 Chr_5:2,160,8322,161,846 DHNTP...”
- Cavitation as a mechanism of substrate discrimination by adenylosuccinate synthetases.
Iancu, Biochemistry 2006 - GeneRIF: The absence of the 2'-hydroxyl group of the deoxyribonucleotide destabilizes binding of the ligand to the L-aspartate pocket of adenylosuccinate synthetase by disrupting hydrogen bonds and by introducing a cavity into the fully ligated active site.
- Nucleotide sequence and analysis of the purA gene encoding adenylosuccinate synthetase of Escherichia coli K12.
Wolfe, The Journal of biological chemistry 1988 (PubMed)- GeneRIF: N-terminus verified by Edman degradation on mature peptide
- Biodistribution of 89Zr-DFO-labeled avian pathogenic Escherichia coli outer membrane vesicles by PET imaging in chickens
Li, Poultry science 2023 - “...trafficking, secretion, and vesicular transport Cytoplasm 164 P12758 UDP Nucleotide transport and metabolism Cytoplasm 165 P0A7D4 PURA Nucleotide transport and metabolism Cytoplasm 166 P0A6M8 EFG Translation, ribosomal structure and biogenesis Cytoplasm 167 P0ABT2 DPS Inorganic ion transport and metabolism Cytoplasm 168 P17169 GLMS Cell wall/membrane/envelope biogenesis...”
- Structural systems pharmacology: A framework for integrating metabolic network and structure-based virtual screening for drug discovery against bacteria
Nazarshodeh, PloS one 2021 - “...complex GO:0005886 Plasma membrane GO:1990351 Transporter complex b3843 P0AAB4 3-octaprenyl-4-hydroxybenzoate decarboxylase GO:0005886 Plasma membrane b4177 P0A7D4 adenylosuccinate synthetase GO:0016020 Membrane b0182 P10441 lipid A disaccharide synthase GO:0019897 Extrinsic component of plasma membrane b3619 P67910 ADP-L-glycero-D-mannoheptose 6-epimerase GO:0016020 Membrane b0586 P11454 apo-serine activating enzyme GO:0005886 Plasma membrane...”
- Affinity-based capture and identification of protein effectors of the growth regulator ppGpp
Wang, Nature chemical biology 2019 - “...SpoT bifunctional ppGpp synthase/hydrolase 2.87 P46853 YhhX uncharacterized oxidoreductase 2.78 P00350 Gnd 6-phosphogluconate dehydrogenase 2.76 P0A7D4 PurA adenylosuccinate synthetase 2.75 P17117 NfsA oxygen-insensitive NADPH nitroreductase 2.64 P0AEW6 Gsk inosine-guanosine kinase 2.59 P0ABS1 DksA RNA polymerase-binding transcription factor 2.44 P37773 Mpl UDP-MurNAc--L-Ala--D-Glu-meso-DAP ligase 2.43 P0A7F3 Pyrl aspartate...”
- Comprehensively Characterizing the Thioredoxin Interactome In Vivo Highlights the Central Role Played by This Ubiquitous Oxidoreductase in Redox Control
Arts, Molecular & cellular proteomics : MCP 2016 - “...P0A6Q3 P0A953 P0AAI9 P0A6R0 P0A6Q6 P0ABF6 P76440 P0A717 P0A7D4 P07650 P0AEZ9 P0ACD4 Description P0AE08 P0AE52 P13029 P0A746 P76270 P0AGD3 P0A862 P0A9P4 P37440...”
- The Escherichia coli proteome: past, present, and future prospects
Han, Microbiology and molecular biology reviews : MMBR 2006 - “...4.78/59,810 4.91/63,671 (DIGE 4.5-6.5) PurA P0A7D4 Adenylosuccinate synthetase 5.32/47,213.76 5.30/44,524 (DIGE 4.5-6.5) 5.30/43,494 (DIGE 4.5-6.5) PurB...”
- Genome-wide analysis of fitness-factors in uropathogenic Escherichia coli during growth in laboratory media and during urinary tract infections
García, Microbial genomics 2021 - “...Purine metabolism (F) 2.87 UTI89_C4174 rfaG 2 Lipopolysaccharide core biosynthesis glucosyltransferase LPS biosynthesis (M) 2.84 UTI89_C4777 purA 1 Adenylosuccinate synthetase Purine metabolism (F) 2.79 UTI89_C4293 atpB ATP synthase subunit a ATP synthesis (C) 2.78 UTI89_C4285 atpD ATP synthase subunit beta ATP synthesis (F) 2.73 UTI89_C0657 ybeY...”
- Global transcriptional response of Escherichia coli O157:H7 to growth transitions in glucose minimal medium
Bergholz, BMC microbiology 2007 - “...acs 5.55 2 ECs4164 rpmJ -2.03 1 ECs5067 O157 2.21 2 ECs4165 prlA -2.53 1 ECs5153 purA -2.06 1 ECs5164 yjfN 4.54 2 ECs5240 yjgR 2.24 2 ECs5192 cysQ 2.01 2 ECs5259 O157 -2.09 1 ECs5231 argI -3.29 1 ECs5354 rob 2.15 2 ECs5235 valS -2.58...”
PMI3370 adenylosuccinate synthetase from Proteus mirabilis HI4320
69% identity, 99% coverage
- Identification of emergent bla CMY-2 -carrying Proteus mirabilis lineages by whole-genome sequencing
Mac, New microbes and new infections 2016 - “..., gyrB ; PMI1296 , icd ; PMI2184 , mdh ; PMI1732 , purA ; PMI3370 and recA ; PMI3400 ). Sequences from 24 P.mirabilis isolates from this study and eight representative P.mirabilis whole-genome data sets; C05028 (ANBT00000000), WGLW4 (AMGU00000000), HI4320 (AM942759), ATCC29906 (ACLE01000000), ATCC7002 (JOVJ00000000),...”
t4417 adenylosuccinate synthetase from Salmonella enterica subsp. enterica serovar Typhi Ty2
SL1344_4299, STM14_5248 adenylosuccinate synthase from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
70% identity, 99% coverage
1cg0A / P0A7D4 Structure of adenylosuccinate synthetase from e. Coli complexed with hadacidin, gdp, 6-phosphoryl-imp, and mg2+ (see paper)
70% identity, 99% coverage
- Ligands: magnesium ion; hadacidin; 6-o-phosphoryl inosine monophosphate; guanosine-5'-diphosphate (1cg0A)
SPC_4513 adenylosuccinate synthetase from Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
70% identity, 99% coverage
- Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
Liu, Plants (Basel, Switzerland) 2023 - “...diphosphate kinase ( SPC_1128 ), a guanylate kinase ( SPC_3822 ), an adenylosuccinate synthetase ( SPC_4513 ), an anaerobic ribonucleoside triphosphate reductase ( SPC_4584 ), a nucleotidase ( SPC_4695 ), and a phosphopentomutase ( SPC_4705 ). For instance, adenylosuccinate synthetase ( SPC_4513 ) is involved in...”
- “...SPC_1144 0.295 Inositol-5-monophosphate dehydrogenase SPC_0502 0.454 Adenylate kinase SPC_1952 0.483 Ribose-phosphate pyrophosphokinase SPC_4695 2.018 Nucleotidase SPC_4513 2.067 Adenylosuccinate synthetase SPC_4705 2.177 Phosphopentomutase SPC_1128 2.354 Nucleoside diphosphate kinase SPC_4049 2.702 Adenylate cyclase SPC_4007 2.997 IMP cyclohydrolase SPC_3824 3.447 (P)ppGpp synthetase II/guanosine-5-bis pyrophosphate 3-pyrophosphohydrolase SPC_3822 3.463 Guanylate kinase...”
KP1_0448 adenylosuccinate synthetase from Klebsiella pneumoniae NTUH-K2044
70% identity, 99% coverage
- The Capsule Regulatory Network of Klebsiella pneumoniae Defined by density-TraDISort
Dorman, mBio 2018 - “...cyaA Adenylate cyclase 0.99 KP1_0164 trkH Potassium transport protein 1.00 KP1_0206 purA Adenylosuccinate synthetase 1.00 KP1_0448 apaH Diadenosinetetraphosphatase 0.96 KP1_0859 ace Pyruvate dehydrogenase E1 component 0.98 KP1_0941 glnD PII uridylyl-transferase 0.94 KP1_1019 hha Hemolysin expression modulating protein 0.99 KP1_1317 tolR Putative inner membrane protein involved in...”
APL_1075 adenylosuccinate synthetase from Actinobacillus pleuropneumoniae L20
68% identity, 100% coverage
- Effects of growth conditions on biofilm formation by Actinobacillus pleuropneumoniae
Labrie, Veterinary research 2010 - “...phosphorylase DeoD-like protein 1.430 APL_0351 Ndk Nucleoside diphosphate kinase 1.531 APL_1839 Udp Uridine phosphorylase 1.617 APL_1075 purA Adenylosuccinate synthetase 1.762 Regulatory functions APL_0059 narP Nitrate/nitrite response regulator protein 2.552 APL_0823 glpR Glycerol-3-phosphate regulon repressor 1.908 APL_1295 argR Arginine repressor 1.896 APL_0126 APL_0126 HIT-like protein 1.580 APL_0395...”
VAS14_18809 adenylosuccinate synthase from Photobacterium angustum S14
69% identity, 98% coverage
- Shotgun redox proteomics: identification and quantitation of carbonylated proteins in the UVB-resistant marine bacterium, Photobacterium angustum S14
Matallana-Surget, PloS one 2013 - “...T DNGTFVINGTER EQEVYMGEI P LMTDNGTFVINGTER VAS14_19166 50S ribosomal protein L10 K 3 AVEG T DFECLQDVFVGPSLIGFSNEHPGAAAR VAS14_18809 adenylosuccinate synthetase I 1 SGEILEVS P MAADEYEDLELVYETMPGWSETTFGAK VAS14_22247 ketol-acid reductoisomerase F 5 GETAETQFENY P SSDIQISEQEYFDNGILMVAMVR VAS14_07339 transcription elongation factor NusA H 1 P RERIFEALEIALATATK VAS14_07344 hypothetical protein K 1 MTALETQLTEMLE...”
- “...K 8 EQEVYMGEI P LMTDNGTFVINGTER VAS14_18764 50S ribosomal protein L9 J 1 AGDEGKLFGSIG T RDIADAVTAAGVALVK VAS14_18809 adenylosuccinate synthetase F 1 SGEILEVS P MAADEYEDLELVYETMPGWSETTFGAK VAS14_22247 ketol-acid reductoisomerase H 6 GETAETQFENY P SSDIQISEQEYFDNGILMVAMVR VAS14_07124 molecular chaperone DnaK O 1 KDVN P DEAVAVGAAVQGGVLAGDVK VAS14_19286 50S ribosomal protein L6 J...”
HI1633 adenylosuccinate synthetase (purA) from Haemophilus influenzae Rd KW20
67% identity, 100% coverage
- Genome-scale approaches to identify genes essential for Haemophilus influenzae pathogenesis
Wong, Frontiers in cellular and infection microbiology 2012 - “...recR Recombination protein a UREA METABOLISM HI0535 ureH Urease accessory protein a e NUCLEOTIDE METABOLISM HI1633 purA Adenylosuccinate synthetase a HI0639 purB Adenylosuccinate lyase a HI1615 purE Phosphoribosylaminoimidazole carboxylase catalytic subunit a e HI1077 pyrG CTP synthetase a HI0518 deoD Purine nucleoside phosphorylase a HI0551 apaH...”
XAC1158 adenylosuccinate synthetase from Xanthomonas axonopodis pv. citri str. 306
64% identity, 100% coverage
- Periplasm-enriched fractions from Xanthomonas citri subsp. citri type A and X. fuscans subsp. aurantifolii type B present distinct proteomic profiles under in vitro pathogenicity induction
Zandonadi, PloS one 2020 - “...4 10 III C XAC1776 Xylose isomerase (2) 48.5 5.3 71 3 7 I C XAC1158 Adenylosuccinate synthetase (2) 46.5 5.4 64 2 7 II C XAC3236 Succinyl-CoA synthetase b subunit (3) 41.5 4.9 48 5 14 I C XAC3463 TolC protein (3) 49.6 5.6 37...”
- “...(GpsA, XAC0222), conserved hypothetical proteins (XAC0223 and XAC0901), succinyl-CoA synthetase -subunit (SucCD, XAC3236), adenylosuccinate synthetase (XAC1158), lytic murein transglycosylase (XACb0007), enolase (XAC1719), elongation factor Tu (XAC0957), phosphoglucomutase/phosphomannomutase (PGM, XAC3579), and TolC (XAC3463). Xylose isomerase (XI) was also detected for XAC (XAC1776, Table 1 ). All these...”
XF0455 adenylosuccinate synthetase from Xylella fastidiosa 9a5c
64% identity, 98% coverage
PD1627 adenylosuccinate synthetase from Xylella fastidiosa Temecula1
63% identity, 100% coverage
- The Exometabolome of Xylella fastidiosa in Contact with Paraburkholderia phytofirmans Supernatant Reveals Changes in Nicotinamide, Amino Acids, Biotin, and Plant Hormones
Feitosa-Junior, Metabolites 2024 - “...6.33 PD1273 2.00 200.00 RHEA:23777 200.00 RHEA:23777 6.33 PD1274 2.00 200.00 RHEA:20015 200.00 RHEA:20015 6.33 PD1627 2.00 200.00 RHEA:15753 200.00 RHEA:15753 6.33 Biotin PD0043 2.00 140.61 2.8.1.6-RXN 145.10 2.8.1.6-RXN 5.80 PD1071 2.00 58.42 RHEA:31118 62.94 RHEA:31118 4.66 2.00 58.42 BIOTINLIG-RXN 62.94 BIOTINLIG-RXN 4.66 PD1494 2.00 167.61...”
- The Secreted Protease PrtA Controls Cell Growth, Biofilm Formation and Pathogenicity in Xylella fastidiosa
Gouran, Scientific reports 2016 - “...34 ), htrB (PD0592), ampE (PD0825), wbpL (PD1452), isoprenoids ispG (PD1956), nucleotides pyrE (PD0122), purA (PD1627), purE (PD2036), amino acids argH (PD0295), proB (PD0296), proA (PD0297), pheA (PD0426), aroK (PD0582), asd (PD0608), aspH (PD0777), trpDE (PD0876 and PD0877), serC (PD1358), leuB (PD1397), cofactor recycling cysG (PD1840),...”
Q39FS0 Adenylosuccinate synthetase 1 from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
64% identity, 96% coverage
BCAL1873 adenylosuccinate synthetase from Burkholderia cenocepacia J2315
64% identity, 96% coverage
6c25A / Q8RNM2 Crystal structure of adenylosuccinate synthetase from legionella pneumophila philadelphia 1 in complex with gdp
64% identity, 100% coverage
- Ligands: guanosine-5'-diphosphate; magnesium ion (6c25A)
NMAA_0643 adenylosuccinate synthase from Neisseria meningitidis WUE 2594
61% identity, 100% coverage
- Metabolic shift in the emergence of hyperinvasive pandemic meningococcal lineages
Watkins, Scientific reports 2017 - “...match 11 (602), 41/44 (92) The Netherlands, 1963 ATP phosphoribosyltransferase regulatory subunit Metabolism E 757422 NMAA_0643 362 6 nucleotide differences 11 (820) USA, 1964 Adenylosuccinate synthetase Metabolism E 762625 NMAA_0651 984 Exact match 11 (838), 1 (47), 8 (20), 4 (14), 35 (7), 4821 (5) USA,...”
BTH_I2245 adenylosuccinate synthetase from Burkholderia thailandensis E264
63% identity, 96% coverage
NGO0398 putative adenylosuccinate synthetase from Neisseria gonorrhoeae FA 1090
62% identity, 99% coverage
- Manganese regulation of virulence factors and oxidative stress resistance in Neisseria gonorrhoeae
Wu, Journal of proteomics 2010 - “...NGO0298 50S ribosomal protein L20 rpIT B 13664 NGO0710 A/G-specific adenine glycosylase mutY E 39542 NGO0398 adenylosuccinate synthetase purA F 45970 NGO0353 uracil phosphoribosyltransferase upp F 22863 NGO1241 histidinol-phosphate aminotransferase hisC G 39245 NGO1358 glutamate dehydrogenase gdhA G 48462 NGO0040 glutamate 1-semialdehyde 2,1-aminotransferase hemL/ gsa H...”
NMY233_0800 adenylosuccinate synthase from Neisseria meningitidis NM233
61% identity, 100% coverage
BP2188 adenylosuccinate synthetase from Bordetella pertussis Tohama I
62% identity, 99% coverage
Q92MA5 Adenylosuccinate synthetase from Rhizobium meliloti (strain 1021)
SMc00643 PROBABLE ADENYLOSUCCINATE SYNTHETASE IMP--ASPARTATE LIGASE PROTEIN from Sinorhizobium meliloti 1021
56% identity, 99% coverage
SPO1318 adenylosuccinate synthase from Ruegeria pomeroyi DSS-3
56% identity, 99% coverage
- A mutant fitness assay identifies bacterial interactions in a model ocean hot spot
Schreier, Proceedings of the National Academy of Sciences of the United States of America 2023 - “...0.3 SPO0284 dihydroorotase, multifunctional complex Pyrimidine 2.2 SPO2654 orotate phosphoribosyltransferase ( pyrE ) Pyrimidine 4.9 SPO1318 adenylosuccinate synthetase ( purA ) Purine 3.6 5.2 SPO1870 phosphoribosylformylglycinamidine synthase II ( purL ) Purine 3.1 SPO2168 phosphoribosylglycinamide formyltransferase ( purN) Purine 1.6 SPO2677 amidophosphoribosyltransferase ( purF ) Purine...”
mll3873 adenylosuccinate synthetase from Mesorhizobium loti MAFF303099
53% identity, 99% coverage
MMSR116_11330, MMSR116_RS11180 adenylosuccinate synthase from Methylobacterium mesophilicum SR1.6/6
53% identity, 99% coverage
- Transcriptome and Secretome Analyses of Endophyte Methylobacterium mesophilicum and Pathogen Xylella fastidiosa Interacting Show Nutrient Competition
Dourado, Microorganisms 2023 - “...Pnp 80 3 39 23 MMSR116_RS29630 MMSR116_29970 Ketol-acid reductoisomerase IlvC 37 5 40 - MMSR116_RS11180 MMSR116_11330 Adenylosuccinate synthetase PurA 48 6 41 - MMSR116_RS21010 MMSR116_21290 Methylenetetrahydrofolate dehydrogenase 29 8 0.81 42 - MMSR116_RS05635 MMSR116_05745 30S ribosomal protein S1 RpsA 63 3 43 - MMSR116_RS03750 MMSR116_03790 Aconitate...”
- “...nucleotidyltransferase Pnp 80 3 39 23 MMSR116_RS29630 MMSR116_29970 Ketol-acid reductoisomerase IlvC 37 5 40 - MMSR116_RS11180 MMSR116_11330 Adenylosuccinate synthetase PurA 48 6 41 - MMSR116_RS21010 MMSR116_21290 Methylenetetrahydrofolate dehydrogenase 29 8 0.81 42 - MMSR116_RS05635 MMSR116_05745 30S ribosomal protein S1 RpsA 63 3 43 - MMSR116_RS03750 MMSR116_03790...”
BAW_11618 adenylosuccinate synthase from Brucella abortus
BAB1_1695 Adenylosuccinate synthetase from Brucella melitensis biovar Abortus 2308
53% identity, 99% coverage
- The regulon of Brucella abortus two-component system BvrR/BvrS reveals the coordination of metabolic pathways required for intracellular life
Rivas-Solano, PloS one 2022 - “...cytidylyltransferase 2 BAW_20204 BAB2_0209 waaA (kdtA) 3-deoxy-D-manno-octulosonic acid transferase Adenine and adenosine salvage 0.027998101 5 BAW_11618 BAB1_1695 purA Adenylosuccinate synthetase, catalyzes the formation of N6-(1;2;-dicarboxyethyl)-AMP from L-aspartate; inosine monophosphateandGTP in AMP biosynthesis * 1 BAW_11903 BAB1_1986 hpt Hypoxanthine phosphoribosyltransferase 1 BAW_20563 BAB2_0587 ade Adenine deaminase regulator...”
- “...signals close or within their CDS. 2308W 2308 Name Function Genes with 5 binding sites BAW_11618 BAB1_1695 purA Adenylosuccinate synthetase, important for virulence [ 17 ] BAW_20068 BAB2_0068 virB1 Type IV secretion system protein VirB1, important for virulence, important for virulence [ 60 ] BAW_11934 BAB1_2018...”
- The regulon of Brucella abortus two-component system BvrR/BvrS reveals the coordination of metabolic pathways required for intracellular life
Rivas-Solano, PloS one 2022 - “...2 BAW_20204 BAB2_0209 waaA (kdtA) 3-deoxy-D-manno-octulosonic acid transferase Adenine and adenosine salvage 0.027998101 5 BAW_11618 BAB1_1695 purA Adenylosuccinate synthetase, catalyzes the formation of N6-(1;2;-dicarboxyethyl)-AMP from L-aspartate; inosine monophosphateandGTP in AMP biosynthesis * 1 BAW_11903 BAB1_1986 hpt Hypoxanthine phosphoribosyltransferase 1 BAW_20563 BAB2_0587 ade Adenine deaminase regulator of...”
- “...close or within their CDS. 2308W 2308 Name Function Genes with 5 binding sites BAW_11618 BAB1_1695 purA Adenylosuccinate synthetase, important for virulence [ 17 ] BAW_20068 BAB2_0068 virB1 Type IV secretion system protein VirB1, important for virulence, important for virulence [ 60 ] BAW_11934 BAB1_2018 zntR...”
- Transposon Sequencing of Brucella abortus Uncovers Essential Genes for Growth In Vitro and Inside Macrophages
Sternon, Infection and immunity 2018 - “...BAB2_0641 BAB2_0640 BAB1_0341 BAB1_0673 BAB1_2132 BAB1_0688 BAB1_1695 BAB1_1757 BAB1_0861 BAB1_0024 BAB1_0168 BAB1_0172 BAB2_0643 BAB1_0003 BAB1_1206 Gene name...”
- Proteomics-based confirmation of protein expression and correction of annotation errors in the Brucella abortus genome
Lamontagne, BMC genomics 2010 - “...BAB1_1671 TcaR synthase BAB1_0242 ManR BAB1_1014 MetG BAB1_1687 Dut BAB2_0216 3-hydroxybutyryl-CoA BAB1_0285 HisD BAB1_1030 Gor BAB1_1695 PurA dehydrogenase BAB1_0317 Trs arginine/ornithine BAB1_1037 Mandelate racemase; BAB1_1702 Phosphoglucosamine BAB2_0246 P47K BAB1_0331 ArgD muconate lactonizing mutase BAB2_0293 Gal BAB1_0344 Pip BAB1_1043 Unknown BAB1_1719 ThiE BAB2_0295 DgoK BAB1_0353 Unknown BAB1_1050...”
DVU3204 adenylosuccinate synthetase from Desulfovibrio vulgaris Hildenborough
52% identity, 98% coverage
AL01_06765 adenylosuccinate synthase from Bombella intestini
52% identity, 99% coverage
BSU40420 adenylosuccinate synthetase from Bacillus subtilis subsp. subtilis str. 168
NP_391922 adenylosuccinate synthetase from Bacillus subtilis subsp. subtilis str. 168
50% identity, 99% coverage
SUB0152 adenylosuccinate synthetase from Streptococcus uberis 0140J
50% identity, 99% coverage
SGO_1989 adenylosuccinate synthetase from Streptococcus gordonii str. Challis substr. CH1
A8AZM9 Adenylosuccinate synthetase from Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
50% identity, 99% coverage
- Physiological and molecular characterization of genetic competence in Streptococcus sanguinis
Rodriguez, Molecular oral microbiology 2011 - “...comX SGO_1707, comR1, SP_2006 comX2 SGO_2130 comR2 SP_0018 comW --- --- SP_0019 purA SSA_2185 purA SGO_1989 purA SP_0042 comA --- SGO_2097 comA SP_0043 comB --- SGO_2096 comB SP_0429 --- --- SP_0430 --- --- SP_0530 blpA --- --- SP_0545 blpY --- --- SP_0546 blpZ --- --- SP_0547...”
- Proteomic response in Streptococcus gordonii DL1 biofilm cells during attachment to salivary MUC5B
Robertsson, Journal of oral microbiology 2021 - “...triplicates. The remaining five member proteins of this pathway (PurA-C, PurH, PurM, UniProt accession numbers A8AZM9, A8AZX3, A8AU96, A8AUA2 and A8AU99) were present in all cultures with no significant difference in abundance. Purine is essential for all living organisms due to its role in a variety...”
spr0021 Adenylosuccinate synthetase from Streptococcus pneumoniae R6
SP_0019 adenylosuccinate synthetase from Streptococcus pneumoniae TIGR4
SPD_0024 adenylosuccinate synthetase from Streptococcus pneumoniae D39
HMPREF1038_00023, SPD_RS00115 adenylosuccinate synthase from Streptococcus pneumoniae gamPNI0373
50% identity, 99% coverage
- iDS372, a Phenotypically Reconciled Model for the Metabolism of Streptococcus pneumoniae Strain R6
Dias, Frontiers in microbiology 2019 - “...cases, information was often replicated throughout the remaining databases, such as the case of gene Spr0021. The annotation of genes with incomplete EC number, such as the cases of Spr0022 and Spr0064, required an in-depth analysis. Databases such as KEGG, UniProtKB, and CDD were consulted. In...”
- Eukaryotic-type serine/threonine protein kinase StkP is a global regulator of gene expression in Streptococcus pneumoniae
Sasková, Journal of bacteriology 2007 - “...Bacteriocin production spr1562 Purine metabolism Hypothetical genes spr0021 spr0053 spr0561 spr1324 spr1408 spr1935 spr1945 Hypothetical genes a spr1482 spr1623...”
- Genomics and Genetics of Streptococcus pneumoniae
Santoro, Microbiology spectrum 2019 (secret) - Genome-wide identification of Streptococcus pneumoniae genes essential for bacterial replication during experimental meningitis
Molzen, Infection and immunity 2011 - “...2.8 9.2 2.8 Purines, pyrimidines, nucleosides, and nucleotides SP_0019 SP_0494 purA pyrG Adenylosuccinate synthetase CTP synthase 2.6 7.0 2.2 17.9 2.6 17.1...”
- “...in GAF, only 6, those with mutations in SP_0019, SP_0151, SP_0416, SP_0749, SP_1068, and SP_1297, were significantly attenuated in competitive infection (Fig....”
- Physiological and molecular characterization of genetic competence in Streptococcus sanguinis
Rodriguez, Molecular oral microbiology 2011 - “...Gene SP_0014, comX1, SSA_0016 comX SGO_1707, comR1, SP_2006 comX2 SGO_2130 comR2 SP_0018 comW --- --- SP_0019 purA SSA_2185 purA SGO_1989 purA SP_0042 comA --- SGO_2097 comA SP_0043 comB --- SGO_2096 comB SP_0429 --- --- SP_0430 --- --- SP_0530 blpA --- --- SP_0545 blpY --- --- SP_0546...”
- A variable region within the genome of Streptococcus pneumoniae contributes to strain-strain variation in virulence
Harvey, PloS one 2011 - “...PH10 phage [30] . The prophage is inserted into a position between genes homologous to SP_0019 (adenylosuccinate synthetase) and 0020 (cytidine/deoxycytidylate deaminase) in TIGR4 and SPINV104 _ 00170 and 00180 in INV104. In addition, examination of the sequence of the integrase gene ( SPP_0028 ) suggests...”
- Comparative genomic analysis of ten Streptococcus pneumoniae temperate bacteriophages
Romero, Journal of bacteriology 2009 - “...are found integrated into their host strains between genes SP_0019 and SP_0020 in the TIGR4 genome (64). The att core sequence was identified by the alignment...”
- SPD_0090 Negatively Contributes to Virulence of Streptococcus pneumoniae
Cao, Frontiers in microbiology 2022 - “...0.56 0.005 SPD_0524 DNA-binding response regulator vncR 0.58 0.001 SPD_0786 Arginine repressor argR 0.60 0.031 SPD_0024 Adenylosuccinate synthetase purA 0.62 0.024 SPD_0700 Aminopeptidase N (metallopeptidase activity zinc ion binding) pepN 0.62 0.037 SPD_1927 Cation-transporting ATPase, E1-E2 family protein spd -1927 0.69 0.012 SPD_0320 2T cps2T 0.69...”
- Inactivation of Transcriptional Regulator FabT Influences Colony Phase Variation of Streptococcus pneumoniae
Zhang, mBio 2021 - “...SPD_2068 htrA Serine protease, DegP/HtrA 1.48 0.012 Down SPD_0004 ychF Redox-regulated ATPase YchF 0.59 0.037 SPD_0024 purA Adenylosuccinate synthase 0.55 0.019 SPD_0033 prsA Ribose-phosphate diphosphokinase 0.84 0.002 SPD_0063 strH Beta-N-acetylhexosaminidase 0.67 0.037 SPD_0074 Nucleoside phosphorylase 0.74 0.015 SPD_0079 Hypothetical protein 0.79 0.022 SPD_0098 Glycosyltransferase family 2...”
- Cadmium stress dictates central carbon flux and alters membrane composition in Streptococcus pneumoniae
Neville, Communications biology 2020 - “...18 32 59 SPD_0012 Hpt A0A0H2ZP27 Hypoxanthine-guanine phosphoribosyltransferase (EC:2.4.2.8) Mg 2+ 38 6 34 57 SPD_0024 PurA PURA_STRP2 Adenylosuccinate synthetase (EC:6.3.4.4) Mg 2+ 30 20 43 32,33,34 SPD_1839 Tkt/UlaH A0A0H2ZLU9 Transketolase (EC:2.2.1.1) Mg 2+ 33 21 32 37,38,41 SPD_0724 DeoB DEOB_STRP2 Phosphopentomutase (EC:5.4.2.7) Mn 2+ 59...”
- Redefining the Small Regulatory RNA Transcriptome in Streptococcus pneumoniae Serotype 2 Strain D39
Sinha, Journal of bacteriology 2019 - “...genes spd_0015, rrsA spd_0017, rrsA rrfA, spd_0017 spd_0024, spd_0025 spd_0040, spd_0039 spd_0047, spd_0048 spd_0048, comA spd_0077, spd_0078 spd_0082, rpsD TSS...”
- Streptococcus pneumoniae: a Plethora of Temperate Bacteriophages With a Role in Host Genome Rearrangement
Martín-Galiano, Frontiers in cellular and infection microbiology 2021 - “...core integration site of PPH010 viruses ( attB PPH010 ), previously reported to lie between SPD_RS00115 and SPD_RS00120 ( Romero etal., 2009a ) but actually located in ccnC coding for csRNA3 ( Furi etal., 2019 ); 2) PPH015, which integrates into SPD_RS00125 encoding the signal recognition...”
- “...positions 2403724121 of the S. pneumoniae D39 genome (between SPD_RS00120 encoding a nucleoside deaminase and SPD_RS00115 coding for an adenylosuccinate synthase). The purple rectangle corresponds to positions 1,712,4851,712,386 (between SPD_RS09110 and SPD_RS09115 in the D39 chromosome). For additional information see Tables S6 and S8 . At...”
- Genome analysis of a highly virulent serotype 1 strain of Streptococcus pneumoniae from West Africa
Williams, PloS one 2012 - “...average G+C content of PNI0373 ( Figure 6 ). This prophage is found integrated between HMPREF1038_00023 and HMPREF1038_00084. Orthologs of HMPREF1038_00023 and HMPREF1038_00084 are found flanking prophages within several other pneumococcal genomes including SP3-BS71, SP11-BS70, SP14-BS69, Hungary 19A-6, CDC3059-06, and CDC1873-00. We were able to identify...”
- “...between HMPREF1038_00316 and HMPREF1038_00317. Based on sequence and protein similarity, prophages integrated between orthologs of HMPREF1038_00023 and HMPREF1038_00084 cluster together forming a closely related group separate from other pneumococcal temperate prophages [54] . Of the previously studied pneumococcal prophages in this group, PNI0373 is most closely...”
A0PXA8 Adenylosuccinate synthetase from Clostridium novyi (strain NT)
50% identity, 98% coverage
MSMEG_0759 adenylosuccinate synthetase from Mycobacterium smegmatis str. MC2 155
MSMEG_0759 adenylosuccinate synthase from Mycolicibacterium smegmatis MC2 155
53% identity, 99% coverage
SSA_2185 Adenylosuccinate synthetase, putative from Streptococcus sanguinis SK36
50% identity, 99% coverage
EF0014 adenylosuccinate synthetase from Enterococcus faecalis V583
50% identity, 99% coverage
- From the Friend to the Foe-Enterococcus faecalis Diverse Impact on the Human Immune System
Daca, International journal of molecular sciences 2024 - “...is produced. In contrast to DCA, TCA stimulates mostly the genes involved in nucleotides ( ef0014 and ef1719 ) and amino acids ( ef0634/36 and ef3106/10 ) metabolism, promoting that way bacterial growth and leading to uncontrolled Enterococcus faecalis proliferation and overgrowth in the absence of...”
- Adaptation of the gut pathobiont Enterococcus faecalis to deoxycholate and taurocholate bile acids
Repoila, Scientific reports 2022 - “...late changes in the expression of pivotal enzymes involved in the nucleotide metabolism, purA ( ef0014 ) and pyrB ( ef1719 ) affecting purine and pyrimidine biosynthesis, respectively, (Table S5 ) 50 , 51 , 66 . This hypothesis is consistent with the sequential expression observed...”
- Integrating highly quantitative proteomics and genome-scale metabolic modeling to study pH adaptation in the human pathogen Enterococcus faecalis
Großeholz, NPJ systems biology and applications 2016 - “...Acylphosphatase EF2401 0.452 0.0013 3.6.1.7 R_ADPT Adenine phosphoribosyltransferase EF1687 1.6662 0.0149 2.4.2.7 R_ADSS Adenylosuccinate synthetase EF0014 0.5674 0.0075 6.3.4.4 R_AICART Phosphoribosylaminoimidazolecarboxamide formyltransferase EF1778 0.41 0.0421 2.1.2.3 R_ASPK Aspartate kinase EF0368 0.4923 0.0202 2.7.2.4 R_CDD Cytidine deaminase EF0175 0.4768 0.0001 3.5.4.5 R_GAT1_EFA Glycerol 3-phosphate acyltransferase EF3112 1.5759...”
- Transcriptional regulator PerA influences biofilm-associated, platelet binding, and metabolic gene expression in Enterococcus faecalis
Maddox, PloS one 2012 - “...rpsD [EF3070], rpmB [EF3116] and rpmH [EF3333]) and pyrimidine nucleotide biosynthetic genes ( purA , EF0014) ( Fig. 1B ). Lastly, putative peptide ATP-binding cassette (ABC) transporters were significantly induced in DBS01. While poorly studied in E. faecalis , these peptide transporters generally provide nutrients to...”
- Intra- and interspecies genomic transfer of the Enterococcus faecalis pathogenicity island
Laverde, PloS one 2011 - “...- - 2c + + * + * + * EF0013 + + + + EF0014 + + + + EF0015 + + + + EF0016 + + + + EF0017 + + + + EF0019 + + + + EF0020 + + + + EF0021...”
- The transcriptome of the nosocomial pathogen Enterococcus faecalis V583 reveals adaptive responses to growth in blood
Vebø, PloS one 2009 - “...pyrimidines [66] . The down-regulation of several genes involved in biosynthesis of these compounds (e.g. EF0014, EF0058, EF1547, EF2362-61 and EF3293) might imply that the requirement for nucleotides was covered by scavenging ( Table S1 ). However, no evidence of modulation of ribose/deoxyribose metabolism was observed,...”
- Transcriptional response of Enterococcus faecalis V583 to erythromycin
Aakra, Antimicrobial agents and chemotherapy 2005 - “...EF0820 EF1379 EF1764 EF1970 EF2228 EF2856 EF2858 EF2931 EF3292 EF3333 EF0014 EF0185 EF0470 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.78...”
Q8P2U1 Adenylosuccinate synthetase from Streptococcus pyogenes serotype M18 (strain MGAS8232)
50% identity, 99% coverage
SPy0160, SPy_0160 putative adenylosuccinate synthetase from Streptococcus pyogenes M1 GAS
50% identity, 99% coverage
Rv0357c adenylosuccinate synthetase from Mycobacterium tuberculosis H37Rv
52% identity, 98% coverage
- Development and application of affordable SNP typing approaches to genotype Mycobacterium tuberculosis complex strains in low and high burden countries
Cancino-Muñoz, Scientific reports 2019 - “...This study R-ACTGCGAGGCGTGGATTC L4.5 2789341 A/C Rv2483c F-GGAGGCCTCACCATCCTTG 81bp This study R-ACGAAGGCGGCTACAAAGAA L4.6.1 435708 G/A Rv0357c F-CAAAGATCCCGCTGGGTCAT 58bp This study R-GATATGAGATCGACGGCCGG L4.6.2 3191099 C/A Rv2881c F-CATCATGCAGAACACCCATC 72bp This study R-CCCATTGTTCTGCTCTTTCG L4.10 1692141 C/A Rv1501 F-GCTCGGTGTTCTTCGACTCA 107bp This study R-TGGCCGTTTCAGATAGCACA * Nomenclature proposed by Stucki et al...”
- The Inosine Monophosphate Dehydrogenase, GuaB2, Is a Vulnerable New Bactericidal Drug Target for Tuberculosis
Singh, ACS infectious diseases 2017 - “...iunH , Rv3393, purine nucleosidase; ndkA , Rv2445c, nucleoside-diphosphate kinase; PRPP, 5-phosphoribosyl 1-pyrophosphate; purA , Rv0357c, adenylosuccinate synthetase; purB , Rv0777, adenylosuccinate lyase; RNR, ribonucleotide reductase; XMP, xanthosine 5-monophosphate. The compound described in this study, VCC234718, adds to the growing list of inhibitors of Mtb GuaB2...”
- A genome-wide structure-based survey of nucleotide binding proteins in M. tuberculosis
Bhagavat, Scientific reports 2017 - “...chaperone protein DnaK (heat shock protein 70) (heat shock 70kDa protein) (HSP70) AMP ATP GTP Rv0357c Probable adenylosuccinate synthetase PurA (imp-aspartate ligase) (ADSS) (ampsase) ADP ATP GTP Rv0391 Probable O-succinylhomoserine sulfhydrylase MetZ (OSH sulfhydrylase) GTP Rv0440 60kDa chaperonin 2 GroEL2 (protein CPN60-2) (GroEL protein 2) (65kDa...”
- The glyceraldehyde-3-phosphate dehydrogenase GapDH of Corynebacterium diphtheriae is redox-controlled by protein S-mycothiolation under oxidative stress
Hillion, Scientific reports 2017 - “...# active site (K)VGIGPGSIC 317 TTR(V) Rv3410c* PurA DIP2063 Adenylosuccinate synthetase Cys423 (R)DQTIVC 423 HDVMEA(-) Rv0357c Other functions DIP0913 DIP0913 Uncharacterized protein Cys22 (K)ERPTAGPQLYPVTC 22 EAVVSAIR(A) DIP1026 DIP1026 Conserved ATP-binding protein Cys75 (R)IC 75 LEADLGPVR(F) Rv1278 DIP1102 DIP1102 Putative uncharacterized protein Cys441 (R)LLSAC 441 PESGLYK(G) DIP1250...”
- Chromosomal rearrangements and protein globularity changes in Mycobacterium tuberculosis isolates from cerebrospinal fluid
Saw, PeerJ 2016 - “...Rv2606c snzP Pyridoxine biosynthesis protein SnzP Biosynthesis of pyridoxine/pyridoxal 5-phosphate UM-CSF strains Mycobacteria, S pneumoniae Rv0357c purA Probable adenylosuccinate synthetase purA AMP biosynthesis UM-CSF strains Mycobacteria N meningitidis Rv2457c clpX ATP-dependent CLP protease ATP-binding subunit ClpX Directs the CLP protease to specific substrates; performs chaperone functions...”
- “...( Table S9 ), three, Rv1699 (CTP synthase PyrG), Rv2606c (pyridoxine biosynthesis protein SnzP) and Rv0357c (adenylosuccinate synthetase PurA) were found in our UM-CSF strains. These genes showed 5168% sequence similarity with their homologs in S. pneumoniae but were identical in all UM-CSF strains and H37Rv,...”
- The Absence of Pupylation (Prokaryotic Ubiquitin-Like Protein Modification) Affects Morphological and Physiological Differentiation in Streptomyces coelicolor
Boubakri, Journal of bacteriology 2015 - “...M MI MI MI MI Y Rv3596c Rv3688c Rv0357c Rv0002 Rv3417c cg0587 cg3011 RER_27870 RER_44340 cg2736 cg0067 cg0483 cg2079 cg0498 RER_17640 RER_15260 MSMEG_4891...”
- Prokaryotic ubiquitin-like protein (Pup) proteome of Mycobacterium tuberculosis [corrected]
Festa, PloS one 2010 - “...29.8 280 Rv2222c GlnA2 (49.6) 363 Rv0242c FabG4 (46.8) 168, 381 Rv2241 AceE (100.1) 346 Rv0357c PurA (46.8) 292 Rv2243 FabD (30.8) 173 Rv0440 GroEL2 (56.7) 132 Rv2280 48.1 354 Rv0467 Icl (47.0) 334 Rv2419c 24.2 47 Rv0525 22.2 136 Rv2449c 44.3 127 Rv0640 RpkL (15.0)...”
- Rapid and spontaneous loss of phthiocerol dimycocerosate (PDIM) from Mycobacterium tuberculosis grown in vitro: implications for virulence studies
Domenech, Microbiology (Reading, England) 2009 - “...Rv0342 iniA -2.49 Isoniazid-inducible unknown protein Rv0357c purA -2.46 Probable adenylosuccinate synthase Rv0531 CHP -2.91 Conserved hypothetical protein...”
- More
M28_Spy0134 adenylosuccinate synthetase from Streptococcus pyogenes MGAS6180
50% identity, 99% coverage
- Adaptation of group A Streptococcus to human amniotic fluid
Sitkiewicz, PloS one 2010 - “...M28_Spy0031 SPy0034 purK 6.05 11.19 Phosphoribosylaminoimidazole carboxylase NCAIR mutase M28_Spy0064 SPy0074 adk 8.25 Adenylate kinase M28_Spy0134 SPy0160 purA 3.17 Adenylosuccinate synthetase M28_Spy0193 SPy0235 - 2.67 Deoxyuridine 5 -triphosphate nucleotidohydrolase M28_Spy0316 SPy0392 upp 2.43 Uracil phosphoribosyltransferase M28_Spy0334 SPy0425 nrdF.1 5.27 Ribonucleoside-diphosphate reductase beta chain M28_Spy0335 SPy0426 nrdI...”
SMU_RS01355 adenylosuccinate synthase from Streptococcus mutans UA159
49% identity, 98% coverage
D820_RS08295 adenylosuccinate synthase from Streptococcus mutans ATCC 25175
49% identity, 98% coverage
- Transcriptomic Stress Response in Streptococcus mutans following Treatment with a Sublethal Concentration of Chlorhexidine Digluconate
Muehler, Microorganisms 2022 - “...D820_RS03940, D820_RS03930 7.00 10 3 Purine nucleotide biosynthesis D820_RS04105, D820_RS04110, D820_RS04100, D820_RS09285, D820_RS09290, D820_RS09325, D820_RS09250, D820_RS08295, D820_RS09340, D820_RS09355, D820_RS09335, D820_RS09300, D820_RS09345 1.00 10 2 Inosine-5-phosphate biosynthesis D820_RS09285, D820_RS09290, D820_RS09325, D820_RS09250 2.00 10 2 Downregulated Lactose degradation D820_RS02995, D820_RS02980, D820_RS02985, D820_RS03025, D820_RS02990 4.00 10 6 Galactose degradation...”
D5AK71 Adenylosuccinate synthetase from Streptococcus suis (strain GZ1)
49% identity, 91% coverage
SSU1758 adenylosuccinate synthetase from Streptococcus suis P1/7
49% identity, 99% coverage
lp_3270 adenylosuccinate synthase from Lactobacillus plantarum WCFS1
48% identity, 99% coverage
Q88SV6 Adenylosuccinate synthetase from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_3270 adenylosuccinate synthase from Lactiplantibacillus plantarum WCFS1
48% identity, 99% coverage
sll1823 adenylosuccinate synthetase from Synechocystis sp. PCC 6803
50% identity, 96% coverage
- Erythromycin mediates co-flocculation between cyanobacterium Synechocystis sp. PCC 6803 and filamentous fungi in liquid cultivation without organic compounds
Pichaiyotinkul, Scientific reports 2024 - “...protein 5.8 NS 5.4 Up-regulation in flocculated wild type, compared to suspended wild type 60 sll1823 (purA) Adenylosuccinate synthetase 5.5 2.0 3.5 Normal expression in flocculated wild type, compared to down-regulation in suspended in kpsM -deleted strain 67 ssr0692 Key regulator of arginine synthesis 5.2 1.5...”
- “..., and sll1951 ), and the genes for the regulatory/signal transduction proteins ( slr1738 , sll1823 , ssr062 , and sll0821 ) (Table 2 ). Additionally, the down-regulated genes are the three genes for the minor-pilin proteins ( slr2016 , slr2017 , and slr2018 ). Synechocystis...”
- Lethality caused by ADP-glucose accumulation is suppressed by salt-induced carbon flux redirection in cyanobacteria
Díaz-Troya, Journal of experimental botany 2020 - “...slr0288 ), petJ (gene ID sll1796 ), adk (gene ID sll1815 ), purA (gene ID sll1823 ), and ggpS (gene ID sll1566 ). Strains used in this work are described in Table 1 , and primers are listed in Supplementary Table S1 at JXB online ....”
BSQ49_00075 adenylosuccinate synthase from Liquorilactobacillus hordei
48% identity, 99% coverage
CPF_2958 adenylosuccinate synthetase from Clostridium perfringens ATCC 13124
CPE2622 adenylosuccinate synthase from Clostridium perfringens str. 13
49% identity, 98% coverage
EQG65_00095, NWMN_RS00085 adenylosuccinate synthase from Staphylococcus aureus subsp. aureus str. Newman
SAOUHSC_00019 adenylosuccinate synthetase from Staphylococcus aureus subsp. aureus NCTC 8325
SAUSA300_0017 adenylosuccinate synthetase from Staphylococcus aureus subsp. aureus USA300_FPR3757
NWMN_0016 adenylosuccinate synthetase from Staphylococcus aureus subsp. aureus str. Newman
SACOL0018 adenylosuccinate synthetase from Staphylococcus aureus subsp. aureus COL
47% identity, 99% coverage
- Global Transcriptomic Analysis of Bacteriophage-Host Interactions between a Kayvirus Therapeutic Phage and Staphylococcus aureus
Finstrlová, Microbiology spectrum 2022 - “...0.53 - - Nucleotide biosynthesis pathway NWMN_RS00455 Purine nucleoside phosphorylase DeoD 6.63 5.33 4.68 10.09 NWMN_RS00085 Adenylosuccinate synthetase PurA 2.00 1.85 1.75 ( P = 0.1) 2.21 NWMN_RS07050 GMP reductase GuaC 2.42 2.18 4.19 3.69 Nitrogen cycle metabolic process NWMN_RS13190 GAF domain-containing protein 4.45 4.65 n.s....”
- Antibacterial Activity and Components of the Methanol-Phase Extract from Rhizomes of Pharmacophagous Plant Alpinia officinarum Hance
Fu, Molecules (Basel, Switzerland) 2022 - “...[ 22 ], were also highly enhanced (15.489, and 19.096-fold, respectively). Additionally, adenylosuccinate synthase ( EQG65_00095 , 16.494-fold) plays an important role in the salvage pathway in purine nucleotide biosynthesis [ 23 ]. In alanine, aspartate and glutamate metabolism, the expression of six DEGs was also...”
- Teg58, a small regulatory RNA, is involved in regulating arginine biosynthesis and biofilm formation in Staphylococcus aureus
Manna, Scientific reports 2022 - “...ALC8717, Teg58 mutant expression value, RPKM Fold Repressed; mut/wt Fold activated; wt/mut Purine metabolic pathway SAOUHSC_00019 Adenylosuccinate synthase, purA 1208 3919 3.24 SAOUHSC_01016 Phosphoribosylglycinamide formyltransferase, purN 5369 12,434 2.31 SAOUHSC_01017 IMP cyclohydrolase, purH 5769 14,143 2.45 SAOUHSC_01018 Phosphoribosylamine glycine lipase, purD 6179 18,501 2.99 SAOUHSC_01015 Phosphoribosylformylglycinamidine...”
- Proteomic and Metabolomic Analyses of a Tea-Tree Oil-Selected Staphylococcus aureus Small Colony Variant
Torres, Antibiotics (Basel, Switzerland) 2019 - “...to SH1000 SAOUHSC_00002 DnaN DNA polymerase III subunit beta DNA replication, recombination and repair 1.4 SAOUHSC_00019 PurA adenylosuccinate synthetase nucleotide metabolism 1.4 SAOUHSC_00074 periplasmic binding protein transporter 2.6 SAOUHSC_00200 PrsW membrane proteinase uncharacterized 1.7 SAOUHSC_00204 Hmp globin domain-containing protein uncharacterized 1.4 SAOUHSC_00284 Hel 5-Nucleotidase nucleotide metabolism...”
- Copper stress in Staphylococcus aureus leads to adaptive changes in central carbon metabolism
Tarrant, Metallomics : integrated biometal science 2019 - “...SAOUHSC_00819 gi|446981826 0.5 0.0001 NADH dehydrogenase-like protein ndh2 SAOUHSC_00878 gi|122539909 0.5 0.00012 Adenylosuccinate synthetase purA SAOUHSC_00019 gi|446017472 0.4 0.00011 Putative formate dehydrogenase subunit alpha fdhA SAOUHSC_02582 gi|123406992 0.4 0.00046 Alcohol dehydrogenase adhA SAOUHSC_00608 gi|122540071 0.3 <0.00010 Formate acetyltransferase pflB SAOUHSC_00187 gi|446817404 0.1 <0.00010 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase...”
- Genes contributing to Staphylococcus aureus fitness in abscess- and infection-related ecologies
Valentino, mBio 2014 - “...found to be underrepresented under all infection-relevant conditions were those for adenylosuccinate synthetase and lyase (SAOUHSC_00019 and SAOUHSC_02126, respectively). The pool of mutants recovered from the abscess was found to have the greatest number of genes (322 genes) for which representation of transposon insertions decreased at...”
- Growth and Stress Tolerance Comprise Independent Metabolic Strategies Critical for Staphylococcus aureus Infection
Kim, mBio 2021 - “...+ 12,937 22,057 770,621 1,472,623 SAUSA300_1127 smc 12138 16033 ** 984 + + + + SAUSA300_0017 purA 74 *** 7822 991 + + + + 1,271 640 * 192,500 135,620 SAUSA300_1889 purB 138 *** 678 968 + + + + 1,288 549 *** 144,250 60,327 ***...”
- “...32.177.98 **** 128.0416.49 37.3511.25 0.70.31 SAUSA300_2064 atpB 5.13 1.070.08 3.24 102.2518.80 88.0840.16 31.172.58 0.980.21 *** SAUSA300_0017 purA Purine 5.72 0.280.11 **** 13 96.0822.11 81.0747.75 NA NA SAUSA300_0969 purS 5.75 NA **** NA 95.9215.84 104.4444.57 30.255.25 0.270.09 *** SAUSA300_1590 relA 3.47 1.020.06 3.94 102.1719.62 92.9928.19 14.831.20 ****...”
- Identification of Staphylococcus aureus Factors Required for Pathogenicity and Growth in Human Blood
Connolly, Infection and immunity 2017 - “...agar A1 SAUSA300_1889 NE522 Adenylosuccinate lyase (PurB) Reduced growth Reduced growth Increased hemolysis Reduced hemolysis SAUSA300_0017 NE529 Adenylosuccinate synthetase (PurA) Reduced growth Reduced growth Increased hemolysis Slightly increased hemolysis SAUSA300_0698 NE821 para -Aminobenzoate synthase, glutamine amidotransferase, component II (PabA) Highly reduced growth Slightly reduced growth b...”
- Cigarette Smoke Extract-Exposed Methicillin-Resistant Staphylococcus aureus Regulates Leukocyte Function for Pulmonary Persistence
Kulkarni, American journal of respiratory cell and molecular biology 2016 - “...SAUSA300_0318 SAUSA300_1374 SAUSA300_0792 SAUSA300_0949 SAUSA300_0017 SAUSA300_1943 SAUSA300_0950 SAUSA300_2486 SAUSA300_1990 SAUSA300_0976 SAUSA300_2525...”
- CodY in Staphylococcus aureus: a regulatory link between metabolism and virulence gene expression
Pohl, Journal of bacteriology 2009 - “...NWMN_0859 NWMN_0428 NWMN_1950 NWMN_0423 NWMN_2288 NWMN_0016 NWMN_0379 NWMN_1110 NWMN_1111 NWMN_1112 NWMN_1249 NWMN_0163 NWMN_0162 NWMN_0979 NWMN_1325 NWMN_2294...”
- Tea tree oil-induced transcriptional alterations in Staphylococcus aureus
Cuaron, Phytotherapy research : PTR 2013 - “...protein SACOL1637 5-CCGGTGACAACAAACTTGG-3 5-TCAGCAGCATCTTTCAAACG-3 mmpL MmpL efflux pump, putative SACOL2566 5-GGAATGACATCTACAGAAGTAGGC-3 5-AACTGCTAGTCCAATCATTACGG-3 purA adenylosuccinate synthase SACOL0018 5-GAGGTTGGTCGTGAATACGG-3 5-TGGGTACTCAGTAATTTCTTTACCG-3 purM phosphoribosylaminoimidazole synthetase SACOL1080 5-AATATGGGTATTGGCTATACGG-3 5-CACAATATGACCAATTTGATAGGC-3 rpmI ribosomal protein L35 SACOL1726 5-TGCCAAAAATGAAAACTCACC-3 5-GAGATGTGAAAGCTCTTGAACG-3 tenA transcriptional regulator, TenA family SACOL2086 5-TAGGAGCTGACGCATTACGC-3 5-CCCATTGTTCTAGTGTCATAGCC-3 vraR DNA-binding response regulator VraR SACOL1942 5-AAAGAAGCAATTGCCAAAGC-3...”
- “...SACOL1636 3.0 vraS histidine kinase sensor SACOL1943 1.7 1.8 1.9 Down-regulated genes purA adenylosuccinate synthase SACOL0018 13.1 2.2 2.1 purM phosphoribosylaminoimidazole synthetase SACOL1080 11.5 1.7 1.6 sle1 N-acetylmuramyl-L-alanine amidase SACOL0507 10.8 isaA lytic transglycosylase SACOL2584 10.8 purL phosphoribosylformylglycinamidine synthetase SACOL1078 10.5 dltA D-alanine-D-alanyl carrier protein ligase...”
- Complete and SOS-mediated response of Staphylococcus aureus to the antibiotic ciprofloxacin
Cirz, Journal of bacteriology 2007 - “...SACOL1381 SACOL1400 SACOL1955 SACOL2089 Nucleotide metabolism Down-regulated ORFs SACOL0018 atpC atpD atpG atpA atpH atpF atpE atpB nuoF narI narJ narH narG...”
SAR0017 putative adenylosuccinate synthetase from Staphylococcus aureus subsp. aureus MRSA252
P65884 Adenylosuccinate synthetase from Staphylococcus aureus (strain Mu50 / ATCC 700699)
SA0016 adenylosuccinate synthase from Staphylococcus aureus subsp. aureus N315
SAV0017 adenylosuccinate synthase from Staphylococcus aureus subsp. aureus Mu50
B4602_RS00095, SAPIG0017 adenylosuccinate synthase from Staphylococcus aureus
47% identity, 99% coverage
- Global network analysis of drug tolerance, mode of action and virulence in methicillin-resistant S. aureus
Overton, BMC systems biology 2011 - “...of persister formation [ 74 ]. Additionally, several other cell division proteins were RanaDown, including SAR0017 (PurA, 0.62-fold, intermodular hub), SAR1047 (PurH, 0.27-fold), SAR2000 (PurB, 0.7-fold), SAR1180 (PyrF 0.82-fold), and the transcript SAR1040 ( purC , 0.48-fold) was RanaDown. These genes (or operons as applicable) are...”
- Antibacterial Activity and Multi-Targeted Mechanism of Action of Suberanilic Acid Isolated from Pestalotiopsis trachycarpicola DCL44: An Endophytic Fungi from Ageratina adenophora
Wen, Molecules (Basel, Switzerland) 2024 - “...succinyltransferase 1.852 Up 0.000103329 A0A0U1MI53 pdhA Pyruvate dehydrogenase E1 component subunit alpha 1.496 Up 0.001443745 P65884 purA Adenylosuccinate synthetase 0.576 Down 0.000180435 Q6GAW6 argH Argininosuccinate lyase 0.404 Down 5.68 10 5 A0A2S6D4J7 glmS Glutamine-fructose-6-phosphate aminotransferase 0.799 Down 0.000120906 Q6GJB4 ilvE Probable branched-chain-amino-acid aminotransferase 0.681 Down 0.000162841...”
- “...5 Q6GFK5 fumC 1.462 0.000550982 2.589 Consistency 6 A0A0U1MI53 pdhA 1.496 0.00642461 2.194 Consistency 7 P65884 purA 0.576 0.023770336 0.390 Consistency 8 A0A2S6D4J7 glmS 0.799 0.932842293 1.017 Consistency 9 Q6GJB4 ilvE 0.681 0.088087529 0.723 Consistency 10 Q6GDG7 arcA 0.301 0.001021429 0.154 Consistency 11 Q6GIC7 argG 0.147...”
- An RpoB mutation confers dual heteroresistance to daptomycin and vancomycin in Staphylococcus aureus
Cui, Antimicrobial agents and chemotherapy 2010 - “...2017 by University of California, Berkeley Purine metabolism SA0016 SA0373 SA0374 SA0375 SA0376 SA0468 SA0916 SA0917 Gene 5230 CUI ET AL. ANTIMICROB. AGENTS...”
- Transcriptome and functional analysis of the eukaryotic-type serine/threonine kinase PknB in Staphylococcus aureus
Donat, Journal of bacteriology 2009 - “...corresponding to the entire coding sequence of purA (SA0016) and pknB (SA1063) were synthesized by PCR amplification using genomic DNA of S. aureus 8325...”
- Transcriptomic and functional analysis of an autolysis-deficient, teicoplanin-resistant derivative of methicillin-resistant Staphylococcus aureus
Renzoni, Antimicrobial agents and chemotherapy 2006 - “...0.05 0.04 NS NS NS SA0743 SAS044 SA1318 SA1337 SA1339 SAS030 SA0016 SA1724 SA0918 SA0926 SA0916 graB graC graD graE malR graF purA purB purC purD purE * ** *...”
- Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
Seggewiss, Journal of bacteriology 2006 - “...repress purA (adenylosuccinate synthase, S. aureus homologue SA0016), glyA (serine hydroxymethyl transferase, S. aureus homologue SA1915), folD, and the...”
- Transcription profiling-based identification of Staphylococcus aureus genes regulated by the agr and/or sarA loci
Dunman, Journal of bacteriology 2001 - “...SA1206 SA0244 SA1103 SA0523 SA0666 SA1391 SA1123 SA2351 SA0016 SA1045 SAS093 SA1466 SA1844 SA1842 SA1843 SAS066 SA1516 SA0434 SA1120 SA1920 SA2079 SA2135 SA1214...”
- Studies on the mechanism of telavancin decreased susceptibility in a laboratory-derived mutant
Song, Microbial drug resistance (Larchmont, N.Y.) 2013 - “...SAV2531 putative beta-subunit of L-serine dehydratase 12fold; SAV0017 purA 14.3-fold; SAV2095 similar to SceD precursor 25.1-fold. In the cell envelope...”
- Golden pigment production and virulence gene expression are affected by metabolisms in Staphylococcus aureus
Lan, Journal of bacteriology 2010 - “...biosynthesis SAV1072 strain SAV1073 strain SAV1074 strain SAV0017 strain Other functions SAV0672 strain SAV1667 strain SAV1108 strain SAV1117 strain Gene name...”
- Antibacterial Ingredients and Modes of the Methanol-Phase Extract from the Fruit of Amomum villosum Lour
Zhang, Plants (Basel, Switzerland) 2024 - “...0.472-fold) in S. aureus GIM1.441 ( p < 0.05). For example, the adenylosuccinate synthase ( B4602_RS00095 ) was significantly inhibited (0.413-fold), which catalyzes the first committed step in the synthesis of adenosine [ 26 ]. Conversely, four DEGs were significantly up-regulated (2.014- to 2.141-fold), e.g., the...”
- Combined proteomic and transcriptomic analysis of the antimicrobial mechanism of tannic acid against Staphylococcus aureus
Wang, Frontiers in pharmacology 2023 - “...B4602_RS05220 purN WP_000238669.1 phosphoribosylglycinamide formyltransferase, partial 1.33 2.45 B4602_RS10010 purB WP_000572878.1 Adenylosuccinate lyase 0.32 1.02 B4602_RS00095 - WP_000095328.1 Adenylosuccinate synthase 1.47 1.06 B4602_RS13495 pruA WP_000259692.1 L-glutamate gamma-semialdehyde dehydrogenase 0.48 0.39 B4602_RS05360 lpdA WP_000260117.1 Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex 0.60 0.52 B4602_RS00640 - WP_000290396.1 Aldehyde dehydrogenase...”
- “...to the anabolism of amino acids. Amidophosphoribosyl transferase (PurF), phosphoribosylformylglycinamidine synthase I (PurQ), adenylosuccinate synthase (B4602_RS00095), phosphoribosylglycinamide formyltransferase (PurN) and adenylosuccinate lyase (PurB) are enzymes involved in the hypoxanthine nucleotide and adenine nucleotide synthesis pathways ( Table 1 ). PurF catalyzes the formation of phosphoribosylamine from...”
- High-Throughput Mutagenesis Reveals a Role for Antimicrobial Resistance- and Virulence-Associated Mobile Genetic Elements in Staphylococcus aureus Host Adaptation
Ba, Microbiology spectrum 2023 - “...RutB Q Human 2091997-2092557 SAPIG0725 fepC Ferric enterobactin transport ATP-binding protein FepC HP Human 760373-761170 SAPIG0017 purA Adenylosuccinate synthetase NA Human/pig 22441-23724 SAPIG0883 aroD 3-Dehydroquinate dehydratase E Human 927295-928011 SAPIG1300 glpP Glycerol uptake operon antiterminator regulatory protein, GlpP K Human 1365435-1365968 SAPIG1842 menC NAAAR, N -acylamino...”
P29726 adenylosuccinate synthase (EC 6.3.4.4) from Bacillus subtilis (see paper)
48% identity, 99% coverage
lmo0055 highly similar to adenylosuccinate synthetase from Listeria monocytogenes EGD-e
49% identity, 98% coverage
- Comparison of Surface Proteomes of Adherence Variants of Listeria Monocytogenes Using LC-MS/MS for Identification of Potential Surface Adhesins
Tiong, Pathogens (Basel, Switzerland) 2016 - “...protein S18 (9) CY CY 0.33 (E,C,CM) CY No No 0 No No <1.8 0.63 lmo0055 (2.3) Hypothetical protein CY CY 0.03 (E,C) CY No No 0 No No <1.8 0.25 lmo0186 (5.2) Hypothetical protein (44) CY M (Equal score to all) Unknown No Yes (TM)...”
- “...Vivo Regulation (literature) a,b 1 lmo0002 * dnaN DNA replication 3.1 --- >10 --- 2 lmo0055 purA Metabolism of nucleotides and nucleic acids 2.3 --- --- 3 lmo0186 lmo0186 Unknown 5.2 --- --- 4 lmo0202 hly Miscellaneous 4.5 --- 5 lmo0204 1 actA Cell surface proteins...”
- Ultra deep sequencing of Listeria monocytogenes sRNA transcriptome revealed new antisense RNAs
Behrens, PloS one 2014 - “...conserved in L. innocua and L. welshimeri . The asRNA anti0055 is located antisense of lmo0055 or purA , an adenylosuccinate synthetase, important in the de novo synthesis of purine nucleobases, which also plays roles in infection [26] and intracellular growth [27] . Transcription of the...”
- “...among these are four asRNAs opposite of the genes lmo2225 ( fumC ), lmo2330 , lmo0055 ( purA) and lmo2367 ( pgi ). The prophage A118 can be found in the L. monocytogenes EGD-e genome inserted between the genes lmo2271 and lmo2332 [22] . At the...”
- Non-coding RNA regulation in pathogenic bacteria located inside eukaryotic cells
Ortega, Frontiers in cellular and infection microbiology 2014 - “...L. monocytogenes Rli55 Up (transcriptome) Mraheil et al., 2011 L. monocytogenes anti0055 (asRNA) Up purA (lmo0055) Unknown Behrens et al., 2014 L. monocytogenes anti2106 (asRNA) Up lmo2106 Unknown Behrens et al., 2014 L. monocytogenes anti2225 (asRNA) Up fumC (lmo2225) Unknown Behrens et al., 2014 L. monocytogenes...”
- Deciphering the intracellular metabolism of Listeria monocytogenes by mutant screening and modelling
Schauer, BMC genomics 2010 - “...metabolism of nucleotides and nucleic acids lmo0787 amino acid transporter no 3.4 1.0 1,5 purA (lmo0055) adenylosuccinate synthetase no 14.9 /4.0 lmo0810 spermidine/putrescine-binding protein no 7.4 3.1 purQ (lmo1769) phosphoribosylformylglycinamidine synthetase rf 12.0 nd 3 lmo1003 phosphotransferase system enzyme I no 3.4 1.0 8 purS (lmo1771)...”
- Microarray-based characterization of the Listeria monocytogenes cold regulon in log- and stationary-phase cells
Chan, Applied and environmental microbiology 2007 - “...2.4 3.0 3.3 7.0 3.9 Amino acid metabolism lmo0055 (purA) Highly similar to adenylosuccinate synthetase 2.2 3.0 Other or hypothetical proteins lmo0047 lmo0189...”
SCO3629 adenylosuccinate synthetase from Streptomyces coelicolor A3(2)
51% identity, 97% coverage
- DNA mapping and kinetic modeling of the HrdB regulon in Streptomyces coelicolor
Šmídová, Nucleic acids research 2019 - “...17 genes (81%)prsA (SCO0782), purB (SCO1254), guaB2 (SCO1461), purE (SCO3059), purK (SCO3060), prsA2 (SCO3123), purA (SCO3629), SCO3677, purQ (SCO4078), purl (SCO4079), purF (SCO4086), purM (SCO4087), adk (SCO723), guaB (SCO4770), SCO4771, purN (SCO4813), purH (SCO4814). In the pyrimidine biosynthesis subgroup we found six genes (67%)pyrB (SCO1487), carB...”
- The Absence of Pupylation (Prokaryotic Ubiquitin-Like Protein Modification) Affects Morphological and Physiological Differentiation in Streptomyces coelicolor
Boubakri, Journal of bacteriology 2015 - “...despite their conservation in these genera. SCO6042 and SCO3629 were the only proteins pupylated in S. coelicolor for which homologous proteins were also found...”
- “...found to be pupylated in the two mycobacteria. For SCO3629, the lysine pupylated in S. coelicolor was found to be conserved in the three other actinobacteria,...”
- ArgR of Streptomyces coelicolor is a versatile regulator
Pérez-Redondo, PloS one 2012 - “...in transcriptomic experiments. That is the case for gabT (forming succinate), the adenylosuccinate-synthetase-encoding gene purA (SCO3629, profile II.2) and for dhsA (SCO4856), dhsB (SCO4855) and SCO0922, three out of the 10 genes encoding succinate dehydrogenases which showed I.3 profile. Purine metabolism In the proteome of the...”
- Quantitative proteomics analysis of Streptomyces coelicolor development demonstrates that onset of secondary metabolism coincides with hypha differentiation
Manteca, Molecular & cellular proteomics : MCP 2010 - “...6 7 7 7 2 3 2 32 32 32 32 SCO1660 SCO4087 SCO3629 1 1 3 1, 27 1, 3 3, 19 Translation, protein folding, RNA/protein processing 32 32 32 32 32 SCO no. Cl Function...”
BL0549 adenylosuccinate synthetase from Bifidobacterium longum NCC2705
48% identity, 97% coverage
C9Z407 Adenylosuccinate synthetase from Streptomyces scabiei (strain 87.22)
50% identity, 97% coverage
LMOf2365_0065 adenylosuccinate synthetase from Listeria monocytogenes str. 4b F2365
48% identity, 98% coverage
- Identification of genetic elements required for Listeria monocytogenes growth under limited nutrient conditions and virulence by a screening of transposon insertion library
Narayanan, Frontiers in microbiology 2022 - “...39.1 purM ::Tn LMOf2365_1792 Phosphoribosylformylglycinamidine cyclo-ligase 28.5 40.95 30.4 11.2 23.9 16.57 29.03 purA ::Tn LMOf2365_0065 Adenylosuccinate synthetase 27.2 34.16 39.6 7.67 17.8 15.98 31.65 purC ::Tn LMOf2365_1797 Phosphoribosylaminoimidazole-succinocarboxamide 31.7 35.75 31.1 15.8 29.09 18.52 31.85 Pyrimidine metabolism pyrE ::Tn LMOf2365_1859 Orotate phosphoribosyltransferase 14.2 11.76 13.5...”
- “...::Tn has Tn-insertion in a hypothetical protein (LMOf2365_0064) that is 68 bp upstream of purA (LMOf2365_0065). The growth defect in HP64 ::Tn and purA ::Tn mutants could be restored by addition of adenine to MM. Thus, the phenotypic effect shown by HP64 ::Tn is apparently due...”
- Transcriptomic Analysis of Listeria monocytogenes in Response to Bile Under Aerobic and Anaerobic Conditions
Chakravarty, Frontiers in microbiology 2021 - “...5.1 LMOf2365_1368 Rhodanese-like domain protein 5.0 LMOf2365_2510 UDP-N-acetylglucosamine 2-epimerase 4.8 mraY LMOf2365_2069 Phospho-N-acetylmuramoyl-pentapeptide-transferase 4.7 purA LMOf2365_0065 Adenylosuccinate synthase 4.7 ald LMOf2365_1601 Alanine dehydrogenase 4.7 plcA LMOf2365_0212 1-phosphatidylinositol phosphodiesterase 4.6 menE LMOf2365_1696 O-succinylbenzoateCoA ligase 4.6 murC LMOf2365_1627 UDP-N-acetylmuramatealanine ligase 4.5 LMOf2365_2743 Hydrolase, CocE/NonD family 4.4 gpmA LMOf2365_2429...”
4m9dB / Q81JI9 The crystal structure of an adenylosuccinate synthetase from bacillus anthracis str. Ames ancestor in complex with amp.
48% identity, 99% coverage
- Ligand: adenosine monophosphate (4m9dB)
Cbei_5074 adenylosuccinate synthetase from Clostridium beijerincki NCIMB 8052
49% identity, 97% coverage
CD16_RS02965 adenylosuccinate synthase from Candidatus Liberibacter asiaticus
48% identity, 99% coverage
SYNW1773 Adenylosuccinate synthetase from Synechococcus sp. WH 8102
48% identity, 97% coverage
BCE_5617 adenylosuccinate synthetase from Bacillus cereus ATCC 10987
48% identity, 99% coverage
- A transposon mutant library of Bacillus cereus ATCC 10987 reveals novel genes required for biofilm formation and implicates motility as an important factor for pellicle-biofilm formation
Okshevsky, MicrobiologyOpen 2018 - “...assembly/bacterial chemotaxis No BCE_1780 2 1,722,347; 1,722,507 fliC Flagellin Flagellar assembly/bacterial chemotaxis No DNA replication/modification BCE_5617 1 5,204,841 purA Adenylosuccinate synthetase; adenine ribonucleotide biosynthesis Purine metabolism; alanine, aspartate and glutamate metabolism No RNA modification/transcription/regulation BCE_0875 3 901,507; 901,619; 901,882 transcription antiterminator, LytR family Transcriptional regulator No...”
BC_5468 adenylosuccinate synthase from Bacillus cereus ATCC 14579
BC5468, NP_835123 Adenylosuccinate synthetase from Bacillus cereus ATCC 14579
48% identity, 99% coverage
- Proteomic evidences for rex regulation of metabolism in toxin-producing Bacillus cereus ATCC 14579
Laouami, PloS one 2014 - “...0,04 2,4 0,081 - BC_4366 NP_834078 Cystathionine beta-lyase N N 0,151 0,447 2 0,03 AdsS BC_5468 NP_835123 Adenylosuccinate synthetase N N 1,8 0,04 1,15 0,202 - BC_3799 NP_833521 Aspartate-semialdehyde dehydrogenase N N 2,56 0,079 3,2 0,01 ThiG BC_0749 NP_830539 Thiazole synthase N N ND ND 2,2...”
- Biofilm formation displays intrinsic offensive and defensive features of Bacillus cereus
Caro-Astorga, NPJ biofilms and microbiomes 2020 - “...SinI, 27 were upregulated in biofilm-associated cells. In a previous work, the genes purA ( BC5468 ), purC ( BC0326 ), and purL ( BC0327 ), which are implicated in purine biosynthesis, were demonstrated to be indispensable for biofilm formation in B. cereus . 28 30...”
- Methionine Residues in Exoproteins and Their Recycling by Methionine Sulfoxide Reductase AB Serve as an Antioxidant Strategy in Bacillus cereus
Madeira, Frontiers in microbiology 2017 - “...Arginase 1.57 Amino sugar and nucleotide sugar NP_830056 BC0188 GlmM Phosphoglucosamine mutase 3.81 Nucleotide NP_835123 BC5468 AdSS Adenylosuccinate synthetase 2.53 Butanoate NP_831099 BC1317 PhaB Acetoacetyl-CoA reductase 2.56 Gamma Hexachlorocyclohexane degradation NP_834220 BC4511 LppC Acid phosphatase 2.34 Ubiquinone and other terpenoid-quinone NP_832068 BC2305 DhbB Isochorismatase 2.45 Toxins...”
- “...RocF Arginase 1.57 Amino sugar and nucleotide sugar NP_830056 BC0188 GlmM Phosphoglucosamine mutase 3.81 Nucleotide NP_835123 BC5468 AdSS Adenylosuccinate synthetase 2.53 Butanoate NP_831099 BC1317 PhaB Acetoacetyl-CoA reductase 2.56 Gamma Hexachlorocyclohexane degradation NP_834220 BC4511 LppC Acid phosphatase 2.34 Ubiquinone and other terpenoid-quinone NP_832068 BC2305 DhbB Isochorismatase 2.45...”
- Proteomic evidences for rex regulation of metabolism in toxin-producing Bacillus cereus ATCC 14579
Laouami, PloS one 2014 - “...2,4 0,081 - BC_4366 NP_834078 Cystathionine beta-lyase N N 0,151 0,447 2 0,03 AdsS BC_5468 NP_835123 Adenylosuccinate synthetase N N 1,8 0,04 1,15 0,202 - BC_3799 NP_833521 Aspartate-semialdehyde dehydrogenase N N 2,56 0,079 3,2 0,01 ThiG BC_0749 NP_830539 Thiazole synthase N N ND ND 2,2 0,01...”
LSA0063 Adenylosuccinate synthetase (IMP-aspartate ligase) from Lactobacillus sakei subsp. sakei 23K
49% identity, 98% coverage
- Global transcriptome response in Lactobacillus sakei during growth on ribose
McLeod, BMC microbiology 2011 - “...LSA0010 lsa0010 Putative nucleotide-binding phosphoesterase -0.6 LSA0023 lsa0023 Putative ribonucleotide reductase (NrdI-like) -0.5 D D LSA0063 purA Adenylosuccinate synthetase (IMP-aspartate ligase) -0.8 LSA0139 guaA Guanosine monophosphate synthase (glutamine amidotransferase) -0.5 -0.8 LSA0252 iunH1 Inosine-uridine preferring nucleoside hydrolase 2.6 2.6 1.8 LSA0446 pyrDB Putative dihydroorotate oxidase, catalytic...”
D9S178 Adenylosuccinate synthetase from Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)
47% identity, 100% coverage
AOV_03080 adenylosuccinate synthase from Anaplasma ovis str. Haibei
49% identity, 98% coverage
- The Anaplasma ovis genome reveals a high proportion of pseudogenes
Liu, BMC genomics 2019 - “...2502 AOV_01975 infB 702 X AOV_02035 pccB 2035 X AOV_02715 1533 AOV_02120 purA 195 X AOV_03080 1281 AOV_02180 purA 195 X AOV_02195 trxB2 228 X AOV_02205 1023 AOV_02200 trxB2 669 X AOV_02415 pepA 1158 X AOV_03525 1497 AOV_02440 pepA 540 X AOV_02835 lpdA 420 X AOV_02845...”
- “...AOV_02180] and [AOV_02195 and AOV_02200]) each for infB (AOV 02590), pepA (AOV_03525), thiE (AOV_01015) purA (AOV_03080) and trxB2 (AOV_02200). There were truncated pseudogenes for methylmalonyl-CoA carboxyltransferase (AOV_02035), sucD (AOV_00515), GTPase ObgE (AOV_03085), and dihydrolipoyl dehydrogenase (AOV_02835). There was a pseudogene (AOV_05010) for a hypothetical protein that...”
W8YC55 Adenylosuccinate synthetase from Bacillus thuringiensis DB27
48% identity, 99% coverage
LSEI_0122 adenylosuccinate synthase from Lacticaseibacillus paracasei ATCC 334
LSEI_0122 Adenylosuccinate synthase from Lactobacillus casei ATCC 334
48% identity, 98% coverage
- Regulatory Mechanisms of L-Lactic Acid and Taste Substances in Chinese Acid Rice Soup (Rice-Acid) Fermented With a Lacticaseibacillus paracasei and Kluyveromyces marxianus
Liu, Frontiers in microbiology 2021 - “...hemolysin domain (LSEI_2229) was up-regulated, whereas the transcription level of the gene encoding adenylosuccinate synthase (LSEI_0122) was down-regulated in the group of the single inoculation of L. paracasei . The genes encoding phosphoglucomutase (LSEI_0949), ribonucleoside-triphosphate reductase (LSEI_2287), and the gene (LSEI_2229) were up-regulated and the genes...”
- “...RNA polymerase subunit alpha (LSEI_2477) and DNA-directed RNA polymerase subunit beta (LSEI_2515) and the gene (LSEI_0122) were down-regulated in the group of the mixed inoculation. The comparison results of inoculation methods (single inoculation of L. paracasei and mixed inoculation) indicated that the genes LSEI_0122 and LSEI_1746...”
cg3063 adenylosuccinate synthetase from Corynebacterium glutamicum ATCC 13032
NCgl2669 adenylosuccinate synthase from Corynebacterium glutamicum ATCC 13032
47% identity, 99% coverage
PFREUD_19280 adenylosuccinate synthase from Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
49% identity, 98% coverage
SXYL_00017 adenylosuccinate synthase from Staphylococcus xylosus
46% identity, 98% coverage
- Investigating Extracellular DNA Release in Staphylococcus xylosus Biofilm In Vitro
Leroy, Microorganisms 2021 - “...Pyrimidine synthesis 8.2 * SXYL_01407 Nucleoside-diphosphate-sugar epimerase 2.1 SXYL_02117-18 nrdFE Ribonucleoside-diphosphate reductase 2.8 * Purine SXYL_00017 purA Adenylosuccinate synthetase 2.2 SXYL_01548 guaC GMP reductase 2.5 3.0 SXYL_02435 purR Pur operon repressor 2.0 CARBOHYDRATE CATABOLISM Amino sugar catabolism SXYL_00403 nanE N -acetylmannosamine-6-phosphate 2-epimerase 2.5 SXYL_00404 RpiR family...”
- Adaptation of Staphylococcus xylosus to Nutrients and Osmotic Stress in a Salted Meat Model
Vermassen, Frontiers in microbiology 2016 - “...* SXYL_01690 pyrP Uracil permease 16.2 6.3 4.1 SXYL_02420 hpt Hypoxanthine phosphoribosyltransferase 6.7 4.0 2.7 SXYL_00017 purA Adenylosuccinate synthetase 13.2 8.6 5.0 SXYL_00796 pdp Pyrimidine-nucleoside phosphorylase 2.0 2.8 2.5 SXYL_00821 upp Uracil phosphoribosyltransferase 9.6 8.2 6.1 SXYL_01689-85 pyrBC, carAB, pyrF UMP biosynthesis 7.8 * 5.0 *...”
YP_194721 adenylosuccinate synthase from Lactobacillus acidophilus NCFM
LBA_RS09205 adenylosuccinate synthase from Lactobacillus acidophilus NCFM
46% identity, 99% coverage
- Dietary Nutrients, Proteomes, and Adhesion of Probiotic Lactobacilli to Mucin and Host Epithelial Cells
Celebioglu, Microorganisms 2018 - “...Manganese-dependent inorganic pyrophosphatase YP_194000 1.5 2.1 1.5 1.5 Aspartate tRNA ligase YP_193821 2.2 Adenylosuccinate synthase YP_194721 2.3 1.5 1.5 30S Ribosomal protein S1 M YP_193850 2.3 1.8 1.7 Ribonucleoside triphosphate reductase YP_192977 2.3 Glyceraldehyde-3-p dehydrogenase M (GAPDH) YP_193579 2.4 1.9 1.6 2.0 1.5 2.0 1.6 BipAEFTU...”
- Metabolomic Analysis of Lactobacillus acidophilus, L. gasseri, L. crispatus, and Lacticaseibacillus rhamnosus Strains in the Presence of Pomegranate Extract
Chamberlain, Frontiers in microbiology 2022 - “...cyclohydrolase (purH; LBA_RS07600), and phosphoribosylamine-glycine ligase (purD; LBA_RS07595). The third locus includes adenylosuccinate synthase (purA; LBA_RS09205) and adenylosuccinate lyase (purB; LBA_RS09200), while the fourth locus consists of an adenine phosphoribosyltransferase (aprT; LBA_RS06175) in its own operon. Genes purS, purQ, purF, purH , and purA are not...”
FTN_0178 adenylosuccinate synthetase from Francisella tularensis subsp. novicida U112
46% identity, 99% coverage
- Macrophage replication screen identifies a novel Francisella hydroperoxide resistance protein involved in virulence
Llewellyn, PloS one 2011 - “..., [89] , [108] FTN_0177 FTT0203c purH bifunctional purine biosynthesis protein [50] , [112] [29] FTN_0178 FTT0204 purA adenylosuccinate synthetase [112] , [113] [29] , [113] FTN_0419 FTT0893 purM Phosphoribosylaminoimidazol (AIR) synthetase [50] , [112] FTN_0422 FTT0896 purE phosphoribosylaminoimidazole carboxylase,catalyic subunit [50] [114] FTN_0430 FTT0904 lpnB...”
- Exploitation of host cell biology and evasion of immunity by francisella tularensis
Asare, Frontiers in microbiology 2010 - “...synthase beta-chain FTN_0113 ribC Riboflavin synthase alpha chain FTN_0125 ackA Propionate kinase 2/acetate kinase A FTN_0178 purA Adenylosuccinate synthetase FTN_0199 cyoE Heme O synthase FTN_0211 pcp Pyrrolidone carboxylate peptidase FTN_0218 nfnB Dihydropteridine reductase FTN_0319 Amino acidpolyamineorganocation family protein FTN_0343 Aminotransferase FTN_0358 tRNA-methylthiotransferase MiaB protein FTN_0420 SAICAR...”
- Working toward the future: insights into Francisella tularensis pathogenesis and vaccine development
Pechous, Microbiology and molecular biology reviews : MMBR 2009 - “...membrane protein AICAR transformylase/IMP cyclohydrolase FTN_0178 FTN_0196 FTN_0197 FTN_0198 FTN_0199 FTN_0202 FTN_0205 FTN_0208 FTN_0210 FTN_0211 FTN_0217...”
- “...Challenge route (dose, CFU) None (wild type) FTN_1645 FTN_0178 FTN_1700 6 F. tularensis subsp. holarctica Challenge strain VOL. 73, 2009 VACCINES FOR...”
alr4784 adenylosuccinate synthetase from Nostoc sp. PCC 7120
48% identity, 93% coverage
SSU05_1966 Adenylosuccinate synthase from Streptococcus suis 05ZYH33
46% identity, 97% coverage
DIP2063 Adenylosuccinate synthetase from Corynebacterium diphtheriae NCTC 13129
46% identity, 98% coverage
GOZ73_RS11610 adenylosuccinate synthase from Akkermansia muciniphila
44% identity, 98% coverage
LOC409299 adenylosuccinate synthetase from Apis mellifera
44% identity, 94% coverage
Q10R17 Adenylosuccinate synthetase 1, chloroplastic from Oryza sativa subsp. japonica
47% identity, 85% coverage
- Proteomic response of hybrid wild rice to cold stress at the seedling stage
Wang, PloS one 2018 - “...expressed 0.55 P49210 60S ribosomal protein L9 0.51 Q6K5R5 40S ribosomal protein S27 0.38 Others Q10R17 Adenylosuccinate synthetase 1, chloroplastic 2.42 A0A0P0V9F2 Cysteine proteinase inhibitor (Fragment) 2.28 Q8LMR0 Phosphoserine aminotransferase 1.69 Q5N8G1 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic 1.64 Q6ERX1 Probable cinnamyl alcohol dehydrogenase 8A 1.56 Q69U53 MAP3K-like...”
LOC100193051 uncharacterized protein LOC100193051 from Zea mays
46% identity, 85% coverage
A8IW34 Adenylosuccinate synthetase, chloroplastic from Chlamydomonas reinhardtii
47% identity, 90% coverage
NP_001105386 adenylosuccinate synthetase, chloroplastic precursor from Zea mays
46% identity, 86% coverage
A2XD35 Adenylosuccinate synthetase, chloroplastic from Oryza sativa subsp. indica
46% identity, 86% coverage
C0PFA1 Adenylosuccinate synthetase, chloroplastic from Zea mays
46% identity, 86% coverage
Q851S8 Adenylosuccinate synthetase 2, chloroplastic from Oryza sativa subsp. japonica
46% identity, 85% coverage
PURA_SCHPO / Q02787 Adenylosuccinate synthetase; AMPSase; AdSS; IMP--aspartate ligase; EC 6.3.4.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
ade2 / RF|NP_594664.1 adenylosuccinate synthetase Ade2; EC 6.3.4.4 from Schizosaccharomyces pombe (see 2 papers)
SPAC144.03 adenylosuccinate synthetase Ade2 from Schizosaccharomyces pombe
44% identity, 97% coverage
- function: Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer. - CharProtDB Source (per GeneDB): GeneDB_Spombe
- A genome-wide screen of genes involved in cadmium tolerance in Schizosaccharomyces pombe
Kennedy, Toxicological sciences : an official journal of the Society of Toxicology 2008 - “...mph1 SPBC106.01 MPS1/YDL028C ade2 tsc1 bag102 SPAC144.03 SPAC22F3.13 SPAC9.02c SPBC530.03c ADE12/YNL220W None YDR071C SNL1/YIL016W ubp14 SPAC20H4.09 SPBC6B1.06c...”
XP_004249273 adenylosuccinate synthetase, chloroplastic from Solanum lycopersicum
46% identity, 82% coverage
MMCAP2_0766 adenylosuccinate synthase from Mycoplasma mycoides subsp. capri str. GM12
42% identity, 99% coverage
- Disruption of the S41 peptidase gene in mycoplasma mycoides capri impacts proteome profile, H(2)O(2) production, and sensitivity to heat shock
Allam, PloS one 2012 - “...GI:256384171 MMCAP2_0128 Hypothetical protein 99% Decrease 602 GI:256384387 MMCAP2_0061 SerinetRNA ligase 100% Increase 962 GI:256383734 MMCAP2_0766 Adenylosuccinate synthase 100% Decrease 1001 GI:256383985 MMCAP2_0606 Phosphoglycerate kinase 100% Decrease 123 GI:256383953 MMCAP2_0480 Hypothetical protein 100% Decrease 517 GI:108795342 N/A TetM [ E. coli ] 100% Increase The spot...”
- “...Dec 0.6570.040 0.0030.002 MMCAP2_0628 Putrescine carbamoyltransferase Inc 1.5230.045 <0.0011.15E05 MMCAP2_0765 Adenylosuccinate lyase Dec 0.5600.044 0.0020.002 MMCAP2_0766 Adenylosuccinate synthetase Dec 0.4500.036 00 MMCAP2_0786 Ornithine carbamoyltransferase Dec 0.5170.031 00 Metabolism: Other Amino Acids MMCAP2_0059 Alanine dehydrogenase Dec 0.6800.020 <0.0015.77E06 Metabolism: Carbohydrate MMCAP2_0036 D-lactate dehydrogenase Dec 0.6100.036 00 MMCAP2_0131...”
D8U1I3 Adenylosuccinate synthetase, chloroplastic from Volvox carteri f. nagariensis
47% identity, 87% coverage
1dj3A / O24396 Structures of adenylosuccinate synthetase from triticum aestivum and arabidopsis thaliana (see paper)
45% identity, 97% coverage
- Ligand: guanosine-5'-diphosphate (1dj3A)
PURA_WHEAT / O24396 Adenylosuccinate synthetase, chloroplastic; AMPSase; AdSS; IMP--aspartate ligase; EC 6.3.4.4 from Triticum aestivum (Wheat) (see paper)
45% identity, 88% coverage
- function: Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP (By similarity).
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer. - A complete ferredoxin/thioredoxin system regulates fundamental processes in amyloplasts
Balmer, Proceedings of the National Academy of Sciences of the United States of America 2006 - “...O04866, Q6YVI0, Q9LEU8, Q9SZ30, P43283, Q6YZH8, Q6VMN8, O24396, P36183, O48959, Q7X9K7, Q9C9C4, Q7XMP6, P12782, Q7XTJ3, Q9FPB6, Q94CN9, P12299, P55238, Q76E42,...”
Cj1498c adenylosuccinate synthetase from Campylobacter jejuni subsp. jejuni NCTC 11168
44% identity, 99% coverage
- In vivo and in silico determination of essential genes of Campylobacter jejuni
Metris, BMC genomics 2011 - “...cj1202, cj1213c, cj1238, cj1243, cj1248, cj1364c, cj1398, cj1400c, cj1401c, cj1402c, cj1404, cj1407c, cj1424c, cj1428c, cj1476c, cj1498c, cj1515c, cj1529c, cj1530, cj1605c, cj1634c, cj1641, cj1645, cj1672c, cj1685c FBA & transposon mutagenesis of this study cj0027, cj0116, cj0117, cj0324, cj0387, cj0394c, cj0442, cj0514, cj0516, cj0581, cj0597, cj0639c, cj0641, cj0686,...”
- Identification of Campylobacter jejuni genes contributing to acid adaptation by transcriptional profiling and genome-wide mutagenesis
Reid, Applied and environmental microbiology 2008 - “...(0.99) Purine biosynthesis and nucleoside salvage Cj0340 Cj1498c (purA) Putative nucleoside hydrolase Adenylosuccinate synthase 8 (1,008), 798 (1,251), Y...”
CJJ81176_1490 adenylosuccinate synthetase from Campylobacter jejuni subsp. jejuni 81-176
Q5HST3 Adenylosuccinate synthetase from Campylobacter jejuni (strain RM1221)
44% identity, 99% coverage
TGME49_279450 adenylosuccinate synthetase, putative from Toxoplasma gondii ME49
44% identity, 91% coverage
- Asexual expansion of Toxoplasma gondii merozoites is distinct from tachyzoites and entails expression of non-overlapping gene families to attach, invade, and replicate within feline enterocytes
Hehl, BMC genomics 2015 - “...Interestingly, expression of two genes involved in purine metabolism, adenylosuccinate synthetase, (a.k.a., IMP-aspartate ligase , TGME49_279450), and hypoxanthine-xanthine-guanine phosphoribosyl transferase ( HXGPRT , TGME49_200320) is>8-fold higher in merozoites. The latter, a key enzyme in the purine salvage pathway [ 17 ], is expressed at a very...”
PURA / Q96529 adenylosuccinate synthetase monomer (EC 6.3.4.4) from Arabidopsis thaliana (see 3 papers)
PURA_ARATH / Q96529 Adenylosuccinate synthetase, chloroplastic; AMPSase; AdSS; IMP--aspartate ligase; EC 6.3.4.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT3G57610 ADSS (ADENYLOSUCCINATE SYNTHASE); adenylosuccinate synthase from Arabidopsis thaliana
45% identity, 85% coverage
- function: Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer. - Proteome and Interactome Linked to Metabolism, Genetic Information Processing, and Abiotic Stress in Gametophytes of Two Woodferns
Ojosnegros, International journal of molecular sciences 2023 - “...0 Nucleotides 2121-1366_3_ORF2 Q9SF85 ADK1 ADENOSINE KINASE 1 39.2 14 3 4 0 Nucleotides 59309-329_5_ORF1 Q96529 PURA ADENYLOSUCCINATE SYNTHETASE 57.9 2 1 1 0 Nucleotides 152024-193_3_ORF2 Q9S726 RPI3 PROBABLE RIBOSE-5-PHOSPHATE ISOMERASE 3 36.1 2 0 2 5.33 10 120 Nucleotides 27769-479_3_ORF1 P55228 ADG1 GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL...”
- Gel-based proteomic map of Arabidopsis thaliana root plastids and mitochondria
Grabsztunowicz, BMC plant biology 2020 - “...Q42553, At3g02780 Protein strictosidine synthase-like 12 82 P94111, At1g74020 NUCLEIC ACID RELATED Adenylosuccinate synthetase 5658 Q96529, At3g57610 Carbamoyl-phosphate synthase small chain 52 Q9LVW7, At3g27740 Dihydropyrimidine dehydrogenase 56, 64, 65 Q9LVI9, At3g17810 Soluble inorganic pyrophosphatase 6 88 Q9LXC9, At5g09650 NITROGEN METABOLISM Ferredoxin-nitrite reductase 45, 51, 52 Q39161,...”
- Profiling of advanced glycation end products uncovers abiotic stress-specific target proteins in Arabidopsis
Chaplin, Journal of experimental botany 2019 - “...AT2G30950 1.68 OASB P47999 AT2G43750 1.59 PRK P25697 AT1G32060 0.937 PRXQ Q9LU86 AT3G26060 1.77 PURA Q96529 AT3G57610 1.24 RAN3 Q8H156 AT5G55190 2.27 Rosette age Name ID TAIR ID 4 weeks/6 weeks A2 Q8W4H7 AT1G07930 1.92 CAT2 P25819 AT4G35090 2.47 CICDH Q9SRZ6 AT1G65930 1.8 CTIMC P48491 AT3G55440...”
- Label-Free Quantitative Proteomics Reveal the Involvement of PRT6 in Arabidopsis thaliana Seed Responsiveness to Ethylene
Wang, International journal of molecular sciences 2022 - “...beta 1.77 AT3G03270 Adenine nucleotide alpha hydrolases-like superfamily protein 7.91 AT1G74260 Purine biosynthesis 4 1.61 AT3G57610 Adenylosuccinate synthase (purine synthesis) 1.50 AT2G45300 RNA 3-terminal phosphate cyclase/enolpyruvate transferase%2C alpha/beta 1.80 AT3G52150 RNA-binding (RRM/RBD/RNP motifs) family protein 1.37 AT3G19130 RNA-binding protein 47B 1.86 AT5G63420 RNA-metabolising metallo-beta-lactamase family protein...”
- BRS1 mediates plant redox regulation and cold responses
Zhang, BMC plant biology 2021 - “...protein Biological process Expression Fold 1 AT3G08590 2,3-Biphosphoglycerate-independent phosphoglycerate mutase 2 Carbohydrate metabolism 1.18 2 AT3G57610 Adenylosuccinate synthetase AMP biosynthesis 0.87 3 AT3G54050 Chloroplastic fructose 1,6-bisphosphate phosphatase Fructose metabolism 0.88 4 AT2G39730 Rubisco activase Light activation of rubisco 1.21 5 AT5G15650 UDP-arabinose mutase Arabinose metabolism 0.68...”
- Gel-based proteomic map of Arabidopsis thaliana root plastids and mitochondria
Grabsztunowicz, BMC plant biology 2020 - “...At3g02780 Protein strictosidine synthase-like 12 82 P94111, At1g74020 NUCLEIC ACID RELATED Adenylosuccinate synthetase 5658 Q96529, At3g57610 Carbamoyl-phosphate synthase small chain 52 Q9LVW7, At3g27740 Dihydropyrimidine dehydrogenase 56, 64, 65 Q9LVI9, At3g17810 Soluble inorganic pyrophosphatase 6 88 Q9LXC9, At5g09650 NITROGEN METABOLISM Ferredoxin-nitrite reductase 45, 51, 52 Q39161, At2g15620...”
- “...purines, pyrimidines and folates [ 68 ]. It is worth noting that also adenylosuccinate synthase (At3g57610) was detected in our analysis (Table 1 ). It catalyzes the first step in the de novo synthesis of adenosine monophosphate (AMP) [ 72 ], which as a purine nucleotide...”
- Redox Conformation-Specific Protein-Protein Interactions of the 2-Cysteine Peroxiredoxin in Arabidopsis
Liebthal, Antioxidants (Basel, Switzerland) 2020 - “...Elongation factor 1 alpha (AT4G20360) TRAF-like family protein (AT3G28220) HTPA reductase 1 (AT2G44040) Adenylosuccinate synthetase (AT3G57610) CDPME kinase (AT2G26930) Ferredoxin--NADP reductase (AT1G20020) 50S ribosomal protein L27 (AT5G40950) Allene oxide synthase (AT5G42650) 50S ribosomal protein L29 (AT1G79850) Protein MET1 (AT1G55480) 50S ribosomal protein L5 (AT4G01310) AT5g64380/MSJ1_22 (AT5G64380)...”
- Profiling of advanced glycation end products uncovers abiotic stress-specific target proteins in Arabidopsis
Chaplin, Journal of experimental botany 2019 - “...1.68 OASB P47999 AT2G43750 1.59 PRK P25697 AT1G32060 0.937 PRXQ Q9LU86 AT3G26060 1.77 PURA Q96529 AT3G57610 1.24 RAN3 Q8H156 AT5G55190 2.27 Rosette age Name ID TAIR ID 4 weeks/6 weeks A2 Q8W4H7 AT1G07930 1.92 CAT2 P25819 AT4G35090 2.47 CICDH Q9SRZ6 AT1G65930 1.8 CTIMC P48491 AT3G55440 2.36...”
- Unravelling Protein-Protein Interaction Networks Linked to Aliphatic and Indole Glucosinolate Biosynthetic Pathways in Arabidopsis
Nintemann, Frontiers in plant science 2017 - “...Plastid 5 0 1 6 At3G56240 Copper chaperone (CCH) 13.0 Cytosol 4 2 2 8 At3G57610 Adenylosuccinate synthase (ADSS) 53.0 Plastid 3 0 3 6 At3G58730 Vacuolar ATP synthase subunit D (VATPD) 29.1 Vacuole membrane 0 0 5 5 At3G61440 Cysteine synthase C1 (CYSC1) 39.9 Mitochondrion...”
- DYn-2 Based Identification of Arabidopsis Sulfenomes
Akter, Molecular & cellular proteomics : MCP 2015 - “...AT4G33030 AT2G35040 AT1G74030 AT3G48730 AT4G18440 AT3G57610 AT5G17530 AT5G16440 AT3G23940 AT4G26300 AT1G29900 AT1G22410 AT5G16290 AT3G53580 AT2G29690 AT2G22250...”
- Comparative transcriptome analysis reveals carbohydrate and lipid metabolism blocks in Brassica napus L. male sterility induced by the chemical hybridization agent monosulfuron ester sodium
Li, BMC genomics 2015 - “...dehydrogenase family protein ( At1g14810 ), isopropylmalate dehydrogenase 2 ( At1g80560 ), adenylosuccinate synthase ( At3g57610 ), transketolase family protein ( At2g34590 ), and pyruvate kinase family protein ( At3g22960 ). Most of these genes are expressed in the plastid (six genes) or mitochondrion (three genes)...”
- More
1dj2A / Q96529 Structures of adenylosuccinate synthetase from triticum aestivum and arabidopsis thaliana (see paper)
45% identity, 97% coverage
- Ligand: guanosine-5'-diphosphate (1dj2A)
PVX_114710 adenylosuccinate synthetase, putative from Plasmodium vivax
43% identity, 97% coverage
jhp0239 ADENYLOSUCCINATE SYNTHETASE from Helicobacter pylori J99
45% identity, 98% coverage
PGN_1504 adenylosuccinate synthetase from Porphyromonas gingivalis ATCC 33277
46% identity, 99% coverage
- The Porphyromonas gingivalis ferric uptake regulator orthologue binds hemin and regulates hemin-responsive biofilm development
Butler, PloS one 2014 - “...PGN_1502- ErmF -Fwd AGAATGGATCGAAAAGATAA CCGATAGCTTCCGCTATTGC Term- ErmF -Rev GTCTTTCGACTGAGCCTTTCGTT TTAGCATCTAATTTAACTTCAATTCC Term- Prom-region -Fwd GCTCAGTCGAAAGACTGGGCCTTTCGTTTTA CGGAGTGAAAAAGGAGCCG PGN_1504- Prom-region -Rev CAATGTTATATGTCTGTGTTA TCTCTCTTTTACATCATATTTTCC Prom-region- PGN_1504 -Fwd AATATGATGTAAAAGAGAGA TAACACAGACATATAACATTGATCC PGN_1504-Rev GCAGATATTTTGTAGCCTCCATC Construction of har complement PGN_1502-Fwd ATGTCGCCTTCCGAGGCTAT CepA- Har -Rev ACTTTCCTTAACTCTTTTGACGTC TTATTTTTTCTTCTTGGGAGCGGCT Har- CepA -Fwd AGCCGCTCCCAAGAAGAAAAAATAA GACGTCAAAAGAGTTAAGGAAAGT ErmF- CepA -Rev...”
- “...region that drives the operon containing PGN_1503, followed by the first 614 bp of the PGN_1504 gene. The truncated PGN_1502 and PGN_1504 genes were used as the sites of homologous recombination with the P. gingivalis ATCC 33277 chromosome and would result in replacement of PGN_1503 with...”
- Regulon controlled by the GppX hybrid two component system in Porphyromonas gingivalis
Hirano, Molecular oral microbiology 2013 - “...PGN_1061 hypothetical protein 0.68 0.02 PGN_0331 hypothetical protein 0.67 0.04 PGN_0770 hypothetical protein 0.67 0.00 PGN_1504 adenylosuccinate synthetase 0.66 0.05 PGN_1461 putative spore maturation protein A/B 0.66 0.02 PGN_1493 hypothetical protein 0.65 0.03 PGN_0683 TonB-linked receptor Tlr 0.65 0.04 PGN_0677 putative multi antimicrobial extrusion protein MatE...”
XP_960187 adenylosuccinate synthetase from Neurospora crassa OR74A
43% identity, 98% coverage
9f17A / P56137 Crystal structure of n term his-tag adenylosuccinate synthetase from helicobacter pylori (see paper)
44% identity, 98% coverage
- Ligands: calcium ion; guanosine-5'-diphosphate; inosinic acid (9f17A)
HP0255 adenylosuccinate synthetase (purA) from Helicobacter pylori 26695
P56137 Adenylosuccinate synthetase from Helicobacter pylori (strain ATCC 700392 / 26695)
44% identity, 98% coverage
- Location Is Everything: Influence of His-Tag Fusion Site on Properties of Adenylosuccinate Synthetase from Helicobacter pylori
Mišković, International journal of molecular sciences 2024 - “...His 6 -tag on N-terminus was created by the PCR reaction: a fragment of the hp0255 gene ( purA the gene encoding the AdSS protein, GenBank ID: AAD07324.1) was amplified using a pair of primers with additional flanking regions for NdeI and XhoI restriction sites on...”
- Molecular Characterization and Clinical Description of Non-Polio Enteroviruses Detected in Stool Samples from HIV-Positive and HIV-Negative Adults in Ghana
Di, Viruses 2020 - “...GI HP0216 pos m 43 851 - NA - - - EV-C113 Enterovirus C - HP0255 pos f 26 455 - NA - - - EV-C113 Enterovirus C - HP0274 pos f 43 539 + NA + - - CVA20 Enterovirus C AdV HP0297 pos f...”
- Helicobacter pylori relies primarily on the purine salvage pathway for purine nucleotide biosynthesis
Liechti, Journal of bacteriology 2012 - “...HPG27_810 (HP0854) HPG27_810 (HP0854) HPG27_234 (HP0255) HPG27_1054 (HP1112) HPG27_1163 (HP1218) HPG27_531 (HP0572) HPG27_531 (HP0572) HPG27_691 (HP0735)...”
- New implications on genomic adaptation derived from the Helicobacter pylori genome comparison
Lara-Ramírez, PloS one 2011 - “...nucleotide. H. pylori core genome also contains the gene guaA (HP0409) and guaB (HP0829), purA (HP0255) and purB (HP1112), all of which are related to purine metabolism. However, the yeast two-hybrid tests showed that HP0854 interacts with another core protein HP0377, thiol-disulfide interchange protein (DsbC) [60]...”
- The HP0256 gene product is involved in motility and cell envelope architecture of Helicobacter pylori
Douillard, BMC microbiology 2010 - “...were designed for the amplification of a 216 bp fragment containing the 3' end of HP0255 and the 5' end of HP0256. Oligonucleotides ML028FP/ML023RP (Table 4 ) were designed for the amplification of a 245 bp fragment at the 5' end of HP0256. ML027RP and ML028FP...”
- Expanded metabolic reconstruction of Helicobacter pylori (iIT341 GSM/GPR): an in silico genome-scale characterization of single- and double-deletion mutants
Thiele, Journal of bacteriology 2005 - “...3 HP0112 HP0121 HP0191 to HP0193 HP0197 HP0212 HP0215 HP0255 HP0293 HP0329 HP0360 HP0372 HP0380 HP0381 HP0389 HP0476 HP0509 HP0512 HP0588 to HP0591 fucA ppsA...”
- Growth phase-dependent response of Helicobacter pylori to iron starvation
Merrell, Infection and immunity 2003 - “...invA 0.3 0.3 Purine ribonucleotide biosynthesis HP0255 JHP0239 Adenylosuccinate synthetase, purA 0.5 0.4 Transcription #HP0550 JHP0497 Transcription termination...”
- Acid-adaptive genes of Helicobacter pylori
Wen, Infection and immunity 2003 - “...0.60 0.93 0.26 0.35 0.32 0.35 0.47 0.21 HP1545 HP0255 HP0919 HP1011 HP0956 Description Type II restriction enzyme R protein (hsdR) Type II restriction enzyme M...”
- More
- Outer Membrane Vesicles Secreted by Helicobacter pylori Transmitting Gastric Pathogenic Virulence Factors
Wei, ACS omega 2022 - “...P56104 adk 371 O25293 ychF 372 O25595 alr 373 P56737 trpD 374 O26103 pdxA 375 P56137 purA 376 P56452 alaS 377 P94842 ybgC 378 O24885 gmd 379 O24864 CheV 380 P56184 prs 381 O25475 secA 382 O25477 HP_0788 383 O24973 OmpR 384 O26096 metN 385 P56157...”
- “...P56004 efp 224 P56032 rplD 225 O25452 HP_0757 226 P56455 hisS 227 O25508 HP_0837 228 P56137 purA 229 O25036 Omp8 230 O25925 mreB 231 O25594 YckK 232 P56459 aspS 233 O24949 HP_0137 234 O25999 HP_1463 235 P56018 rpsK 236 O25820 Dld 237 P56029 rplA 238 O25255...”
- In the quest for new targets for pathogen eradication: the adenylosuccinate synthetase from the bacterium Helicobacter pylori
Bubić, Journal of enzyme inhibition and medicinal chemistry 2018 - “...this article we present the biochemical and kinetic characterisation of H. pylori AdSS (UniProt ID: P56137), along with its inhibition by a potent AdSS inhibitor, hadacidin, and the reaction product, adenylosuccinate. Materials and methods Materials Substrates for AdSS: L-aspartic acid monosodium salt monohydrate (Asp), inosine 5-monophosphate...”
CNAG_02858 adenylosuccinate synthetase from Cryptococcus neoformans var. grubii H99
42% identity, 98% coverage
- Amoeba Predation of Cryptococcus neoformans Results in Pleiotropic Changes to Traits Associated with Virulence
Fu, mBio 2021 - “...SNPs were also identified in A2 and A3 isolates, resulting in a missense mutation in CNAG_02858, which encodes adenylsuccinate synthetase. Another SNP in the A2 isolate was found in an intergenic region, a site with a high fraction of ambiguous calls. Isolates A4 to A6 had...”
- “...6 68953 C A Intron variant CNAG_01101 Hypothetical protein A1 5 1208219 T C R478G CNAG_02858 Adenylsuccinate synthetase A2, A3 3 594765 A G I346V Intergenic region A2 13 592173 C T CNAG_03622 Cell polarity A4, A5, A6 2 363200 CA C Frameshift at N150 CNAG_01506...”
- A Fungal Arrestin Protein Contributes to Cell Cycle Progression and Pathogenesis
Telzrow, mBio 2019 - “...0.0 CNAG_03249 THO complex, subunit 4 3.3 0.0 CNAG_00649 Tryptophan synthase, beta subunit 3.3 0.0 CNAG_02858 ADE12 Adenylosuccinate synthetase 3.0 0.0 CNAG_01189 DNA-directed RNA polymerase I, subunit RPA1 3.0 0.0 CNAG_02545 Inorganic pyrophosphatase 3.0 0.0 CNAG_04976 Zuotin 3.0 0.0 CNAG_04951 3-Deoxy-7-phosphoheptulonate synthase 2.7 0.0 CNAG_02500 Calnexin...”
- Purine Acquisition and Synthesis by Human Fungal Pathogens
Chitty, Microorganisms 2017 - “...synthesis has been carried out for four enzymes in C. neoformans : adenylosuccinate synthetase (ADSS) (CNAG_02858, ADE12 ), adenylosuccinate lyase (ADSL) (CNAG_03270, ADE13 ), inosine monophosphate dehydrogenase (IMPDH) (CNAG_00441, IMD1 ) and guanine monophosphate synthase (GMP synthase) (CNAG_01877, GUA1 ) [ 108 , 109 , 113...”
- Capsule growth in Cryptococcus neoformans is coordinated with cell cycle progression
García-Rodas, mBio 2014 - “...1.8 CNAG_02813 1062 Aminotransferase 1.79 CNAG_02853 860 Malate synthase 1.7 CNAG_05653 1149 Adenylsuccinate synthase 1.68 CNAG_02858 2227 Phosphogluconate dehydrogenase 1.67 CNAG_07561 598 Heat shock protein 1.59 CNAG_05199 915 UTP-glucose-1-phosphate uridyltransferase 1.51 CNAG_02748 1133 Methione adenosyltransferase 1.52 CNAG_00418 584 Heat shock protein 70 1.55 CNAG_01727 532 Heat...”
- Purification, crystallization and preliminary X-ray analysis of adenylosuccinate synthetase from the fungal pathogen Cryptococcus neoformans
Blundell, Acta crystallographica. Section F, Structural biology and crystallization communications 2013 - “...APRT-encoding gene (strain H99; CNAG_02858, Broad Institute of MIT and Harvard; http://www.broadinstitute.org/...”
- “...gene ADE12 (strain H99; CNAG_02858, Broad Institute of MIT and Harvard; http://www.broadinstitute.org/annotation/genome/ cryptococcus_neoformans/MultiHome.html)...”
5i34A / J9VI09 Adenylosuccinate synthetase from cryptococcus neoformans complexed with gdp and imp (see paper)
42% identity, 98% coverage
- Ligands: guanosine-5'-diphosphate; inosinic acid (5i34A)
BRE_423 adenylosuccinate synthase from Borrelia recurrentis A1
39% identity, 99% coverage
- The genome of Borrelia recurrentis, the agent of deadly louse-borne relapsing fever, is a degraded subset of tick-borne Borrelia duttonii
Lescot, PLoS genetics 2008 - “...were similarly found in these relapsing fever borreliae, including adenylosuccinate synthase ( purA , BDU_419, BRE_423), adenylosuccinate lyase ( purB , BDU_420, BRE_424), and hypoxanthine phosphoribosyltransferase ( hpt , BDU_422, BRE_425). They were located between the 16S and 23S ribosomal DNA. Other genes unique to the...”
PHATRDRAFT_26256 adenylosuccinate synthetase from Phaeodactylum tricornutum CCAP 1055/1
43% identity, 79% coverage
- Examination of metabolic responses to phosphorus limitation via proteomic analyses in the marine diatom Phaeodactylum tricornutum
Feng, Scientific reports 2015 - “...the proteins related to nucleotide biosynthesis were downregulated, such as carbamate kinase (PHATRDRAFT_24238), adenylosuccinate synthetase (PHATRDRAFT_26256) and putative phosphoribosyl aminoimidazole carboxylase (PHATRDRAFT_56626). Carbamate kinase (CKase) is a member of transferases, transferring phosphorus-containing groups with a carboxyl group as an acceptor, which is involved in purine metabolism...”
- “...involved in arginine and proline metabolism, glutamate synthase (NADPH/NADH) small chain (PHATRDRAFT_20342) and adenylosuccinate synthase (PHATRDRAFT_26256) involved in alanine, aspartate and glutamate metabolism, and enoyl-CoA hydratase (PHATRDRAFT_55192) involved in tryptophan metabolism. Among these, downregulation of glutamate synthase would cause a reduction of glutamate which plays an...”
BDU_419 adenylosuccinate synthase from Borrelia duttonii Ly
39% identity, 99% coverage
- The genome of Borrelia recurrentis, the agent of deadly louse-borne relapsing fever, is a degraded subset of tick-borne Borrelia duttonii
Lescot, PLoS genetics 2008 - “...salvage were similarly found in these relapsing fever borreliae, including adenylosuccinate synthase ( purA , BDU_419, BRE_423), adenylosuccinate lyase ( purB , BDU_420, BRE_424), and hypoxanthine phosphoribosyltransferase ( hpt , BDU_422, BRE_425). They were located between the 16S and 23S ribosomal DNA. Other genes unique to...”
PURA_YEAST / P80210 Adenylosuccinate synthetase; AMPSase; AS-synthetase; AdSS; IMP--aspartate ligase; EC 6.3.4.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 5 papers)
ade12 / CAA88590.1 adenylosuccinate synthetase from Saccharomyces cerevisiae (see paper)
NP_014179, YNL220W Ade12p from Saccharomyces cerevisiae
NP_014179 adenylosuccinate synthase from Saccharomyces cerevisiae S288C
42% identity, 97% coverage
- function: Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer. - Response mechanism of Saccharomyces cerevisiae under benzoic acid stress in ethanol fermentation
Xiu-Feng, Scientific reports 2024 - “...carboxylase catalyzes de novo purine nucleotide biosynthesis YMR120C ADE17 2.67 Purine biosynthesis de novo enzymes YNL220W ADE12 1.04 Catalyze the synthesis of adenosine monophosphate from inosine 5 monophosphate during purine nucleotide biosynthesis YMR300C ADE4 3.29 Aminophosphoribose transferase YLR359W ADE13 2.08 Catalyze de novo purine nucleotide biosynthesis...”
- Selection markers for transformation of the sequenced reference monokaryon Okayama 7/#130 and homokaryon AmutBmut of Coprinopsis cinerea
Dörnte, Fungal biology and biotechnology 2020 - “...CC1G_08365T0 Chr_7:2,467,1632,464,958 FAICAR to IMP IMP cyclohydrolase IMP to SAMP Adenylosuccinate synthase PurA, NP_418598 Ade12, NP_014179 CC1G_10072T0 Chr_2:407,487405,875 SAMP to AMP Adenylosuccinate lyase BifunctionalPurB, THI73349 Bifunctional Ade13, NP_013463 CC1G_08733T0, bifunctional Ade5 Chr_10:936,450934,462 GTP to DHNTP GTP cyclohydrolase FolE, NP_416658 Fol2, P51601 CC1G_14672T0 Chr_5:2,160,8322,161,846 DHNTP and PABA...”
- Identification of the Genetic Requirements for Zinc Tolerance and Toxicity in Saccharomyces cerevisiae
Zhao, G3 (Bethesda, Md.) 2020 - “...Metabolism (11) YDR127W a ARO1 YHR106W TRR2 YNL129W NRK1 YPR060C ARO7 YGL234W ADE5,7 YJL216C IMA5 YNL220W ADE12 YDL133W b SRF1 YHR004C NEM1 YLR425W TUS1 YPL268W PLC1 Cell cycle and DNA processing (18) YAL015C NTG1 YDL047W SIT4 YJL092W SRS2 YNL271C BNI1 YAL020C ATS1 YDL101C DUN1 YJL208C NUC1...”
- Genome-scale metabolic reconstruction of the non-model yeast Issatchenkia orientalis SD108 and its application to organic acids production
Suthers, Metabolic engineering communications 2020 - “...be non-essential in I.orientalis . For four of these (i.e., JL09_g5079 (YKL001C; adenylyl-sulfate kinase), JL09_g4689 (YNL220W; adenylosuccinate synthase), JL09_g4696 (YOR303W; carbamoyl-phosphate synthase (glutamine-hydrolyzing)), and JL09_g5138 (YNR050C; saccharopine dehydrogenase (NADP, l -glutamate forming)) involved with the synthesis of methionine, adenine, arginine and lysine, respectively, two nearly identical...”
- Yeast to Study Human Purine Metabolism Diseases
Daignan-Fornier, Cells 2019 - “...ORF Name Enzymatic Activities Aah1 YNL141W Adenine deaminase Ade1 YAR015W Phosphoribosyl aminoimidazole succinocarboxamide synthetase Ade12 YNL220W Adenylosuccinate synthase Ade13 YLR359W Adenylosuccinate lyase Ade16 YLR028C AICAR transformylase and IMP cyclohydrolase Ade17 YMR120C AICAR transformylase and IMP cyclohydrolase Ade2 YOR128C Phosphoribosylaminoimidazole carboxylase Ade4 YMR300C Phosphoribosylpyrophosphate amidotransferase Ade5,7 YGL234W...”
- Transcriptional profiling reveals molecular basis and novel genetic targets for improved resistance to multiple fermentation inhibitors in Saccharomyces cerevisiae
Chen, Biotechnology for biofuels 2016 - “...YDR135C, YDR214W, YDR502C, YER043C, YER070W, YFL045C, YGR209C, YGR281W, YKR080W, YLR043C, YLR180W, YLR231C, YMR120C, YMR300C, YNL112W, YNL220W, YOL086C, YOR128C, YOR153W, YOR184W, YOR328W, YPL036W, YPL058C YCR021C , YDR502C, YGR043C, YGR256W, YKL151C, YLR249W, YMR105C, YOR128C, YPL036W YBL022C, YCR021C , YDL055C, YDR011W, YDR135C, YDR214W, YDR502C, YEL039C, YER043C, YFL037W, YGR043C, YGR209C,...”
- “...process (GO:0055086) YCR021C, YDR135C, YDR529C, YEL021W, YEL024W, YEL041W, YER036C, YER037W, YJR078W, YJR103W, YKL073W, YMR145C, YNL088W, YNL220W, YOL059W, YOL081W, YOL086C, YOR204W, YPL036W, YPR181C Since the exhibition of complex genetic responses of S. cerevisiae to the environment was largely due to the transcription factors (TFs) that control the...”
- A Whole Genome Screen for Minisatellite Stability Genes in Stationary-Phase Yeast Cells
Alver, G3 (Bethesda, Md.) 2013 - “...a YBR236C ERG10 a YPL028w ORC2 a YBR060c RRS1 a YOR294w TOF1 b YNL273w ADE12 YNL220W FAL1 a YDR021w ORC3 a YLL004w RSP5 a YER125w TSC11 a YER093c APC11 a YDL008W GAS2 YLR343w PAC10 YGR078c SAC1 YKL212w UPS2 YLR168c ARL1 YBR164c HBT1 YDL223c PDS1 a YDR113c...”
- Regulation of amino acid, nucleotide, and phosphate metabolism in Saccharomyces cerevisiae
Ljungdahl, Genetics 2012 - “...Activity in ADP synthesis ADE12 ADE13 ADK1 YNL220W YLR359W YDR226W Adenylosuccinate synthase Adenylosuccinate lyase Adenylate kinase Andreichuk Iu et al. (1995)...”
- More
- [Genetic control of metabolism of mutagenic purine base analogs 6-hydroxylaminopurine and 2-amino-6-hydroxylaminopurine in yeast Saccharomyces cerevisiae].
Stepchenkova, Genetika 2009 - GeneRIF: genes ADE12, ADE13, AAH1, and HAM1 controlling processes of purine utilization and interconversion in yeast make the greatest contribution to the system of protection against the toxic and mutagenic action of the examined analogs.
PURA1_HUMAN / Q8N142 Adenylosuccinate synthetase isozyme 1; AMPSase 1; AdSS 1; Adenylosuccinate synthetase, basic isozyme; Adenylosuccinate synthetase, muscle isozyme; M-type adenylosuccinate synthetase; Adenylosuccinate synthetase-like 1; AdSSL1; IMP--aspartate ligase 1; EC 6.3.4.4 from Homo sapiens (Human) (see 2 papers)
Q8N142 adenylosuccinate synthase (EC 6.3.4.4) from Homo sapiens (see paper)
NP_689541 adenylosuccinate synthetase isozyme 1 isoform 2 from Homo sapiens
44% identity, 92% coverage
- function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer. - Proteome-Wide Genetic Investigation of Large Artery Stiffness.
Dib, JACC. Basic to translational science 2024 - “...human disease although invitro was identified as a potential pathway of interest in cancer therapeutics Q8N142 ADSS1 Adenylosuccinate synthetase isozyme-1 Enzyme that catalyzes the first step in the conversion of IMP to AMP to regulate nucleotide levels; in rodents with cardiac hypertrophy, this gene is up-regulated;...”
- Plasma Proteomic Risk Markers of Incident Type 2 Diabetes Reflect Physiologically Distinct Components of Glucose-Insulin Homeostasis.
Cronjé, Diabetes 2023 - Role of Antizyme Inhibitor Proteins in Cancers and Beyond.
Tulluri, OncoTargets and therapy 2021 - “...Canalicular multi-specific organic anion transporter 1 Q92887 [ 107 ] ADSSL1 Adenylosuccinate synthetase isozyme 1 Q8N142 [ 107 ] ARNTL Aryl hydrocarbon receptor nuclear translocator-like protein 1 O00327 [ 120 ] CDKN2A Cyclin-dependent kinase inhibitor 2A P42771 [ 112 ] ELAVL1 ELAV-like protein 1-A Q1JQ73 [...”
- Acute sleep loss results in tissue-specific alterations in genome-wide DNA methylation state and metabolic fuel utilization in humans
Cedernaes, Science advances 2018 - “...0.017 Q5T7C4; Q5T7C6; P09429 High mobility group protein B1 ( HMGB1 ) 0.19 0.23 0.019 Q8N142; Q8N142-2 Adenylosuccinate synthetase isozyme 1 ( ADSSL1 ) 0.14 0.20 0.022 P61586; Q5JR08; P08134 Transforming protein RhoA; Rho-related guanosine 5-triphosphatebinding protein RhoC ( RHOA ; RHOC ) 0.17 0.22 0.024...”
- Levels of human proteins in plasma associated with acute paediatric malaria.
Reuterswärd, Malaria journal 2018 - “...HPA039704 Motor protein MYL3 P08590 Myosin light chain 3 3E 18 HPA016564 Purine biosynthesis ADSSL1 Q8N142 Adenylosuccinate synthase like 1 4E 55 HPA052621 T-cell response CD80 P33681 CD80 molecule 7E 24 HPA039851 Information about the 27 selected proteins (number of UniProt IDs) grouped on primary biological...”
- Application of Large-Scale Aptamer-Based Proteomic Profiling to Planned Myocardial Infarctions.
Jacob, Circulation 2018 - “...Target Protein Name Median Fold Change P TNNI P19429 troponin I, cardiac 66.7 5.93E-16 ADSSL1 Q8N142 adenylosuccinate synthase like 1 15.3 1.73E-12 CKB, CKM P12277, P06732 creatine kinase M-type: B-type heterodimer 10 1.80E-13 FABP3 P05413 fatty acid binding protein 3, muscle and heart 8.3 3.69E-11 CSRP3...”
- “...P 10 min vs. Baseline 1 h vs. Baseline 24 h vs. Baseline P ADSSL1 Q8N142 adenylosuccinate synthase like 1 437.6 1407.2 108.1 8.64E-10 473.2 1952.1 122.2 2.81E-09 ARHGAP1 Q07960 Rho GTPase activating protein 1 49.9 48 5.1 2.24E-07 49.2 51.1 1.7 1.02E-10 ATP5J P18859 ATP...”
- Multiplexed, Quantitative Workflow for Sensitive Biomarker Discovery in Plasma Yields Novel Candidates for Early Myocardial Injury.
Keshishian, Molecular & cellular proteomics : MCP 2015 - Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria.
Bachmann, PLoS pathogens 2014 - “...candidates with SOTA clusters (random array). Cluster Protein Uniprot Gene description Antibodies Malaria increased ADSSL1 Q8N142 adenylosuccinate synthase like 1 HPA052621 CCDC102A Q96A19 coiled-coil domain containing 102A HPA040598 EEF2 P13639 eukaryotic translation elongation factor 2 HPA040534 FAM71F2 Q6NXP2 family with sequence similarity 71, member F2 HPA052240...”
- More
- ADSSL1 myopathy is the most common nemaline myopathy in Japan with variable clinical features.
Saito, Neurology 2020 (PubMed)- GeneRIF: ADSSL1 myopathy is the most common nemaline myopathy in Japan with variable clinical features.
- Distal myopathy with ADSSL1 mutations in Korean patients.
Park, Neuromuscular disorders : NMD 2017 (PubMed)- GeneRIF: Study investigated the clinical manifestation in Korean patients with ADSSL1 mutations. Patients with ADSSL1 mutations demonstrated distal muscle weakness in adolescence, followed by quadriceps muscle weakness in the early 30s. All patients had mild facial weakness and two patients complained of easy fatigue while eating and chewing. Muscle biopsies and whole body muscle MR imaging findings are discussed.
- ADSSL1 mutation relevant to autosomal recessive adolescent onset distal myopathy.
Park, Annals of neurology 2016 (PubMed)- GeneRIF: Mutations in ADSSL1 are the novel genetic cause of autosomal recessive adolescent onset distal myopathy.
- Molecular cloning and characterization of a novel muscle adenylosuccinate synthetase, AdSSL1, from human bone marrow stromal cells.
Sun, Molecular and cellular biochemistry 2005 (PubMed)- GeneRIF: A novel muscle isozyme of adenylosuccinate synthetase, human AdSSL1, is identified from human bone marrow stromal cells.
2dgnA / P28650 Mouse muscle adenylosuccinate synthetase partially ligated complex with gtp, 2'-deoxy-imp (see paper)
43% identity, 97% coverage
- Ligands: magnesium ion; 9-(2-deoxy-5-o-phosphono-beta-d-erythro-pentofuranosyl)-6-(phosphonooxy)-9h-purine; guanosine-5'-diphosphate (2dgnA)
PURA1_PIG / A4Z6H0 Adenylosuccinate synthetase isozyme 1; AMPSase 1; AdSS 1; Adenylosuccinate synthetase, basic isozyme; Adenylosuccinate synthetase, muscle isozyme; M-type adenylosuccinate synthetase; IMP--aspartate ligase 1; EC 6.3.4.4 from Sus scrofa (Pig) (see paper)
44% identity, 92% coverage
- function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer. - Proteins from toad's parotoid macroglands: do they play a role in gland functioning and chemical defence?
Kowalski, Frontiers in zoology 2023 - “...secretion, intracellular signal transduction, angiogenesis, endothelial cell migration, inflammatory response 2, 3, 6, 7, 10 A4Z6H0 43 50,343 2 3 Adenylosuccinate synthetase isozyme 1 AMP biosynthesis 7 Q5R8Y6 42 76,640 3 1 Transmembrane 9 superfamily member 2 Channel or small molecule transporter 8 Q6P6V1 41 69,685...”
- Naturally Produced Lovastatin Modifies the Histology and Proteome Profile of Goat Skeletal Muscle.
Leo, Animals : an open access journal from MDPI 2019 - “...and a half LIM domains protein 1 2.5 3.55 K0J107 Malate dehydrogenase, mitochondrial 2.47 3.06 A4Z6H0 Adenylosuccinate synthetase isozyme 1 2.21 2.8 P13707 Glycerol-3-phosphate dehydrogenase [NAD( + )], cytoplasmic 2.11 2.36 Medium vs. High Q96DG6 Carboxymethylenebutenolidase homolog 3.53 5.82 Q5S1S4 Carbonic anhydrase 3 3.09 3.63 Q00872...”
PURA_DROME / Q9Y0Y2 Adenylosuccinate synthetase; AMPSase; AdSS; IMP--aspartate ligase; EC 6.3.4.4 from Drosophila melanogaster (Fruit fly) (see paper)
42% identity, 94% coverage
- function: Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP (By similarity). Plays a role in the regulation of adult life span.
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer.
disruption phenotype: Mutant flies show life span extension and increased activity. Heterozygous mutants show increased ratios of AMP:ATP (3 to 4-fold) and ADP:ATP (2-fold), also observed in response to caloric restriction, and associated with life span extension phenotypes in yeast and worms.
PURA1_MOUSE / P28650 Adenylosuccinate synthetase isozyme 1; AMPSase 1; AdSS 1; Adenylosuccinate synthetase like 1; Adenylosuccinate synthetase, basic isozyme; Adenylosuccinate synthetase, muscle isozyme; M-type adenylosuccinate synthetase; IMP--aspartate ligase 1; EC 6.3.4.4 from Mus musculus (Mouse) (see 2 papers)
NP_031447 adenylosuccinate synthetase isozyme 1 from Mus musculus
43% identity, 92% coverage
- function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) Note=Binds 1 Mg(2+) ion per subunit
subunit: Homodimer. - Adenylosuccinate synthetase 1 gene is a novel target of deletion in lung adenocarcinoma.
Miller, Molecular carcinogenesis 2009 (PubMed)- GeneRIF: Deletion of Adenylosuccinate synthetase 1 gene is associated with lung adenocarcinoma.
- Cavitation as a mechanism of substrate discrimination by adenylosuccinate synthetases.
Iancu, Biochemistry 2006 - GeneRIF: The absence of the 2'-hydroxyl group of the deoxyribonucleotide destabilizes binding of the ligand to the L-aspartate pocket of adenylosuccinate synthetase by disrupting hydrogen bonds and by introducing a cavity into the fully ligated active site.
- Variations in the response of mouse isozymes of adenylosuccinate synthetase to inhibitors of physiological relevance.
Borza, The Journal of biological chemistry 2003 (PubMed)- GeneRIF: there are antagonistic interactions between the active sites of the basic isozyme of adenylosuccinate synthetase
- IMP, GTP, and 6-phosphoryl-IMP complexes of recombinant mouse muscle adenylosuccinate synthetase.
Iancu, The Journal of biological chemistry 2002 (PubMed)- GeneRIF: Crystalline complexes presented of the recombinant basic isozyme from mouse
- The adenylosuccinate synthetase-1 gene is activated in the hypertrophied heart.
Wen, Journal of cellular and molecular medicine - GeneRIF: Adss1 functions as an important component in adenine nucleotide biosynthesis. It is up-regulated in surgically induced cardiomegaly.
- Physiological and Biochemical Effects of Intrinsically High and Low Exercise Capacities Through Multiomics Approaches.
Tung, Frontiers in physiology 2019 - “...0.01918 Putative uncharacterized protein Q3TX47 Q3TX47 2.18 0.79 0 0 0.03254 Adenylosuccinate synthetase isozyme 1 P28650 PURA1 2.37 0.46 0 0 0.00222 Adenylosuccinate synthetase isozyme 1 J3QN31 J3QN31 2.37 0.46 0 0 0.00222 Glucose-6-phosphate isomerase P06745 G6PI 10.88 2.67 3.96 0.42 0.04274 Putative uncharacterized protein Q3U6X6...”
- Label-Free Neuroproteomics of the Hippocampal-Accumbal Circuit Reveals Deficits in Neurotransmitter and Neuropeptide Signaling in Mice Lacking Ethanol-Sensitive Adenosine Transporter.
Oliveros, Journal of proteome research 2017 - “...degradation 1.46 4.0 10 3 Q99L13 HIBADH 3-hydroxyisobutyrate dehydrogenase -ala degradation 1.48 6.6 10 6 P28650 ADSSL1 adenylosuccinate synthase like 1 purine synthesis 1.81 7.1 10 7 Q920P5 AK5 adenylate kinase 5 purine synthesis 1.57 4.4 10 5 Q8R5H6 WASF1 Wiskott-Aldrich syndrome protein 1 actin nucleation...”
- Quantitative proteomic analysis reveals metabolic alterations, calcium dysregulation, and increased expression of extracellular matrix proteins in laminin α2 chain-deficient muscle
de, Molecular & cellular proteomics : MCP 2014 - “...Q8R429 Q9QZ47 P13707 P47857 O08532 P13412 P17751 P20801 P28650 P09411 Q9D0F9 O09165 P16858 Q9R0Y5 P62631 P52480 P56392 Q9JK37 Q6P8J7 Q60932 P06745 Q91YE8 A2ASS6...”
- “...Q6P8J7 P20801 Q9DCT2 P05977 Q91VD9 Q9WUM5 P48962 P05201 P28650 P62897 P05064 P11404 P54071 Q8BMS1 Q9CZU6 P08249 Q9QZ47 Q3TJD7 P12787 Q9CQ62 Q60936 P97807 Q9DCW4...”
- Proteomic analysis of murine bone marrow niche microenvironment identifies thioredoxin as a novel agent for radioprotection and for enhancing donor cell reconstitution.
An, Experimental hematology 2013 - “...Cp, Io, Op Ras-related protein Rab-7a P51150 0 Ga, Cp, Es, Io Adenylosuccinate synthetase isozyme P28650 0 Cp, Mb Fatty acid synthase P19096 0 Ga, Cp, Io, Nu Plasma Kallikrein P26262 0 Cp, Ec Keratin, type I Q6IFX2 0 Cp, Cs, Io, Op Gene Ontology Abbreviations:...”
- Proteomic studies of nitrated alpha-synuclein microglia regulation by CD4+CD25+ T cells.
Reynolds, Journal of proteome research 2009 - “...0.05 Phosphoglycerate kinase 1 P09411 IPI00555069 44540 8.02 Cytoplasm enzyme 3 1.63 0.0065 Adenylosuccinate synthase P28650 IPI00123190 50254 8.57 Cytoplasm/Membrane enzyme 2 -1.74 Cathepsin B precursor P10605 IPI00113517 37280 5.57 Lysosome thiol protease 7 1.6 0.022 Cathepsin D precursor P18242 IPI00111013 44954 6.71 Lysosome acid protease...”
CPAR2_803640 uncharacterized protein from Candida parapsilosis
41% identity, 98% coverage
PURA1_DANRE / Q6NSN5 Adenylosuccinate synthetase isozyme 1; AMPSase 1; AdSS 1; Adenylosuccinate synthetase, basic isozyme; Adenylosuccinate synthetase, muscle isozyme; M-type adenylosuccinate synthetase; IMP--aspartate ligase 1; EC 6.3.4.4 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
44% identity, 92% coverage
- function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer.
disruption phenotype: Morpholino knockdown of the protein in embryos results in severe disruption of muscle fibers.
PF3D7_1354500, XP_001350257 adenylosuccinate synthetase from Plasmodium falciparum 3D7
41% identity, 96% coverage
PURA_PLAFA / Q9U8D3 Adenylosuccinate synthetase; AMPSase; AdSS; IMP--aspartate ligase; EC 6.3.4.4 from Plasmodium falciparum (see 3 papers)
Q9U8D3 adenylosuccinate synthase (EC 6.3.4.4) from Plasmodium falciparum (see 3 papers)
41% identity, 96% coverage
- function: Plays an important role in the salvage pathway for purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP (By similarity).
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer.
1p9bA / Q9U8D3 Structure of fully ligated adenylosuccinate synthetase from plasmodium falciparum (see paper)
41% identity, 98% coverage
- Ligands: magnesium ion; 6-o-phosphoryl inosine monophosphate; hadacidin; guanosine-5'-diphosphate (1p9bA)
AFUA_1G15450 adenylosuccinate synthetase AdB from Aspergillus fumigatus Af293
43% identity, 97% coverage
PURA2_PIG / A4Z6H1 Adenylosuccinate synthetase isozyme 2; AMPSase 2; AdSS 2; Adenylosuccinate synthetase, acidic isozyme; Adenylosuccinate synthetase, liver isozyme; L-type adenylosuccinate synthetase; IMP--aspartate ligase 2; EC 6.3.4.4 from Sus scrofa (Pig) (see paper)
43% identity, 92% coverage
- function: Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer.
D4AEP0 Adenylosuccinate synthetase isozyme 2 from Rattus norvegicus
43% identity, 92% coverage
- Effects of Erythrodiol on the Antioxidant Response and Proteome of HepG2 Cells.
Peñas-Fuentes, Antioxidants (Basel, Switzerland) 2021 - “...1 96.233 5,377,500,000 16 D4ADZ9 Pus7 Pseudouridine synthase 7 5.5004 5.8 3 74.64 59,883,000 17 D4AEP0 Adss Adenylosuccinate synthetase isozyme 2 12.613 17.8 5 50.085 206,830,000 18 F1LPD6 Acaa1b 3-ketoacyl-CoA thiolase A, peroxisomal 5.6309 7.2 3 44.524 123,980,000 19 F1LVV4 Rcc2 Regulator of chromosome condensation 2...”
J3QN31 Adenylosuccinate synthetase isozyme 1 from Mus musculus
41% identity, 88% coverage
BBOV_II004950 putative adenylosuccinate synthetase from Babesia bovis T2Bo
41% identity, 97% coverage
- Morphological and Molecular Descriptors of the Developmental Cycle of Babesia divergens Parasites in Human Erythrocytes
Rossouw, PLoS neglected tropical diseases 2015 - “...protease -1.680191261 BBOV_III009930 Ubiquinol cytochrome c reductase -1.800386366 BBOV_IV001730 Ubiquitin carboxyl-terminal hydrolase -2.434145021 Cellular process BBOV_II004950 Adenylosuccinate synthase -2.103832513 BBOV_II005700 Ca2+ transporting ATPase -2.00987223 BBOV_IV008310 Ethanolamine kinase -2.348186354 BBOV_IV005830 F0F1-type ATP synthase 2.061846648 BBOV_IV010920 GTPase Ran/TC4/GSP1 0.966482698 BBOV_III008970 Membrane coat complex retromer -3.015783812 BBOV_IV005570 Metallopeptidase -2.564704469...”
PURA2_MOUSE / P46664 Adenylosuccinate synthetase isozyme 2; AMPSase 2; AdSS 2; Adenylosuccinate synthetase, acidic isozyme; Adenylosuccinate synthetase, liver isozyme; L-type adenylosuccinate synthetase; IMP--aspartate ligase 2; EC 6.3.4.4 from Mus musculus (Mouse) (see paper)
43% identity, 92% coverage
- function: Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer. - Quantitative proteomic analysis after neuroprotective MyD88 inhibition in the retinal degeneration 10 mouse
Carmy-Bennun, Journal of cellular and molecular medicine 2021 - “...Rps7 1.804698 Q3TEA8 Heterochromatin protein 1binding protein 3 Hp1bp3 1.640806 O35486 Gammacrystallin S Crygs 1.587322 P46664 Adenylosuccinate synthetase isozyme 2 Adss 1.4961 A2RTH4 Crystallin, gamma E Cryge 1.393776 Q3TVV6 Heterogeneous nuclear ribonucleoprotein U Hnrnpu 1.349486 P23927 Alphacrystallin B chain Cryab 1.346436 F6W687 Nonhistone chromosomal protein HMG17...”
- The ubiquitin ligase Cullin5SOCS2 regulates NDR1/STK38 stability and NF-κB transactivation
Paul, Scientific reports 2017 - “...Neuroguidin Ngdn 2.196 0.594 5 35.658 Q5SWU9 Acetyl-CoA carboxylase 1 Acaca 3.318 0.593 26 265.25 P46664 Adenylosuccinate synthetase isozyme 2 Adss 3.358 0.591 25 50.02 Q6WKZ8 E3 ubiquitin-protein ligase UBR2 Ubr2 2.034 0.586 18 199.2...”
- Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
Ayyar, Journal of proteomics 2017 - “...Haao 3-hydroxyanthranilate oxygenase Biosynthesis of NAD + UP/DOWN P63259 Actg Actin, cytoplasmic Cell motility UP P46664 Adss2 Adenylosuccinate synthetase isozyme 2 De novo and salvage pathways of purine nucleotide biosynthesis UP Q0D2L3 Agmat Agmatinase, mitochondrial Putrescine biosynthesis via agmatine pathway UP Q8VHE9 Retsat All-trans-retinol 13,14-reductase Retinol...”
- Proteomic Expression Changes in Large Cerebral Arteries After Experimental Subarachnoid Hemorrhage in Rat Are Regulated by the MEK-ERK1/2 Pathway.
Müller, Journal of molecular neuroscience : MN 2017 - “...[ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial 2.26 Q5U2R0 Methionine adenosyltransferase 2 subunit beta 2.24 P46664 Adenylosuccinate synthetase isozyme 2 2.21 P0C5W1 Microtubule-associated protein 1S 2.19 Q9WTT6 Guanine deaminase 2.17 O55125 Protein NipSnap homolog 1 2.17 Q6MG49 Large proline-rich protein BAG6 2.16 P04692 Tropomyosin alpha-1 chain...”
- Ankrd2/ARPP is a novel Akt2 specific substrate and regulates myogenic differentiation upon cellular exposure to H(2)O(2)
Cenni, Molecular biology of the cell 2011 - “...Q9JIF9 MYOTI 55.316 8.85 m/l motif Component of a complex of actin cross-linkers 8 4955 P46664 PURA2 50.021 5.85 m/l motif Purine nucleotide biosynthesis enzyme 9 3640 Q9WV06 ANKRD2 39.858 6.1 RVRKTS98L Structural and gene regulatory protein Q9JLH8 TMOD4 39.261 4.72 m/l motif Actin capping protein...”
- Anterior segment alterations and comparative aqueous humor proteomics in the buphthalmic rabbit (an American Ophthalmological Society thesis).
Edward, Transactions of the American Ophthalmological Society 2011 - Use of microarray technology to assess the time course of liver stress response after confinement exposure in gilthead sea bream (Sparus aurata L.).
Calduch-Giner, BMC genomics 2010 - “...sequence receptor subunit P45433 1E-101 Protein folding/ER -1.27, 1.87, 1.01, -3.03 Adenylosuccinate synthetase isozyme 2 P46664 8E-16 Nucleotide biosynthesis -1.03, -1.64, -1.57, -1.64 Nicotinamide riboside kinase 2 Q9NPI5 1E-73 Nucleotide biosynthesis -1.30, 1.03, 1.03, -2.78 Liver-specific uridine phosphorylase Q8CGR7 1E-84 Nucleotide catabolism 1.51, -1.09, -1.72, 2.22...”
P30520 Adenylosuccinate synthetase isozyme 2 from Homo sapiens
NP_001117 adenylosuccinate synthetase isozyme 2 isoform 1 from Homo sapiens
43% identity, 92% coverage
- Proteomics of Serum Samples for the Exploration of the Pathological Mechanism of Obstetric Antiphospholipid Syndrome.
Zhang, Journal of proteome research 2024 - “...(Annexin-3) (inositol 1,2-cyclic phosphate 2-phosphohydrolase) (lipocortin III) (placental anticoagulant protein III) (PAP-III) 17.22 1.2110 14 P30520 ADSS2 adenylosuccinate synthetase isozyme 2 (AMPSase 2) (AdSS 2) (EC 6.3.4.4) (adenylosuccinate synthetase, acidic isozyme) (adenylosuccinate synthetase, liver isozyme) (L-type adenylosuccinate synthetase) (IMP-aspartate ligase 2) 19.07 2.2910 16 P60033 CD81...”
- Effects of Physiological and Pathological Urea Concentrations on Human Microvascular Endothelial Cells
Colombo, International journal of molecular sciences 2022 - “...0.000000000000022 O94760 N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 45.754 0.000000000000091 A0A024R3X4 Epididymis secretory sperm binding protein 30.065 0.000000000046539 P30520 Adenylosuccinate synthetase isozyme 2 26.540 0.000000000936884 A0A024R3V7 NIF3-like protein 1 14.996 0.000009726416165 A0A024RB75 Citrate synthase 14.257 0.000000573618455 P12273 Prolactin-inducible protein 14.216 0.000000591547361 P55786 Puromycin-sensitive aminopeptidase 14.108 0.000000641574461 Q549N0 Cofilin 2...”
- Integrated Metabolomics and Network Pharmacology Study on Immunoregulation Mechanisms of Panax ginseng through Macrophages.
Hao, Evidence-based complementary and alternative medicine : eCAM 2019 - “...detoxification 0.029 0.34 P09211, P28161 Go Term (Cellular Component) cytosol 0.003 0.086 P11217, P09211, P28161, P30520, P09488, P47712 cytoplasm 0.024 0.3 P11217, P09211, P28161, P30520, P09488, P47712 extracellular exosome 0.079 0.56 P11217, P09211, P28161, P30520 Go Term (molecular function) glutathione binding 8.1E-06 0.00033 P09211, P28161, P09488...”
- Systematic Analysis of Cell-Type Differences in the Epithelial Secretome Reveals Insights into the Pathogenesis of Respiratory Syncytial Virus-Induced Lower Respiratory Tract Infections.
Zhao, Journal of immunology (Baltimore, Md. : 1950) 2017 - “...O75390 CS 4 P48163 ME1 4 O75223 GGCT 5 O95490 LPHN2 3 P50479 PDLIM4 3 P30520 ADSS 4 P07384 CAPN1 4 Q92841 DDX17 5 Q00888 PSG4 3 P82979 SARNP 3 Q9NQ88 TIGAR 4 P35222 CTNNB1 4 Q92499 DDX1 5 Q9HB40 SCPEP1 3 P27144 AK4 3 Q9H2U2...”
- Pleiotropic effects of 4-hydroxynonenal on oxidative burst and phagocytosis in neutrophils
Chacko, Redox biology 2016 - “...Table 5 No Protein name Accession Peptides % Coverage 1 Adenylosuccinate syn thetase isozyme 2 P30520 2 20.18 2 Cytochrome b-245 heavy chain P04839 2 18.60 3 Nicotinamide phosphoribosyltransferase P43490 2 29.53 4 Nicotinate phosphoribosyltransferase Q6XQN6 3 16.73 5 Rab GDP dissociation inhibitor beta P50395 9...”
- High throughput proteomic analysis and a comparative review identify the nuclear chaperone, Nucleophosmin among the common set of proteins modulated in Chikungunya virus infection.
Abraham, Journal of proteomics 2015 - “...ENO1 P06733 ; Eno1 P17182 Energy production and metabolism 2 Adenylsuccinate synthetase isozyme 2 ADSS P30520 Purine nucleotide biosynthesis 3 Annexin V ANXA5 P08758 Anticoagulant protein 4 ATP citrate synthase ACLY P53396 , Acly Q91V92 Energy production and metabolism (lipid synthesis) 5 DEAD box polypeptide 17...”
- Peripheral blood mononuclear cell proteome changes in patients with myelodysplastic syndrome.
Pecankova, BioMed research international 2015 - “...inhibitor P30740 8 0.0114 2.0 14 Alpha-enolase P06733 4 0.000782 2.0 Adenylosuccinate synthetase isozyme 2 P30520 5 Rab GDP dissociation inhibitor beta P50395 3 C-terminal-binding protein 1 Q13363 2 15 Annexin A7 P20073 3 0.00019 2.0 Adenosylhomocysteinase P23526 3 Proliferation-associated protein 2G4 Q9UQ80 1 16 Actin,...”
- “...GDP dissociation inhibitor beta P50395 13 0.0000838 1.5 Alpha-enolase P06733 6 Adenylosuccinate synthetase isozyme 2 P30520 5 Beta-centractin P42025 3 59 Tubulin alpha-1C chain Q9BQE3 5 0.0393 1.5 Tubulin alpha-1A chain Q71U36 5 Tubulin alpha-4A chain P68366 4 60 Alpha-enolase P06733 7 0.0459 1.5 Phosphoglycerate kinase...”
- Down-regulation of Ras-related protein Rab 5C-dependent endocytosis and glycolysis in cisplatin-resistant ovarian cancer cell lines.
Jin, Molecular & cellular proteomics : MCP 2014 - More
- Effect of a new non-cleavable substrate analog on wild-type and serine mutants in the signature sequence of adenylosuccinate lyase of Bacillus subtilis and Homo sapiens.
Sivendran, Protein science : a publication of the Protein Society 2008 - GeneRIF: Kinetic data reveal that human Ser(289) and B. subtilis Ser(262) and Ser(263) are essential for catalysis, while the ability of these Ser mutants to bind APBADP suggests that they do not contribute to substrate affinity
- An association study of ADSS gene polymorphisms with schizophrenia.
Zhang, Behavioral and brain functions : BBF 2008 - GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- Association analyses of the interaction between the ADSS and ATM genes with schizophrenia in a Chinese population.
Zhang, BMC medical genetics 2008 - GeneRIF: These findings suggest that the combined effects of the polymorphisms in the ADSS and ATM genes may confer susceptibility to the development of schizophrenia in a Chinese population
- GeneRIF: Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
CCM_06768 adenylosuccinate synthetase from Cordyceps militaris CM01
40% identity, 97% coverage
- Core microbes in <i>Cordyceps militaris</i> sclerotia and their nitrogen metabolism-related ecological functions
Luo, Microbiology spectrum 2024 - “...to glutamine) were upregulated in the NH 4 or NO 3 vs peptone medium. Third, CCM_06768 [which converts hypoxanthine nucleotide (IMP) to adenylosuccinate] and CCM_04436 ( cns1 ), CCM_04437 ( cns2 ), CCM_04438 ( cns3 ), and CCM_00622 (which facilitate cordycepin synthesis) were upregulated in the...”
- Transcriptome Analysis Reveals the Flexibility of Cordycepin Network in Cordyceps militaris Activated by L-Alanine Addition
Chen, Frontiers in microbiology 2020 - “...involved because it is a bypass pathway of adenine formation. The transcriptional level of DEG CCM_06768, which was annotated as denylosuccinate synthase (EC 6.3.4.4) and could transform IMP into adenylosuccinate, was significantly up-regulated (CMsI: 102.4, CMsII: 315.3, 1.6-fold). For its downstream reaction, the gene CCM_05789 (the...”
- “...involved in the cordycepin pathway by offering the precursor IMP. Adenylosuccinate synthase (EC 6.3.4.4) gene CCM_06768 could transform IMP into adenylosuccinate, and then the adenylosuccinate lyase (EC 4.3.2.2) gene CCM_05789 will perform the reaction of producing AMP. CCM_06768 was significantly up-regulated while CCM_05789 was not, but...”
- Genome-wide transcriptome and proteome analysis on different developmental stages of Cordyceps militaris
Yin, PloS one 2012 - “...CCM_07752 52.93 82.38 0.64 4.3.2.2 Adenylosuccinate lyase CCM_05789 339.7 157.22 1.11 Up 6.3.4.4 Adenylosuccinate synthase CCM_06768 72.39 17.13 2.08 Up CCM_07353 5.3 94.77 4.16 Down Semi-quantitative RT-PCR and Quantitative RT-PCR 2 g total RNA extracted from each sample was used for cDNA synthesis by ImProm-II Reverse...”
- “...The results showed 18 genes were in accordance with the transcriptome data except CCM_05761, CCM_02831, CCM_06768 and CCM_07353 ( Figure 5B ). CCM_05761 and CCM_02831 were up expressed in fruiting body while CCM_07353 was only detected in mycelium (Not shown in the figure). CCM_06768 showed no...”
2v40A / P30520 Human adenylosuccinate synthetase isozyme 2 in complex with gdp
42% identity, 98% coverage
- Ligand: guanosine-5'-diphosphate (2v40A)
6jrqA / Q5SLS1 Crystal structure of adenylosuccinate synthetase, pura, from thermus thermophilus
41% identity, 97% coverage
- Ligand: inosinic acid (6jrqA)
SO1258 adenylosuccinate synthetase, putative from Shewanella oneidensis MR-1
38% identity, 98% coverage
YP_009000992 2-aminooxy adenylosuccinate synthetase from Pithovirus sibericum
37% identity, 93% coverage
- The Viral Fraction Metatranscriptomes of Lake Baikal
Potapov, Microorganisms 2022 - “...tree with the sequence of RVP3 Node_835 (2406 nt), which is similar to adenylosuccinate synthetase (YP_009000992), showed inclusion in the cluster, which may again indicate the affiliation of this sequence with the virus ( Figure 4 ). In the samples, according to blastX analysis (RefSeq database),...”
- “...the RefSeq database. Pithovirus sibericum Protein Accession e-value Glycosyltransferase YP_009000961 3.1 10 21 Adenylosuccinate synthetase YP_009000992 4.2 10 79 DNA-binding ferritin-like protein YP_009001267 1.8 10 17 ABC2 type transporter superfamily protein YP_009001225 1.2 10 17 PDZ serine protease YP_009001035 2.9 10 9 pv_324 YP_009001226 3.0 10...”
CSP5_0246 adenylosuccinate synthase from Cuniculiplasma divulgatum
38% identity, 97% coverage
- Proteome Cold-Shock Response in the Extremely Acidophilic Archaeon, Cuniculiplasma divulgatum
Bargiela, Microorganisms 2020 - “...(CSP5_1108, 1.64-fold), S-methyl-5-thioadenosine phosphorylase (CSP5_0442, 1.19-fold), chlorohydrolase (CSP5_1765, 1.16-fold), phosphoribosylaminoimidazole-succinocarboxamide synthase (CSP5_1136, 1.14), adenylosuccinate synthetase (CSP5_0246, 1.37), NUDIX family hydrolase (CSP5_0459, 1.21-fold) and nucleoside diphosphate kinase (CSP5_1342, 1.36). Coenzyme transport and metabolism category overexpressed proteins under cold conditions exceeded those from same category under optimal growth...”
VDA_001041 adenylosuccinate synthetase from Photobacterium damselae subsp. damselae CIP 102761
37% identity, 99% coverage
CCM_07353, XP_006672557 adenylosuccinate synthetase from Cordyceps militaris CM01
37% identity, 74% coverage
- Insight into cordycepin biosynthesis of Cordyceps militaris: Comparison between a liquid surface culture and a submerged culture through transcriptomic analysis
Suparmin, PloS one 2017 - “...militaris mutant that produced less cordycepin than wild-type C . militaris , and adenylosuccinate synthetase (CCM_07353, XP_006672557) was downregulated by 3-fold in the mutant compared with the wild-type [ 40 ]. An accumulation of SAICAR by upregulation of SAICAR synthase (DN11023_c1_g1) might trigger activation of the...”
- “...mutant that produced less cordycepin than wild-type C . militaris , and adenylosuccinate synthetase (CCM_07353, XP_006672557) was downregulated by 3-fold in the mutant compared with the wild-type [ 40 ]. An accumulation of SAICAR by upregulation of SAICAR synthase (DN11023_c1_g1) might trigger activation of the genes...”
- Genome-wide transcriptome and proteome analysis on different developmental stages of Cordyceps militaris
Yin, PloS one 2012 - “...Adenylosuccinate lyase CCM_05789 339.7 157.22 1.11 Up 6.3.4.4 Adenylosuccinate synthase CCM_06768 72.39 17.13 2.08 Up CCM_07353 5.3 94.77 4.16 Down Semi-quantitative RT-PCR and Quantitative RT-PCR 2 g total RNA extracted from each sample was used for cDNA synthesis by ImProm-II Reverse Transcriptase (Promega). The specific primers...”
- “...AMP deaminase, and adenylosuccinate lyase. Only a purine nucleoside phosphorylase (CCM_04505) and an adenylosuccinate synthase (CCM_07353) were up expressed in fruiting body. To validate the data, 22 genes in the pathway were randomly selected to perform qRT-PCR. The results showed 18 genes were in accordance with...”
YP_009329210 2-aminooxy adenylosuccinate synthetase from Cedratvirus A11
36% identity, 91% coverage
- The Viral Fraction Metatranscriptomes of Lake Baikal
Potapov, Microorganisms 2022 - “...YP_009328950 1.7 10 99 DNA-directed RNA polymerase subunit RPB2 YP_009329295 2.4 10 14 Adenylosuccinate synthetase YP_009329210 7.8 10 14 dTDPD-glucose 4,6-dehydratase YP_009329097 4.2 10 11 ABC2 type transporter superfamily protein YP_009329403 3.2 10 26 NAD dependent epimerase/dehydratase YP_009329336 9.8 10 19 Translation elongation factor EF-1 subunit...”
TK1002 adenylosuccinate synthase from Thermococcus kodakaraensis KOD1
33% identity, 97% coverage
- An archaeal histone is required for transformation of Thermococcus kodakarensis
Čuboňováa, Journal of bacteriology 2012 - “...TK1893 TK0835 TK0204 TK0203 TK1895 TK0010 TK2147 TK1002 TK1287 TK2138 TK1737 TK0766 TK1605 TK1961 TK1459 TK0252 Aspartate carbamoyltransferase, regulatory...”
- “...TK0418 TK1287 TK0260 TK1895 TK0084 TK0612 TK1923 TK2180 TK1002 TK0199 TK0475 TK0838 TK0983 TK1822 TK0762 TK2138 TK0531 TK1841 TK0836 TK0407 TK2182 TK0737 TK0210...”
O58187 adenylosuccinate synthase (EC 6.3.4.4) from Pyrococcus horikoshii (see 2 papers)
WP_010884548 adenylosuccinate synthetase from Pyrococcus horikoshii
32% identity, 98% coverage
5k7xA / O58187 Fully ligated adenylosuccinate synthetase from pyrococcus horikoshii ot3 with gtp, imp and hadacidin
32% identity, 98% coverage
- Ligands: guanosine-5'-triphosphate; inosinic acid; hadacidin; magnesium ion (5k7xA)
Q57981 adenylosuccinate synthase (EC 6.3.4.4) from Methanocaldococcus jannaschii (see 2 papers)
32% identity, 98% coverage
MMP1432 Adenylosuccinate synthase from Methanococcus maripaludis S2
31% identity, 98% coverage
PURA_PYRSS / Q59726 Adenylosuccinate synthetase; AMPSase; AdSS; IMP--aspartate ligase; EC 6.3.4.4 from Pyrococcus sp. (strain ST700) (see paper)
Q59726 adenylosuccinate synthase (EC 6.3.4.4) from Pyrococcus sp. (see paper)
31% identity, 98% coverage
- function: Plays an important role in the de novo pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
catalytic activity: IMP + L-aspartate + GTP = N(6)-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H(+) (RHEA:15753)
cofactor: Mg(2+) (Binds 1 Mg(2+) ion per subunit.)
subunit: Homodimer.
SSO0242 Adenylosuccinate synthase (IMP--aspartate ligase) (purA) from Sulfolobus solfataricus P2
30% identity, 98% coverage
- Something old, something new, something borrowed; how the thermoacidophilic archaeon Sulfolobus solfataricus responds to oxidative stress
Maaty, PloS one 2009 - “...COG1473 Thermostable carboxypeptidase (cpsA-2) SSO1952 43250 5.93 143,301,150 P5,P6,P7 COG1473 Adenylosuccinate synthase (IMP aspartate ligase) SSO0242 37417 5.83 206, 94 P6, P7 COG0104 Glutamate dehydrogenase (gdhA-4) * SSO2044 46091 6.5 157,278 P7, P10 COG0334 Long-chain-fatty-acid-CoA ligase (fadD-1) SSO0369 51587 6.11 163 P8 COG0318 Hypothetical protein SSO2635...”
Rru_A1964 Adenylosuccinate synthase from Rhodospirillum rubrum ATCC 11170
30% identity, 97% coverage
- Metabolic Regulation as a Consequence of Anaerobic 5-Methylthioadenosine Recycling in Rhodospirillum rubrum
North, mBio 2016 - “...is strongly downregulated. GMP reductase (Rru_A1958), which irreversibly converts GMP to IMP, and adenylosuccinate synthase (Rru_A1964), which generates AMP from IMP, each show a 12-fold decrease in protein levels ( Fig.2 ; Table1 ). This is evidently in response to the excess adenine flux from MTA...”
- “...sulfate, this is supported by observed lower levels of GMP reductase (Rru_A1958) and adenylosuccinate synthase (Rru_A1964) ( Table1 ; Fig.2 ), which convert GMP to AMP from de novo purine biosynthesis. Such was also observed for aerobic MTA metabolism in R.rubrum ( 27 ). Interestingly, in...”
Desfe_0482 adenylosuccinate synthetase from Desulfurococcus amylolyticus DSM 16532
31% identity, 96% coverage
toyG / B6CWJ0 succinylo-toyocamycin phosphate synthase from Streptomyces rimosus (see paper)
29% identity, 98% coverage
YP_827486 Adenylosuccinate synthase from Solibacter usitatus Ellin6076
27% identity, 62% coverage
XP_003859320 adenylosuccinate synthetase, putative from Leishmania donovani
25% identity, 60% coverage
A7LBL2 Adenylosuccinate synthetase from Leishmania donovani
25% identity, 60% coverage
CW752_RS05825 adenylosuccinate synthetase from Chryseobacterium sp. PMSZPI
27% identity, 78% coverage
7vf6A / A0A7L7SI10 The crystal structure of purz0 (see paper)
26% identity, 76% coverage
- Ligands: phosphate ion; guanosine-5'-diphosphate (7vf6A)
AOV_02120, AOV_02180 adenylosuccinate synthetase from Anaplasma ovis str. Haibei
55% identity, 13% coverage
- The Anaplasma ovis genome reveals a high proportion of pseudogenes
Liu, BMC genomics 2019 - “...infB 387 X AOV_02590 2502 AOV_01975 infB 702 X AOV_02035 pccB 2035 X AOV_02715 1533 AOV_02120 purA 195 X AOV_03080 1281 AOV_02180 purA 195 X AOV_02195 trxB2 228 X AOV_02205 1023 AOV_02200 trxB2 669 X AOV_02415 pepA 1158 X AOV_03525 1497 AOV_02440 pepA 540 X AOV_02835...”
- “...infB 702 X AOV_02035 pccB 2035 X AOV_02715 1533 AOV_02120 purA 195 X AOV_03080 1281 AOV_02180 purA 195 X AOV_02195 trxB2 228 X AOV_02205 1023 AOV_02200 trxB2 669 X AOV_02415 pepA 1158 X AOV_03525 1497 AOV_02440 pepA 540 X AOV_02835 lpdA 420 X AOV_02845 1416 AOV_03085...”
PURZ_BPSHA / A0A2H5BHJ6 N6-succino-2-amino-2'-deoxyadenylate synthase; 2-amino-2'-deoxyadenylo-succinate synthase; PurZ; EC 6.3.4.25 from Acinetobacter phage SH-Ab 15497 (see paper)
A0A2H5BHJ6 2-amino-2'-deoxyadenylo-succinate synthase (EC 6.3.4.25) from Acinetobacter phage SH-Ab 15497 (see paper)
28% identity, 69% coverage
- function: Involved in the synthesis of the atypical nucleotide dZTP (2- amino-2'-deoxyadenosine-5'-triphosphate) (PubMed:33926954). Catalyzes the condensation of aspartate with deoxyguanylate into dSMP (N6- succino-2-amino-2'-deoxyadenylate), which undergoes defumarylation and phosphorylation respectively by host PurB and guanylate/nucleoside diphosphate kinases to give dZTP (PubMed:33926954). dZTP is integrated into the viral genome instead of adenine by the viral DNA polymerase. This Z-base probably completely replaces adenosine and forms a triple bond to the opposite T-base (PubMed:33926954). The resulting non- standard viral DNA is called Z-genome (PubMed:33926954). The chemically modified DNA is probably harder for the host bacteria to digest with nucleases or restriction enzymes (Probable).
catalytic activity: dGMP + L-aspartate + ATP = (2S)-2-amino-2'-deoxyadenylo- succinate + ADP + phosphate + 2 H(+) (RHEA:67628)
cofactor: Mg(2+)
PURZ_BPS2L / A0A7U3TBV6 N6-succino-2-amino-2'-deoxyadenylate synthase; 2-amino-2'-deoxyadenylo-succinate synthase; PurZ; EC 6.3.4.25 from Cyanophage S-2L (Cyanobacteria phage S-2L) (see paper)
26% identity, 84% coverage
- function: Involved in the synthesis of the atypical nucleotide dZTP (2- amino-2'-deoxyadenosine-5'-triphosphate) (PubMed:33926955). Catalyzes the condensation of aspartate with deoxyguanylate into dSMP (N6- succino-2-amino-2'-deoxyadenylate), which undergoes defumarylation and phosphorylation respectively by host PurB and guanylate/nucleoside diphosphate kinases to give dZTP (PubMed:33926955). dZTP is integrated into the viral genome instead of adenine by the viral DNA polymerase. This Z-base probably completely replaces adenosine and forms a triple bond to the opposite T-base (PubMed:33926955). The resulting non- standard viral DNA is called Z-genome (PubMed:33926955). The chemically modified DNA is probably harder for the host bacteria to digest with nucleases or restriction enzymes (Probable).
catalytic activity: dGMP + L-aspartate + ATP = (2S)-2-amino-2'-deoxyadenylo- succinate + ADP + phosphate + 2 H(+) (RHEA:67628)
cofactor: Mg(2+)
7odxA / A0A7U3TBV6 Cyanophage s-2l succinoaminodeoxyadenylate synthetase (purz) bound to dgmp and datp as an energy donor (see paper)
26% identity, 84% coverage
- Ligands: 2'-deoxyguanosine-5'-monophosphate; 2'-deoxyadenosine 5'-triphosphate (7odxA)
PURZ_BPPMB / A0A2L0V130 N6-succino-2-amino-2'-deoxyadenylate synthase; 2-amino-2'-deoxyadenylo-succinate synthase; PurZ; EC 6.3.4.25 from Salmonella phage PMBT28 (see paper)
29% identity, 64% coverage
- function: Involved in the synthesis of the atypical nucleotide dZTP (2- amino-2'-deoxyadenosine-5'-triphosphate). Catalyzes the condensation of aspartate with deoxyguanylate into dSMP (N6-succino-2-amino-2'- deoxyadenylate), which undergoes defumarylation and phosphorylation respectively by host PurB and guanylate/nucleoside diphosphate kinases to give dZTP. dZTP is integrated into the viral genome instead of adenine by the viral DNA polymerase. This Z-base probably completely replaces adenosine and forms a triple bond to the opposite T-base. The resulting non-standard viral DNA is called Z-genome. The chemically modified DNA is probably harder for the host bacteria to digest with nucleases or restriction enzymes.
catalytic activity: dGMP + L-aspartate + ATP = (2S)-2-amino-2'-deoxyadenylo- succinate + ADP + phosphate + 2 H(+) (RHEA:67628)
cofactor: Mg(2+)
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory