PaperBLAST

PaperBLAST Hits for mRNA_3724 (52 a.a., ATEASKLASY...)

Show query sequence

>mRNA_3724
ATEASKLASYNKKSTISSREIQTSVRLILPGELSKHAISEGTNAVTKFSSTK

Running BLASTp...

Found 234 similar proteins in the literature:

CNAG_06746 histone H2B from Cryptococcus neoformans var. grubii H99
CNB00560 histone h2b from Cryptococcus neoformans var. neoformans JEC21
90% identity, 37% coverage

• Cryptococcus neoformans, Unlike Candida albicans, Forms Aneuploid Clones Directly from Uninucleated Cells under Fluconazole Stress
  Chang, mBio 2018
  • “...10mM asparagine as the sole nitrogen source. To tag histone H2B with GFP, cDNA of CNAG_06746 was placed under the promoter control of the glyceraldehyde-3-phosphate dehydrogenase gene (CNAG_06699) and fused with mNG at its C terminus. The resulting construct was target integrated into chr3 as described...”
• HDAC genes play distinct and redundant roles in Cryptococcus neoformans virulence
  Brandão, Scientific reports 2018
  • “...Non-histone chromosomal protein 6 0.61516928 CNAG_06597 SPT8 Transcriptional activator SPT8 0.224863088 CNAG_06745 Histone H3 0.576382711 CNAG_06746 Histone H2B 0.606684422 CNAG_06747 Histone H2A 0.53480499 CNAG_07027 SPT2 Protein SPT2 0.101538608 CNAG_07565 TAF9 Transcription initiation factor TFIID subunit 9B 0.194617264 CNAG_07572 ELP3 Pol II transcription elongation factor 0.32202168 CNAG_07680...”
• Characterization of Lipids and Proteins Associated to the Cell Wall of the Acapsular Mutant Cryptococcus neoformans Cap 67
  Longo, The Journal of eukaryotic microbiology 2015
  • “...CnHcPbSc CNAG_05465 guanine nucleotide-binding protein Af Ca PbSc HcSc Nucleosomeassembly CNAG_06745 histone H3 - - CNAG_06746 histone H2B Ca Pb CnHcPbSc Cytoskeleton CNAG_00483 actin Ca PbSc CnHcPbSc CNAG_01840 tubulin beta chain - CnPbSc CNAG_03787 tubulin alpha-1A chain Ca Cn CNAG_04948 tubulin beta - - * Proteins...”
• Secretome profiling of Cryptococcus neoformans reveals regulation of a subset of virulence-associated proteins and potential biomarkers by protein kinase A
  Geddes, BMC microbiology 2015
  • “...protein S2 No No TCA/acetone Regulation of transcription CNAG_00483 Actin No No TCA/acetone Nucleosome assembly CNAG_06746 Histone h2b No No TCA/acetone Unknown/Unclassified CNAG_00407 Glyoxal oxidase Yes (16/17) Yes (C-27) EtOH, TCA/acetone CNAG_00776 Immunoreactive mannoprotein MP88 Yes (22/23) Yes (C-30) TCA/acetone CNAG_01653 Cytokine-inducing glycoprotein Yes (19/20) No...”
• Identification of Cryptococcus neoformans temperature-regulated genes with a genomic-DNA microarray
  Kraus, Eukaryotic cell 2004
  • “...CNH00590 CNI01120 LEU1 CNC03960 CND02650 ACC1 CND05600 CNB00560 CNE04690 Fatty acid synthase, beta subunit Nuclear pore complex protein Unknown Ribosomal...”

NCU02435 histone H2B from Neurospora crassa OR74A
88% identity, 37% coverage

• Nutritional compensation of the circadian clock is a conserved process influenced by gene expression regulation and mRNA stability
  Kelliher, PLoS biology 2023
  • “...APA events in controls collapsing to a single poly(A) peak in mutants ( A ). NCU02435 (histone H2B) is 1 out of the 123 APA events in mutants collapsing to a single poly(A) peak in controls ( B ). NCU01418 ( ccg-6 ) and NCU16757 are...”
• Post-Translational Modifications of Histones Are Versatile Regulators of Fungal Development and Secondary Metabolism
  Etier, Toxins 2022
  • “...). H2B alignment of S. cerevisiae (YDR224C), C. albicans (C3_03900C_A), S. pombe (SPCC622.09), N. crassa (NCU02435), F. graminearum (FGRAMPH1_01G26111), A. nidulans (AN3469) ( C ). H3 alignment of S. cerevisiae (YBR010W), C. albicans (C1_04260W_A), S. pombe (SPBC1105.11c), N. crassa (NCU01635), F. graminearum (FGRAMPH1_01G14931), A. nidulans (AN0733)...”

P23754 Histone H2B from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
88% identity, 36% coverage

• Chromatin-dependent regulation of secondary metabolite biosynthesis in fungi: is the picture complete?
  Collemare, FEMS microbiology reviews 2019
  • “...P04911; H2B P02293; H3 P61830; H4 P02309) and Aspergillus nidulans (accession numbers: H2A P08844; H2B P23754; H3 P23753; H4 P23750) from the reviewed (Swiss-Prot) Uniprot database (TheUniProtConsortium 2017 ). The PTMs from A. nidulans are only predictions based on similarity. (A) Proportion of each experimentally validated...”

An11g11310 uncharacterized protein from Aspergillus niger
88% identity, 36% coverage

• Updating genome annotation for the microbial cell factory Aspergillus niger using gene co-expression networks
  Schäpe, Nucleic acids research 2019
  • “...gene expression locus; strain BG3.1), An12g03570 (medium gene expression locus, pyrG , strain VG8.27), and An11g11310 (high gene expression locus; strain BG6.14) are given. Doxycycline was added 16 h after inoculation. ( D ) Cultivation of strain BG1.1 and BG6.14 in 5L bioreactors. For each strain,...”
• Highly active promoters and native secretion signals for protein production during extremely low growth rates in Aspergillus niger
  Wanka, Microbial cell factories 2016 (no snippet)
• Cytosolic streaming in vegetative mycelium and aerial structures of Aspergillus niger
  Bleichrodt, Studies in mycology 2013
  • “...3312 Similarity to hypothetical protein encoded by CG4090 - Drosophila melanogaster An16g06570 3294 Hypothetical protein An11g11310 3289 Strong similarity to histone H2B - Aspergillus nidulans An15g07370 3217 Similarity to hypothetical protein encoded by CG4090 - Drosophila melanogaster An14g02140 3104 Weak similarity to Ca-dependent protein kinase CDPK1...”

HCAG_03525 histone H2b from Histoplasma mississippiense (nom. inval.)
88% identity, 37% coverage

• Auranofin is active against Histoplasma capsulatum and reduces the expression of virulence-related genes
  de, PLoS neglected tropical diseases 2024
  • “...superoxide dismutase (HCAG_01543), thioredoxin reductase (HCAG_07019), serine proteinase (HCAG_00635), cytochrome C peroxidase (HCAG_08658), Histone 2B (HCAG_03525), formamidase (HCAG_08831), metallopeptidase (HCAG_04252), Y20 protein (HCAG_04745), and yeast phase specific protein 3 (YPS 3) (Q00950) were selected for analysis. The constitutively expressed glyceraldehyde 3-phosphate dehydrogenase (HCAG_04910) gene [ 34...”
• Vesicle and vesicle-free extracellular proteome of Paracoccidioides brasiliensis: comparative analysis with other pathogenic fungi
  Vallejo, Journal of proteome research 2012
  • “...Yes HCAG_03885 CNAG_01648 YBR009C 70 NS PADG_05907 histone H2B type 1-A (142 aa) Yes Yes HCAG_03525 YBL002W other/ unknown function 71 - PADG_01509 DUF907 domain-containing protein (746 aa) Yes NF* HCAG_03638 YAL053W* 72 NS PADG_04288 L-PSP endoribonuclease family protein (Hmf1) (168 aa) Yes Yes HCAG_04397 YER057C*...”
• Histoplasma capsulatum heat-shock 60 orchestrates the adaptation of the fungus to temperature stress
  Guimarães, PloS one 2011
  • “...a 7.97 9.12 HCAG_05266 aconitase 1.01 1.70 1.81 HCAG_06901 malate dehydrogenase 3.89 3.96 2.44 Nuclear HCAG_03525 histone H2b 11.42 b 2.81 2.20 7.22 9.87 4.53 HCAG_00683 woronin body major protein 5.30 2.91 2.07 Chaperone-like HCAG_00806 heat shock protein SSB1 2.69 3.14 3.32 HCAG_01398 hsp70-like protein 10.74...”

DFL_000203 uncharacterized protein from Arthrobotrys flagrans
88% identity, 36% coverage

• Tools and basic procedures of gene manipulation in nematode-trapping fungi
  Wang, Mycology 2023
  • “...D. flagrans genomic DNA as template, producing a 1.6 kb fragment including the ORF of DFL_000203 (0.6 kb without stop codon), + 1 kb of the 5 region and a 1 kb fragment 3 downstream of the locus as reported in Youssar et al. s study....”
• The small-secreted cysteine-rich protein CyrA is a virulence factor participating in the attack of Caenorhabditis elegans by Duddingtonia flagrans
  Wernet, PLoS pathogens 2021
  • “...D . flagrans genomic DNA as template. The vector pNH31 consisting of the H2B gene (DFL_000203) under its native promoter fused to mCherry was amplified as well and used as a backbone [ 15 ]. The two fragments were assembled via Gibson assembly. For the C-terminal...”
• Intercellular communication is required for trap formation in the nematode-trapping fungus Duddingtonia flagrans
  Youssar, PLoS genetics 2019
  • “...the histone H2B under its natural promoter, a 1.6 kb fragment including the ORF of DFL_000203 (0.6 kb without stop codon) + 1 kb of the 5 region and a 1 kb fragment 3 downstream of the locus were amplified by PCR, using D . flagrans...”

Q4WWC5 Histone H2B from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
AFUA_3G05350, Afu3g05350 histone H2B from Aspergillus fumigatus Af293
88% identity, 36% coverage

• Unveiling fungal strategies: Mycoremediation in multi-metal pesticide environment using proteomics
  Dey, Scientific reports 2024
  • “...L37a Mitochondria 0.019 Q0CX81 6.5 Energy production and conversion Plasma membrane ATPase Plasma membrane 0.019 Q4WWC5 6.5 Posttranslational modification, protein turnover, chaperones Histone H2B Nucleus 0.001 A1CIN5 6.1 Secondary metabolites biosynthesis, transport and catabolism Hydrophobin Mitochondria 0.046 Q41E2 5.8 Posttranslational modification, protein turnover, chaperones Ketoreductase Cytoplasm...”
• The proteomic signature of Aspergillus fumigatus during early development
  Cagas, Molecular & cellular proteomics : MCP 2011
  • “...kDa 13 kDa 15 kDa Q4WN34 Q4WYA0 Q4WWC5 AFUA_5G03490 AFUA_2G13860 AFUA_3G05370 AFUA_2G02100 AFUA_6G12930 AFUA_6G07770 16 kDa 45 kDa AFUA_1G05390 AFUA_6G03820...”
• Biotinylated Surfome Profiling Identifies Potential Biomarkers for Diagnosis and Therapy of Aspergillus fumigatus Infection
  Jia, mSphere 2020
  • “...were also abundantly detected throughout germination ( Table2 ). Somewhat surprisingly, the histone H2B (Htb1, Afu3g05350) seemed to be one of the most abundant proteins throughout the germination time course ( Table1 and 2 ). The number of PSM/length of Htb1 in dormant conidia (3.25) was...”
  • “...a Protein Accession no. Protein description No. of AAs Biotinylation site(s) b Note c Htb1 Afu3g05350 Histone H2B 140 K9 G, M ; K20 D, G, M ; K25 G ; K31 D, S, G, M ; K60 M ; K99 D ; K100 D, M...”
• The Aspergillus fumigatus SchA^SCH9 kinase modulates SakA^HOG1 MAP kinase activity and it is essential for virulence
  Alves, Molecular microbiology 2016
  • “...NI AFUA_3G06070 AFUB_042980 histone H1 NI 2.60937 NI AFUA_3G05360 AFUB_043640 histone H2A NI 1.60511 NI AFUA_3G05350 AFUB_043650 Histone H2B NI 1.49352 NI AFUA_4G11910 AFUB_068910 N-terminal acetyltransferase catalytic sub- unit (NAT1) NI 2.76482 NI Lipid metabolism AFUA_7G05920 AFUB_091500 stearic acid desaturase (SdeA) NI 1.04105 NI AFUA_7G03740 AFUB_089270...”
• The proteomic signature of Aspergillus fumigatus during early development
  Cagas, Molecular & cellular proteomics : MCP 2011
  • “...Q4X1P8 Q4WWZ4 Q6MY67 Q4WDM0 Q4WWT2 AFUA_3G05350 AFUA_3G06970 AFUA_1G03970 AFUA_3G12690 AFUA_1G09100 AFUA_5G04230 AFUA_1G04530 AFUA_3G08600 AFUA_3G11260...”

PADG_05907 histone H2B from Paracoccidioides brasiliensis Pb18
88% identity, 36% coverage

• Vesicle and vesicle-free extracellular proteome of Paracoccidioides brasiliensis: comparative analysis with other pathogenic fungi
  Vallejo, Journal of proteome research 2012
  • “...proteins 69 - PADG_07134 histone H4.2 (104 aa) Yes Yes HCAG_03885 CNAG_01648 YBR009C 70 NS PADG_05907 histone H2B type 1-A (142 aa) Yes Yes HCAG_03525 YBL002W other/ unknown function 71 - PADG_01509 DUF907 domain-containing protein (746 aa) Yes NF* HCAG_03638 YAL053W* 72 NS PADG_04288 L-PSP endoribonuclease...”

C1HDS5 Histone H2B from Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01)
PAAG_08918 late histone H2B.L4 from Paracoccidioides lutzii Pb01
88% identity, 36% coverage

• Identification of Potentially Therapeutic Immunogenic Peptides From Paracoccidioides lutzii Species
  Silva, Frontiers in immunology 2021
  • “...and accession number(s) can be found below: https://www.uniprot.org/ , A0A0A2V091, https://www.uniprot.org/ , C1GPI5, https://www.uniprot.org/ , C1HDS5, https://www.uniprot.org/ , C1H2V9, https://www.uniprot.org/ , A0A0A2V0A9, https://www.uniprot.org/ , C1GP19, https://www.uniprot.org/ , C1GXU1, https://www.uniprot.org/ , C1GRW7, https://www.uniprot.org/ , C1H2K5, https://www.uniprot.org/ , C1GNW1, https://www.uniprot.org/ , C1H8U1, https://www.uniprot.org/ , C1GRA7, https://www.uniprot.org/ , C1GWA6,...”
• Identification of Potentially Therapeutic Immunogenic Peptides From Paracoccidioides lutzii Species
  Silva, Frontiers in immunology 2021
  • “...protein L8-B PAAG_04998 BMDC 63.5% 11 NFGIGQDIQPK 65.0% 16 LKVPPAIAQFQNTLDR 54.0% 11 QVHPDTGISNR Histone H2B PAAG_08918 BMDC 40.5% 15 AMSILNSFVNDIFER 63.5% 12 DAGTIAGLNVLR Hsp70-like protein PAAG_01262 BMDC 28.1% 25 QHPSELETAIAGALSDLEANTPDLK 40S ribosomal protein S7 PAAG_07182 BMDC 22.0% 11 VNIGQILLSVR 60S ribosomal protein L10-B PAAG_01052 BMDC 28.5%...”
  • “...Rank (%) Peptide named/Sequence 60S ribosomal protein L8-B PAAG_04998 65.0% LBR1/LKVPPAIAQFQNTLDR 54.0% LBR2/NFGIGQDIQPK Histone H2B PAAG_08918 40.5% LBR3/QVHPDTGISNR 63.5% LBR4/AMSILNSFVNDIFER Hsp70-like protein PAAG_01262 28.1% LBR5/DAGTIAGLNVLR 40S ribosomal protein S7 PAAG_07182 22.0% LBR6/QHPSELETAIAGALSDLEANTPDLK Ribosomal protein L35 PAAG_02889 16.0% LBR7/VNIGQILLSVR H15 domain-containing protein PAAG_12131 9.7% LBR8/ITVTSQSAFDAQFNR 3-D Prospecting...”
• Comparison of the RNA Content of Extracellular Vesicles Derived from Paracoccidioidesbrasiliensis and Paracoccidioides lutzii
  Peres, Cells 2019
  • “...PADG_00873 PABG_02444 PAAG_07099 histone h3 100% chromosome organization PABG_05588 PAAG_08917 histone h2a 90% chromosome organization PAAG_08918 histone h2b 70% chromosome organization PADG_06568 tctp family protein 50% cell differentiation PABG_03449 PAAG_08247 calmodulin 70% ion binding Other/Unknown Function PADG_02280 hypothetical protein 75% Unknown PADG_02399 calcium-binding protein 70% Unknown...”
• Transcriptional and proteomic responses to carbon starvation in Paracoccidioides
  Lima, PLoS neglected tropical diseases 2014
  • “...# DNA processing PAAG_07098 histone H4,1 # DNA processing PAAG_00126 histone H4,2 # DNA processing PAAG_08918 late histone H2B,L4 # DNA processing PAAG_05147 mitotic checkpoint protein BUB3 # cell cycle control PAAG_03054 G2/M phase checkpoint control protein Sum2 # cell cycle control TRANSCRIPTION PAAG_02467 Transcription initiation...”

C0NZ94 Histone H2B from Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432)
88% identity, 40% coverage

• Antibody Binding Alters the Characteristics and Contents of Extracellular Vesicles Released by Histoplasma capsulatum.
  Matos, mSphere 2016

SS1G_10960, XP_001587720 histone H2B.1 from Sclerotinia sclerotiorum 1980 UF-70
88% identity, 37% coverage

• Ssams2, a Gene Encoding GATA Transcription Factor, Is Required for Appressoria Formation and Chromosome Segregation in Sclerotinia sclerotiorum
  Liu, Frontiers in microbiology 2018
  • “...of the cell cycle related gene Sscdc6 (SS1G_04516), Sscdc28 (SS1G_02296), histone genes H2A (SS1G_10959), H2B (SS1G_10960), H3 (SS1G_09608), H4 (SS1G_09609), and Sscpn1 (SS1G_00304) in the RNAi transformants were down-regulated significantly (Figures 7B H ). These data demonstrate that chromosome segregation was disturbed in Ssams2 -silenced strains,...”
• Ss-Sl2, a novel cell wall protein with PAN modules, is essential for sclerotial development and cellular integrity of Sclerotinia sclerotiorum
  Yu, PloS one 2012
  • “...(Da) XP_001592594 60S ribosomal protein L35 (6) 60.6% 14513 XP_001585386 Histone H4.1 (5) 59.2% 11363 XP_001587720 Histone H2B.1 (7) 59.0% 14774 XP_001595438 Woronin body major protein (6) 56.0% 18262 XP_001585908 40S ribosomal protein S2 (8) 51.9% 28410 XP_001591676 Ribosomal protein S3 (8) 40.3% 28652 XP_001586490 40S...”

BCIN_02g06790 hypothetical protein from Botrytis cinerea B05.10
88% identity, 36% coverage

• Deciphering the Dynamics of Signaling Cascades and Virulence Factors of B. cinerea during Tomato Cell Wall Degradation
  Escobar-Niño, Microorganisms 2021
  • “...last group of proteins of cluster 24 was hypothesized to be related to transcription (BCIN_07g05050, BCIN_02g06790, Bcrtf1, and Bcctr9). Blastp and a Conserved Domain Search analysis showed that BCIN_07g05050 was a putative RuvB-like helicase; and BCIN_02g06790 was a histone H2B family protein. Cluster 36 was the...”
  • “...56 ], explaining the presence of the third group of proteins of this cluster (BCIN_07g05050, BCIN_02g06790, Bcrtf1, Bcctr9). In yeast, RNA polymerase-associated protein CTR9 and RNA polymerase-associated protein RTF1 are components of the multifunctional complex PAF1, which is involved in transcription, elongation, and transcription-coupled histone modification,...”

XP_011327820 histone H2B from Fusarium graminearum PH-1
Q4HTT2 Histone H2B from Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
86% identity, 37% coverage

• Plant defense compound triggers mycotoxin synthesis by regulating H2B ub1 and H3K4 me2/3 deposition.
  Ma, The New phytologist 2021
  • GeneRIF: Plant defense compound triggers mycotoxin synthesis by regulating H2B ub1 and H3K4 me2/3 deposition.
• Characterization of copper stress response in Fusarium tricinctum M6: A metal-resistant microorganism isolated from an acid mine drainage-affected environment.
  Bonilla, Journal of hazardous materials 2021
  • “...to TATA-binding protein associated factor 2 N 348 38.23 A0A0J9WA35 BZIP domain-containing protein 212 24.35 Q4HTT2 Histone H2B 137 14.75 K3VN47 Zn(2)-C6 fungal-type domain- containing protein 1024 116.72 C7YIM9 Uncharacterized protein BRD2103 675 74.94 C7YNQ5 Uncharacterized protein NECHADRAFT_60425 604 65.40 A0A0J9V1M3 Uncharacterized protein FOXG_07428 841 94.08...”

E3KEI6 Histone H2B from Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL)
87% identity, 37% coverage

• Label-Free Quantitative Proteomic Analysis of Puccinia psidii Uredospores Reveals Differences of Fungal Populations Infecting Eucalyptus and Guava
  Quecine, PloS one 2016
  • “...Heme-binding peroxidase 6757.64 1.73 0.55 0.14 1.00 E3L1S2 Histone H2A 7513.68 0.92 -0.08 0.08 0.03 E3KEI6 Histone H2B 6731.25 0.63 -0.47 0.14 0.00 E3JQ71 Histone-binding protein RBBP4 790.83 PpGuava PpGuava PpGuava PpGuava E3KZR0 Hsp10 like protein 1463.97 1.45 0.37 0.15 1.00 E3JT24 Hsp70-like protein 2010.73 1.45...”

KAFR0F02480 uncharacterized protein from Kazachstania africana CBS 2517
84% identity, 39% coverage

• Patterns of Gene Conversion in Duplicated Yeast Histones Suggest Strong Selection on a Coadapted Macromolecular Complex
  Scienski, Genome biology and evolution 2015
  • “...e KNAG0K01430 HTB2 D 1 e KAFR0C00770 0.030 0.091 1,294 1,259 1,258 D 2 e KAFR0F02480 O e KNAG0K01420 HHF1 D 1 e KAFR0C00700 0.0 0.010 1,251 1,174 1,146 D 2 e KAFR0A01280 O e KNAG0J01060 D 1 e CAGL0C04136g 0.0 0.010 D 2 e CAGL0H09834g...”
  • “...0.012 0.551 HTB2 D 1 e KAFR0C00770 >0.99 0.008 0.08 0.156 0.011 D 2 e KAFR0F02480 0.015 0.098 O e KNAG0K01420 0.027 0.411 HHF1 D 1 e KAFR0C00700 0.97 0 0.07 0.011 <0.001 D 2 e KAFR0A01280 0 0.124 O e KNAG0J01060 0.010 0.459 D 1...”

H2B1_YEAST / P02293 Histone H2B.1; Suppressor of Ty protein 12 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 13 papers)
NP_010510 histone H2B from Saccharomyces cerevisiae S288C
YDR224C Htb1p from Saccharomyces cerevisiae
84% identity, 39% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Reversal of histone H2B mono-ubiquitination is required for replication stress recovery.
  Korenfeld, DNA repair 2022 (PubMed)
  • GeneRIF: Reversal of histone H2B mono-ubiquitination is required for replication stress recovery.
• Influence of sequence length and charged residues on Swc5 binding with histone H2A-H2B.
  Chu, Proteins 2021 (PubMed)
  • GeneRIF: Influence of sequence length and charged residues on Swc5 binding with histone H2A-H2B.
• RPA-mediated recruitment of Bre1 couples histone H2B ubiquitination to DNA replication and repair.
  Liu, Proceedings of the National Academy of Sciences of the United States of America 2021
  • GeneRIF: RPA-mediated recruitment of Bre1 couples histone H2B ubiquitination to DNA replication and repair.
• Bre1 mediates the ubiquitination of histone H2B by regulating Lge1 stability.
  Kim, FEBS letters 2018 (PubMed)
  • GeneRIF: Bre1 mediates the ubiquitination of histone H2B by regulating Lge1 stability
• H2B ubiquitylation and the histone chaperone Asf1 cooperatively mediate the formation and maintenance of heterochromatin silencing.
  Wu, Nucleic acids research 2017
  • GeneRIF: Data indicate that histone H2B ubiquitylation (H2Bub) and Asf1 cooperatively promote transcriptional silencing at telomeres and mating loci.
• Dissecting Nucleosome Function with a Comprehensive Histone H2A and H2B Mutant Library.
  Jiang, G3 (Bethesda, Md.) 2017
  • GeneRIF: This study not only demonstrates the applications of the versatile histone library, but also reveals many previously unknown functions of histone H2A and H2B.
• Histone Chaperone Nap1 Is a Major Regulator of Histone H2A-H2B Dynamics at the Inducible GAL Locus.
  Chen, Molecular and cellular biology 2016
  • GeneRIF: Nap1 is essential for maintaining proper chromatin composition and modulating the exchange of H2A-H2B in vivo.
• Quantitative Analysis of Dynamic Protein Interactions during Transcription Reveals a Role for Casein Kinase II in Polymerase-associated Factor (PAF) Complex Phosphorylation and Regulation of Histone H2B Monoubiquitylation.
  Bedard, The Journal of biological chemistry 2016
  • GeneRIF: decreased CKII function in vivo results in decreased levels of histone H2B lysine 123 monoubiquitylation, a modification dependent on FACT and PAF-C.
• More
• Structure of the complete Saccharomyces cerevisiae Rpd3S-nucleosome complex
  Markert, Nature communications 2023
  • “...(v2.3.1). The predictions were seeded with sequences for S. cerevisiae H2A.1 (P04911), S. cerevisiae H2B (P02293), and S. cerevisiae Rco1 (residues 1-79, Q04779). The AlphaFold multimer prediction yielded two potential canonical arginine anchors (Rco1 residues Arg38 and Arg51). Figure generation All figures were generated using Adobe...”
• Chromatin-dependent regulation of secondary metabolite biosynthesis in fungi: is the picture complete?
  Collemare, FEMS microbiology reviews 2019
  • “...H2A P0C0S8; H2B P62807; H3 P84243; H4 P62805), Saccharomyces cerevisiae (accession numbers: H2A P04911; H2B P02293; H3 P61830; H4 P02309) and Aspergillus nidulans (accession numbers: H2A P08844; H2B P23754; H3 P23753; H4 P23750) from the reviewed (Swiss-Prot) Uniprot database (TheUniProtConsortium 2017 ). The PTMs from A....”
• Proteoform Suite: Software for Constructing, Quantifying, and Visualizing Proteoform Families
  Cesnik, Journal of proteome research 2018
  • “...histone protein entries that were observed to have significant proteoform level changes (with UniProt accessions P02293, P02294, P02309, P04911, P04912, and P61830). A second analysis using a background set of the 1742 proteins detected below 1% FDR in a bottom-up analysis (see in section 3.2 of...”
• Ubiquitin-Activated Interaction Traps (UBAITs) identify E3 ligase binding partners
  O'Connor, EMBO reports 2015
  • “...5 0 0 3 0 0 P61830 HISTONE H3 15.3 19 0 0 29 0 0 33 3 0 P02293 HISTONE H2B 14.2 5 0 0 5 0 0 9 0 0 P25369 LSB5 39.8 3 0 0 4 0 0 4 0 0 Q12499 NOP58 56.9 2 2 0 2 1...”
• Applying label-free quantitation to top down proteomics
  Ntai, Analytical chemistry 2014
  • “...quantifiable differences for both of its two distinct gene products, H2B.1 and H2B.2 (UniProt Accessions P02293 and P02294). Interestingly, histone H2B.1 shows a more confident degree of hyperacetylation than does histone H2B.2 (Figure 5 and Table S1 ). Figure 5 Quantitation of histone H2B.1 and H2B.2...”
• Cell cycle-specified fluctuation of nucleosome occupancy at gene promoters
  Hogan, PLoS genetics 2006
  • “...HHT1 (P61830), HO (P09932), HOS1 (Q12214), HOS2 (P53096), HOS3 (Q02959), HTA1 (P04911), HTA2 (P04912), HTB1 (P02293), HTB2 (P02294), KAR5/FIG3 (Q04746), MBP1 (P39678), MCM1 (P11746), MSI1 (P13712), NDD1 (Q08887), PCL2 (P25693), PCL9 (Q12477), PHO5 (P00635), RAD6 (P06104), RAD6 (P06104), RPD3 (P32561), SEC53 (P07283), SET1 (P38827), SET2 (P46995),...”
• The splicing ATPase prp43p is a component of multiple preribosomal particles
  Lebaron, Molecular and cellular biology 2005
  • “...H2B.1 Histone H2B.2 Histone H4 P04911 P04912 Q12692 P02293 P02294 P02309 Splicing factors Brr2p Bud31p Clf1p Cwc2p Cwc23p Lea1p Lsm12p Ntc20p Prp19p Prp45p...”
• Post-Translational Modifications of Histones Are Versatile Regulators of Fungal Development and Secondary Metabolism
  Etier, Toxins 2022
  • “...(NCU02437), F. graminearum (FGRAMPH1_01G26109), A. nidulans (AN3468) ( B ). H2B alignment of S. cerevisiae (YDR224C), C. albicans (C3_03900C_A), S. pombe (SPCC622.09), N. crassa (NCU02435), F. graminearum (FGRAMPH1_01G26111), A. nidulans (AN3469) ( C ). H3 alignment of S. cerevisiae (YBR010W), C. albicans (C1_04260W_A), S. pombe (SPBC1105.11c),...”
• Inducing controlled cell cycle arrest and re-entry during asexual proliferation of Plasmodium falciparum malaria parasites
  van, Scientific reports 2018
  • “...Anaphase promoting complex subunit, putative YDL008W Anaphase-promoting complex subunit 11 pf3d7_0714000 Histone H2B variant (H2B.Z) YDR224C Histone H2B.1 pf3d7_1027700 Centrin-3 (CEN3) YOR257W Cell division control protein 31 (CDC31) pf3d7_0320900 Histone H2A variant, putative (H2A.Z) YOL012C Histone H2A.Z The complete dataset is available in Supplementary File S3,...”
• Precise estimates of mutation rate and spectrum in yeast
  Zhu, Proceedings of the National Academy of Sciences of the United States of America 2014
  • “...V XV IV XV 87066 914652 192081 260436 438662 927326 YBL074C YDR224C YER018C YOL034W YDL007W YOR326W Q -- G Q E Q Stop 30-bp deletion Stop Stop Stop Stop PNAS |...”
• Global identification of new substrates for the yeast endoribonuclease, RNase mitochondrial RNA processing (MRP)
  Aulds, The Journal of biological chemistry 2012
  • “...Ty1 Ty1B protein YDR155C; cyclophilin YLR286C; endochitinase YDR224C; histone H2B YBR010W; histone H3 YLR079W; p40 inhibitor of Cdc28 YIL123W; involved in...”
• The checkpoint transcriptional response: make sure to turn it off once you are satisfied
  Smolka, Cell cycle (Georgetown, Tex.) 2012
  • “...YDR222W YDR222W Unknown vegetative growth: decreased rate 9 YDR224C HTB1 Histone H2B - vegetative growth: decreased rate 10 YDR225W HTA1 Histone H2A -...”
• Identification of cis-regulatory elements in gene co-expression networks using A-GLAM
  Mariño-Ramírez, Methods in molecular biology (Clifton, N.J.) 2009
  • “...AGCATAACACA GGTTTTTAAATATATTATTATATATCATGGTATATGTGTAAAATTTTTT TGCTGACTGGT TTTGTTTATTTATTTAGCTTTTTAAAAATTTTACTTTCTTCTTGTTAAT TTTTTCTGATT GCTCTATACTCAAACCAACAACAACTTACTCTACAACTA >D:914709915525, Chr 4 from 914709915525, between YDR224C and YDR225W TGTATGTGTGTATGGTTTATTTGTGGTTTGACTTGTCTATATAGGATAA ATTTAATATAA CAATAATCGAAAATGCGGAAAGAGAAACGTCTTTAATAAATCTGACCAT CTGAGATGATC AAATCATGTTGTTTATATACATCAAGAAAACAGAGATGCCCCTTTCTTA CCAATCGTTAC AAGATAACCAACCAAGGTAGTATTTGCCACTACTAAGGCCAATTCTCTT GATTTTAAATC CATCGTTCTCATTTTTTCGCGGAAGAAAGGGTGCAACGCGCGAAAAAGT GAGAACAGCCT TCCCTTTCGGGCGACATTGAGCGTCTAACCATAGTTAACGACCCAACCG CGTTTTCTTCA AATTTGAACTCGCCGAGCTCACAAATAATTCATTAGCGCTGTTCCAAAA TTTTCGCCTCA CTGTGCGAAGCTATTGGAATGGAGTG TATTTGGTGGCTCAAAAAAAGAGCACAATAGTTA ACTCGTCGTTGTTGAAGAAACGCCCGTAGAGATATGTGGTTTCTCATGC TGTTATTTGTT ATTGCCCACTTTGTTGATTTCAAAATCTTTTCTCACCCCCTTCCCCGTT CACGAAGCCAG CCAGTGGATCGTAAATACTAGCAATAAGTCTTGACCTAAAAAATATATA AATAAGACTCC TAATCAGCTTGTAGATTTTCTGGTCTTGTTGAACCATCATCTATTTACT...”
  • “...2 90 (11.12770) (5.771870e-03) 314 TTGAGAAATAATGGGAACAC 333 + (9.034960) (2.714569e-02) >D:914709915525, Chr4 from 914709915525, between YDR224C and YDR225W 423 GTGCGAAGCTATTGGAATGG 442 + (18.55810) (2.256236e-06) 278 GCGCGAAAAAGTGAGAACAG 297 + (13.90430) (6.4 9552 6e-04) 418 AGGCGAAAATTTTGGAACAG 399 (12.51460) (2.007017e-03) 262 CCGCGAAAAAATGAGAACGA 243 (9.499530) (2.2 99132e-02) >N:576052576727, Chr 14...”
• Genome-wide analysis of interactions between ATP-dependent chromatin remodeling and histone modifications
  Dai, BMC genomics 2009
  • “...has showed that H3K14 and H3K18 acetylation levels decrease in TF hir3 mutant at the YDR224C promoter, and H3K18 acetylation level decreases in TF yml081W mutant at the YDR525W promoter [ 38 ]. Our identified significant TF-acetylation pairs include Hir3-H3K18 acetylation and YML081W-H3K18 acetylation pairs. However,...”
  • “...deleted. Indeed, the deletion of Hir3 causes significant decrease (> 2-fold) in expression level of YDR224C. This result indicates that the recruitment of H3K14 acetyltransferases by Hir3 may be specific for individual genes. Analysis of gene activity revealed that modification and remodeling cohort genes have significantly...”
• NLStradamus: a simple Hidden Markov Model for nuclear localization signal prediction
  Nguyen, BMC bioinformatics 2009
  • “...b YDR146C SWI5 636 655 7615496/1652372 18485366 a YDR208W MSS4 347 364 12912920 12912920 b YDR224C HTB1 30 36 3123916 15679097 b YEL009C GCN4 231 246 12455686 18485366 a YER040W GLN3 388 394 12624103 12624103/18485366 a YFR034C PHO4 141 166 9732266 9732266 b YGL071W AFT1 202...”
• More

H2B2_YEAST / P02294 Histone H2B.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 14 papers)
NP_009553 histone H2B from Saccharomyces cerevisiae S288C
YBL002W Htb2p from Saccharomyces cerevisiae
84% identity, 39% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Interacts with NAP1.
• Histone sumoylation promotes Set3 histone-deacetylase complex-mediated transcriptional regulation.
  Ryu, Nucleic acids research 2020
  • GeneRIF: Histone sumoylation promotes Set3 histone-deacetylase complex-mediated transcriptional regulation.
• The Histone Modification Domain of Paf1 Complex Subunit Rtf1 Directly Stimulates H2B Ubiquitylation through an Interaction with Rad6.
  Van, Molecular cell 2016
  • GeneRIF: The histone modification domain of Paf1 complex subunit Rtf1 directly stimulates H2B ubiquitylation through an interaction with Rad6.
• The Nucleosome Acidic Patch Regulates the H2B K123 Monoubiquitylation Cascade and Transcription Elongation in Saccharomyces cerevisiae.
  Cucinotta, PLoS genetics 2015
  • GeneRIF: A role for the H2B nucleosome acidic patch in recruitment of histone modification machinery and maintenance of transcriptional integrity.
• A highly conserved region within H2B is important for FACT to act on nucleosomes.
  Zheng, Molecular and cellular biology 2014
  • GeneRIF: Data indicate that histone H2B repression (HBR) domain is important for FACT (consisting of Spt16/Pob3) histone chaperone activity.
• UV damage-induced RNA polymerase II stalling stimulates H2B deubiquitylation.
  Mao, Proceedings of the National Academy of Sciences of the United States of America 2014
  • GeneRIF: These results indicate that eukaryotic cells respond to RNAPII arrest by deubiquitylating H2B to coordinate DNA repair and RNAPII degradation.
• Codependency of H2B monoubiquitination and nucleosome reassembly on Chd1.
  Lee, Genes & development 2012
  • GeneRIF: this study provides evidence that only small levels of H2BK123ub are necessary for full levels of H3K4 and H3K79 trimethylation in vivo and points to a possible role for Chd1 in positively regulating gene expression through promoting nucleosome reassembly coupled with H2B monoubiquitination.
• Histone H2B ubiquitylation and H3 lysine 4 methylation prevent ectopic silencing of euchromatic loci important for the cellular response to heat.
  Leung, Molecular biology of the cell 2011
  • GeneRIF: Histone H2B ubiquitylation and H3 lysine 4 methylation prevent ectopic silencing of euchromatic loci important for the cellular response to heat.
• A Bre1-associated protein, large 1 (Lge1), promotes H2B ubiquitylation during the early stages of transcription elongation.
  Song, The Journal of biological chemistry 2010
  • GeneRIF: Disruption of Lge1 abolished ubiquitylation of histone H2B on lysine 123 and H3 methylation on lysines 4 and 79
• More
• Strategy for Development of Site-Specific Ubiquitin Antibodies.
  van, Frontiers in chemistry 2020
  • “...sequences corresponding to the C-termini of the protein, as for the H2B-K123 peptide (UniProtKB - P02294, AA 115130: ac-SEGTRAVTazOrnYSSSTQA-COOH), are synthesized on a preloaded PEG-polystyrene support resin (PEG-PS). Synthesis of -Thiolysine Peptide Precursor for Synthesis Native Conjugates The peptides are synthesized on a Syro II MultiSyntech...”
• Proteoform Suite: Software for Constructing, Quantifying, and Visualizing Proteoform Families
  Cesnik, Journal of proteome research 2018
  • “...protein entries that were observed to have significant proteoform level changes (with UniProt accessions P02293, P02294, P02309, P04911, P04912, and P61830). A second analysis using a background set of the 1742 proteins detected below 1% FDR in a bottom-up analysis (see in section 3.2 of the...”
• Redundant Functions for Nap1 and Chz1 in H2A.Z Deposition
  Dronamraju, Scientific reports 2017
  • “...This construct consists of H2A.Z (residues 22118, UniProt ID: Q12692), H2B (residues 36130, UniProt ID: P02294) and Chz1 (63124). The NMR sample was constructed by connecting the C-terminus of H2B and N-terminus of H2A.Z to form a single peptide chain. In the construct used in our...”
• HyCCAPP as a tool to characterize promoter DNA-protein interactions in Saccharomyces cerevisiae
  Guillen-Ahlers, Genomics 2016
  • “...(p value) Fold enrichment in Glc (p value) Fold enrichment between conditions (p value) ENO2 P02294 Histone H2B HTB2 13.3 (110 07 ) Gal only (410 02 ) P04147 Poly(A) binding protein PAB1 347.6 (510 228 ) 66.5 (210 32 ) Gal 3.1 (710 08 )...”
• Applying label-free quantitation to top down proteomics
  Ntai, Analytical chemistry 2014
  • “...for both of its two distinct gene products, H2B.1 and H2B.2 (UniProt Accessions P02293 and P02294). Interestingly, histone H2B.1 shows a more confident degree of hyperacetylation than does histone H2B.2 (Figure 5 and Table S1 ). Figure 5 Quantitation of histone H2B.1 and H2B.2 proteoforms across...”
• Cell cycle-specified fluctuation of nucleosome occupancy at gene promoters
  Hogan, PLoS genetics 2006
  • “...HO (P09932), HOS1 (Q12214), HOS2 (P53096), HOS3 (Q02959), HTA1 (P04911), HTA2 (P04912), HTB1 (P02293), HTB2 (P02294), KAR5/FIG3 (Q04746), MBP1 (P39678), MCM1 (P11746), MSI1 (P13712), NDD1 (Q08887), PCL2 (P25693), PCL9 (Q12477), PHO5 (P00635), RAD6 (P06104), RAD6 (P06104), RPD3 (P32561), SEC53 (P07283), SET1 (P38827), SET2 (P46995), SET3 (P36124),...”
• The splicing ATPase prp43p is a component of multiple preribosomal particles
  Lebaron, Molecular and cellular biology 2005
  • “...Histone H2B.2 Histone H4 P04911 P04912 Q12692 P02293 P02294 P02309 Splicing factors Brr2p Bud31p Clf1p Cwc2p Cwc23p Lea1p Lsm12p Ntc20p Prp19p Prp45p Prp46p...”
• Heme, A Metabolic Sensor, Directly Regulates the Activity of the KDM4 Histone Demethylase Family and Their Interactions with Partner Proteins
  Konduri, Cells 2020
  • “...6322515 Protein involved in C/D snoRNP assembly ZNHIT3 HPA3 YEL066W 6320768 D-amino-acid N-acetyltransferase + HTB2 YBL002W 6319471 Core histone protein required for chromatin assembly and chromosome function H2BFWT, HIST1H2BA, HIST1H2BB, HIST1H2BC, HIST1H2BD, HIST1H2BE, HIST1H2BF, HIST1H2BG, HIST1H2BH, HIST1H2BI, HIST1H2BJ, HIST1H2BK, HIST1H2BL, HIST1H2BM, HIST1H2BN, HIST1H2BO, HIST2H2BE, HIST3H2BB +...”
• Regulatory and evolutionary adaptation of yeast to acute lethal ethanol stress
  Yang, PloS one 2020
  • “...transposable element YPR137C-A YPR137C-A 2.8 transposable element RPB9 YGL070C 2.7 RNA polymerase II subunit HTB2 YBL002W 2.5 Histone H2B To explore the difference between the pre-stress state of strain JY304 and the parental strain at the level of significantly enriched pathways, we performed iPAGE analysis, which...”
• Predicting gene ontology annotations of orphan GWAS genes using protein-protein interactions
  Kuppuswamy, Algorithms for molecular biology : AMB 2014
  • “...YFR032C-A, YIL069C GO:0050790 18/20 YGR162W, YLR455W, YNL031C, YMR124W, YLR019W, YGL140C, YEL025C, YMR031C, YBR079C, YFR016C, YJL084C, YBL002W, YJR056C, YDR334W, YPL282C, YNL301C, YMR144W, YLR419W, YKL219W GO:0009966 18/20 YHR155W, YJL084C, YDR520C, YHL004W, YER033C, YNL289W, YKR104W, YKL209C, YBR071W, YGR162W, YOR077W, YIR016W, YHL029C, YGR054W, YDL123W, YCR030C, YOR166C, YNL208W Table shows the...”
• Vesicle and vesicle-free extracellular proteome of Paracoccidioides brasiliensis: comparative analysis with other pathogenic fungi
  Vallejo, Journal of proteome research 2012
  • “...HCAG_03885 CNAG_01648 YBR009C 70 NS PADG_05907 histone H2B type 1-A (142 aa) Yes Yes HCAG_03525 YBL002W other/ unknown function 71 - PADG_01509 DUF907 domain-containing protein (746 aa) Yes NF* HCAG_03638 YAL053W* 72 NS PADG_04288 L-PSP endoribonuclease family protein (Hmf1) (168 aa) Yes Yes HCAG_04397 YER057C*...”
• Comparative studies of genome-wide maps of nucleosomes between deletion mutants of elp3 and hos2 genes of Saccharomyces cerevisiae
  Matsumoto, PloS one 2011
  • “...sequences, from 5 to 3) for transcripts of YBL003C; GCTTCTAAATTGGCCGCTTA and GAACCAATTCTCTGGGCGTA for transcripts of YBL002W; TTCTTGGCAAGCATTGACTG and CCCATGGCTGTACCTTTGTT for transcripts of YBR018C; ACCAAGATGCACCGTACCAT and ACCAACTTGGACACGGAAAG for transcripts of YBR048W; ATGCGATCGATTTTTCTGCT and TTAAGGCATTTCCCATCTGC for transcripts of YCR099C; TGGACCCCAAAGAATACGAG and ACAACCGTTCCTGTTGTTCC for transcripts of YDR389W; TGAAAACTTCACAGGGAGAAA and...”
• Identification, analysis, and prediction of protein ubiquitination sites
  Radivojac, Proteins 2010
  • “...structure YBR102C EXO84 2d2s:A(2) 523753 5235 100.0 K219 N/A site is not covered by structure YBL002W HTB2 1id3:H(10) 28131 27130 100.0 K124 K123(c) Residues 122, 126 and 128 participate in crystal contacts YGR136W LSB1 1zx6:A(1) 56111 358 73.2 K41, K79 K26(e) Residues 22 26, 29 31...”
• Characterizing the connectivity of poly-ubiquitin chains by selected reaction monitoring mass spectrometry
  Mirzaei, Molecular bioSystems 2010
  • “...quantify changes in the ubiquitination level and inter-link profiles of affinity enriched histone protein Htb2 (YBL002W) as well as the whole cell lysate when yeast cells were treated with MMS, a chemical known to induce DNA damage. 35 It is known that Htb2 ubiquitination is critical...”
• Identification of cis-regulatory elements in gene co-expression networks using A-GLAM
  Mariño-Ramírez, Methods in molecular biology (Clifton, N.J.) 2009
  • “...shared between the genes in the cluster: >B:235796236494, Chr 2 from 235796236494, between YBL003C and YBL002W TATATATTAAATTTGCTCTTGTTCTGTACTTTCCTAATTCTTATGTA AAAAGACAAGAAT TTATGATACTATTTAATAACAAAAAACTACCTAAGAAAAGCATCATGCAG TCGAAATTGA AATCGAAAAGTAAAACTTTAACGGAACATGTTTGAAATTCTAAGAAAGC ATACATCTTCA TCCCTTATATATAGAGTTATGTTTGATATTAGTAGTCATGTTGTAATCT CTGGCCTAAGT ATACGTAACGAAAATGGTAGCACGTCGCGTTTATGGCCCCCAGGTTAAT GTGTTCTCTGA AATTCGCATCACTTTGAGAAATAATGGGAACACCTTACGCGTGAGCTGT GCCCACCGCTT CGCCTAATAAAGCGGTGTTCTCAAAATTTCTCCCCGTTTTCAGGATCAC GAGCGCCATCT AGTTCTGGTAAAATCGCGCTTACAAGAACAAAGAAAAGAAACATCGCGT AATGCAACAGT GAGACACTTGCCGTCATATATAAGGTTTTGGATCAGTAACCGTTATTTG AGCATAACACA GGTTTTTAAATATATTATTATATATCATGGTATATGTGTAAAATTTTTT TGCTGACTGGT TTTGTTTATTTATTTAGCTTTTTAAAAATTTTACTTTCTTCTTGTTAAT TTTTTCTGATT GCTCTATACTCAAACCAACAACAACTTACTCTACAACTA >D:914709915525, Chr 4 from 914709915525, between YDR224C...”
  • “...Runs [ 10] ! Best possible alignment: >B:235796236494, Chr 2 from 235796236494, between YBL003C and YBL002W 365 AGGCGAAGCGGTGGGCACAG 346 (21.29360) (2.820982e-08) 394 GGGAGAAATTTTGAGAACAC 375 (13.97930) (5.205043e-04) 309 ATGCGAATTTCAGAGAACAC 2 90 (11.12770) (5.771870e-03) 314 TTGAGAAATAATGGGAACAC 333 + (9.034960) (2.714569e-02) >D:914709915525, Chr4 from 914709915525, between YDR224C and YDR225W...”
• More

P48989 Histone H2B.1 from Candida albicans (strain SC5314 / ATCC MYA-2876)
86% identity, 38% coverage

• Systematic Analysis of the Lysine Crotonylome and Multiple Posttranslational Modification Analysis (Acetylation, Succinylation, and Crotonylation) in Candida albicans
  Zhou, mSystems 2021
  • “...H2A.2 HTA2 Q5AEE1 48 K Histone H2A.Z HTZ1 Q5AEE1 125 K Histone H2A.Z HTZ1 H2B P48989 17 K Histone H2B.1 HTB1 P48989 18 K Histone H2B.1 HTB1 P48989 23 K Histone H2B.1 HTB1 P48989 31 K Histone H2B.1 HTB1 P48989 47 K Histone H2B.1 HTB1 P48989...”
  • “...Histone H2B.1 HTB1 P48989 83 K Histone H2B.1 HTB1 P48989 89 K Histone H2B.1 HTB1 P48989 112 K Histone H2B.1 HTB1 Q59VP1 83 K Histone H2B.2 HTB2 Q59VP1 89 K Histone H2B.2 HTB2 H3 Q59VN2 80 K Histone H3.1/H3.2 HHT21 Q5ADQ0 57 K Histone H3.3 HHT3...”

KAFR0C00770 uncharacterized protein from Kazachstania africana CBS 2517
84% identity, 39% coverage

• Patterns of Gene Conversion in Duplicated Yeast Histones Suggest Strong Selection on a Coadapted Macromolecular Complex
  Scienski, Genome biology and evolution 2015
  • “...0.015 1,357 1,324 1,316 D 2 e KAFR0F02490 O e KNAG0K01430 HTB2 D 1 e KAFR0C00770 0.030 0.091 1,294 1,259 1,258 D 2 e KAFR0F02480 O e KNAG0K01420 HHF1 D 1 e KAFR0C00700 0.0 0.010 1,251 1,174 1,146 D 2 e KAFR0A01280 O e KNAG0J01060 D...”
  • “...D 2 e KAFR0F02490 0 0.189 O e KNAG0K01430 0.012 0.551 HTB2 D 1 e KAFR0C00770 >0.99 0.008 0.08 0.156 0.011 D 2 e KAFR0F02480 0.015 0.098 O e KNAG0K01420 0.027 0.411 HHF1 D 1 e KAFR0C00700 0.97 0 0.07 0.011 <0.001 D 2 e KAFR0A01280...”

E3JV95 Histone H2B from Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL)
PGTG_01301 histone H2B from Puccinia graminis f. sp. tritici CRL 75-36-700-3
87% identity, 36% coverage

• Proteomic Analysis of UV-B-Induced Virulence-Mutant Strains of Puccinia striiformis f. sp. tritici Based on iTRAQ Technology
  Zhao, Frontiers in microbiology 2020
  • “...Accession Description Treatment combination Folder change Information storage and processing (23) [B]Chromatin structure and dynamics E3JV95 Histone H2B CYR32-61 vs.CYR32 0.74 CYR32-61 vs. CYR32-5 0.76 [J]Translation, ribosomal structure and biogenesis E3KHH0 40S ribosomal protein S22 CYR32-5 vs. CYR32 0.80 F4RAC5 40S ribosomal protein S0 CYR32-5 vs....”
• Comparative transcriptomics of Gymnosporangium spp. teliospores reveals a conserved genetic program at this specific stage of the rust fungal life cycle
  Tao, BMC genomics 2019
  • “...Hypothetical protein MELLADRAFT_49061 c14029_g2 1772.19 2196 no Hypothetical protein MELLADRAFT_72270 c12350_g1 1604.07 434 no Histone PGTG_01301 c7823_g1 1589.52 1667 no Hypothetical protein PGTG_11071 c31399_g1 1589.15 534 no No hit found c2267_g1 1524.26 852 yes No hit found c13642_g1 1452.79 2299 no Hypothetical protein PGTG_15958 c1160_g1 1438.03...”

orf19.1052 histone H2B from Candida albicans (see paper)
Q59VP1 Histone H2B.2 from Candida albicans (strain SC5314 / ATCC MYA-2876)
84% identity, 38% coverage

• CharProtDB CGD description: Predicted histone H2B
• Systematic Analysis of the Lysine Crotonylome and Multiple Posttranslational Modification Analysis (Acetylation, Succinylation, and Crotonylation) in Candida albicans
  Zhou, mSystems 2021
  • “...Histone H2B.1 HTB1 P48989 89 K Histone H2B.1 HTB1 P48989 112 K Histone H2B.1 HTB1 Q59VP1 83 K Histone H2B.2 HTB2 Q59VP1 89 K Histone H2B.2 HTB2 H3 Q59VN2 80 K Histone H3.1/H3.2 HHT21 Q5ADQ0 57 K Histone H3.3 HHT3 Q5ADQ0 80 K Histone H3.3 HHT3...”

H2B1_SCHPO / P04913 Histone H2B-alpha; H2B.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
htb1 / RF|NP_588181.1 histone H2B Htb1 from Schizosaccharomyces pombe (see paper)
NP_588181 histone H2B Htb1 from Schizosaccharomyces pombe
SPCC622.09 histone H2B (alpha) (PMID 3018512) from Schizosaccharomyces pombe
82% identity, 40% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Interacts with rik1.
• CharProtDB Source (per GeneDB): GeneDB_Spombe
• The SUN-family protein Sad1 mediates heterochromatin spatial organization through interaction with histone H2A-H2B
  Sun, Nature communications 2024
  • “...tag. The S. pombe H2B/H2A or H2B/H2A-RFP heterodimer was obtained by separately cloning H2B (Uniprot: P04913) and H2A (Uniprot: P04909) (or H2A-RFP) into the first and second promoters of the modified pCDF-Duet vector, respectively. The fusion proteins of S. pombe H2AB (H2B 32-126 -H2A 15-108 )...”
• CRL4(Wdr70) regulates H2B monoubiquitination and facilitates Exo1-dependent resection.
  Zeng, Nature communications 2016
  • GeneRIF: CRL4(Wdr70) regulates H2B monoubiquitination and facilitates Exo1-dependent DNA repair resection.
• Histone H2B ubiquitylation represses gametogenesis by opposing RSC-dependent chromatin remodeling at the ste11 master regulator locus.
  Materne, eLife 2016
  • GeneRIF: Therefore, ubiquitylated histone H2B represses gametogenesis by opposing the recruitment of RSC complex proteins at the promoter of the master regulator ste11 gene.
• A positive feedback loop links opposing functions of P-TEFb/Cdk9 and histone H2B ubiquitylation to regulate transcript elongation in fission yeast.
  Sansó, PLoS genetics 2012
  • GeneRIF: Transcription elongation in fission yeast is regulated by opposing functions of P-TEFb/Cdk9 and histone H2B ubiquitylation.
• Post-Translational Modifications of Histones Are Versatile Regulators of Fungal Development and Secondary Metabolism
  Etier, Toxins 2022
  • “...(AN3468) ( B ). H2B alignment of S. cerevisiae (YDR224C), C. albicans (C3_03900C_A), S. pombe (SPCC622.09), N. crassa (NCU02435), F. graminearum (FGRAMPH1_01G26111), A. nidulans (AN3469) ( C ). H3 alignment of S. cerevisiae (YBR010W), C. albicans (C1_04260W_A), S. pombe (SPBC1105.11c), N. crassa (NCU01635), F. graminearum (FGRAMPH1_01G14931),...”
• Histone H2B Ubiquitylation Regulates Histone Gene Expression by Suppressing Antisense Transcription in Fission Yeast
  Pagé, Genetics 2019
  • “...SPBC32F12.16 SPCC645.02 SPAC144.07c SPAC1834.03c SPCC622.09 SPBC3D6.04c SPAC31G5.12c SPAC688.02c SPCP1E11.03 SPBC32H8.06 SPAC25H1.06 SPAC3C7.10 SPCC24B10.22...”
• A novel histone deacetylase complex in the control of transcription and genome stability
  Zilio, Molecular and cellular biology 2014
  • “...SPBC12C2.10c SPBC1734.16c SPBC16G5.15c SPCC1259.07 SPCC622.09 SPCC1682.13 SPBC428.06c Multiple SPAC14C4.12c SPAC17A2.13c SPAC8E11.02c SPBC646.10c SPBC1D7.04...”
• A chromatin-remodeling protein is a component of fission yeast mediator
  Khorosjutina, The Journal of biological chemistry 2010
  • “...SPBC1105.12 and SPBC8D2.03c Histone H3: SPBC8D2.04; histone 2B, SPCC622.09 VOLUME 285 * NUMBER 39 * SEPTEMBER 24, 2010 Downloaded from http://www.jbc.org/ at...”

SPPG_02345 histone H2B from Spizellomyces punctatus DAOM BR117
83% identity, 39% coverage

• Genetic transformation of Spizellomyces punctatus, a resource for studying chytrid biology and evolutionary cell biology
  Medina, eLife 2020
  • “...and GFP fluorescence from pGI3EM plasmids transformed into Saccharomyces . We identified H2A (SPPG_02344), H2B (SPPG_02345), and HSP70 (SPPG_04820) genes and promoters from FungiDB (RRID: SCR_006013 ) by blasting human homologs against the Spun genome. The promoter DNA was cloned from Spizellomyces genomic DNA (gDNA) isolated...”
  • “.... pGI3EM20B ( H2Bpr-H2B-tdTomato-ScADH1ter:H2Apr-hph-ScADH1ter ) took advantage of a divergent Spizellomyces H2A (SPPG_02344) and H2B (SPPG_02345) promoter to express an H2B-tdTomato fusion in one direction (H2B promoter) and hph in the other direction (H2A promoter). The shared promoter region of H2B and H2A corresponds to 217...”

XP_002179210 histone H2B isoform 1b from Phaeodactylum tricornutum CCAP 1055/1
80% identity, 44% coverage

• An integrative analysis of post-translational histone modifications in the marine diatom Phaeodactylum tricornutum
  Veluchamy, Genome biology 2015
  • “...Saccharomyces cerevisiae (CAA81267), Leishmania infantum (CAD11891), Dictyostelium discoideum (XP_636327), Giardia intestinalis (ESU37209)]; [H2B: Phaeodactylum tricornutum (XP_002179210), Thalassiosira pseudonana (XP_002290856), Saccharomyces cerevisiae (CAA81268), Arabidopsis thaliana (NP_180440), Chlamydomonas reinhardtii (XP_001700194), Drosophila melanogaster (NP_724342), Caenorhabditis elegans (NP_505464), Homo sapiens (NP_003510), Giardia intestinalis (ESU39253), Paramecium tetraurelia (XP_001428087), Leishmania infantum (XP_001470056),...”

Q27876 Probable histone H2B 4 from Caenorhabditis elegans
79% identity, 42% coverage

• Futile attempts to differentiate provide molecular evidence for individual differences within a population of cells during cellular reprogramming.
  Hoffmann, FEMS microbiology letters 2012
  • “...Q8H100 3.00E023 52.00 hcpA Histone chaperone ASF1A Q2KIG1 5.00E062 82.00 hstA Probable histone H2B 4 Q27876 1.00E041 43.00 ligA Checkpoint protein hus1 homologue 1 (LigA) Q54NC0 1.00E028 94.00 meiB Meiosis protein mei2 Q64M78.1 9.00E064 27.00 nhpA Nonhistone chromosomal protein 6 Q4PBZ9 5.00E017 30.00 pakA Serine/threonine protein...”

NP_505464 putative histone H2B 3 from Caenorhabditis elegans
79% identity, 42% coverage

• An integrative analysis of post-translational histone modifications in the marine diatom Phaeodactylum tricornutum
  Veluchamy, Genome biology 2015
  • “...(XP_002290856), Saccharomyces cerevisiae (CAA81268), Arabidopsis thaliana (NP_180440), Chlamydomonas reinhardtii (XP_001700194), Drosophila melanogaster (NP_724342), Caenorhabditis elegans (NP_505464), Homo sapiens (NP_003510), Giardia intestinalis (ESU39253), Paramecium tetraurelia (XP_001428087), Leishmania infantum (XP_001470056), Dictyostelium discoideum (XP_628972)]; [H1: Drosophila melanogaster (NP_724341), Homo sapiens (NP_722575), Chlamydomonas reinhardtii (XP_001693443), Arabidopsis thaliana (AAD20121), Caenorhabditis elegans...”

LOAG_10011 hypothetical protein from Loa loa
79% identity, 43% coverage

• Identification and Validation of Loa loa Microfilaria-Specific Biomarkers: a Rational Design Approach Using Proteomics and Novel Immunoassays
  Drame, mBio 2016
  • “...2 171.1 8.8 1E05 13 Yes LOAG_09325 Hypothetical protein 2 33.0 68.3 1E13 27 Yes LOAG_10011 Hypothetical protein 2 13.6 3,257.3 7E66 98 Yes LOAG_16297 Hypothetical protein 2 14.3 0.4 5E 04 67 No LOAG_17249 Pyruvate kinase 2 59.0 609.7 0E+00 99 Yes LOAG_17808 PWWP domain-containing...”

NP_496892 Histone H2B 1 from Caenorhabditis elegans
79% identity, 43% coverage

• Structural Insights into ceNAP1 Chaperoning Activity toward ceH2A-H2B.
  Liu, Structure (London, England : 1993) 2019 (PubMed)
  • GeneRIF: Molecular characterization of NAP1 chaperoning activity toward histones H2A/H2B has been reported.

Q27894 Histone H2B 2 from Caenorhabditis elegans
79% identity, 42% coverage

• Altered proteostasis in aging and heat shock response in C. elegans revealed by analysis of the global and de novo synthesized proteome
  Liang, Cellular and molecular life sciences : CMLS 2014
  • “...Cohesin complex subunit 1.9 Q23670 top-2 DNA topoisomerase 2.0 Histones P62784 his-1 Histone H4 1.8 Q27894 his-4 Histone H2B2 3.1 P10771 his-24 Histone H1.1 1.8 Q10453 his-71 Histone H3.3 type 1 2.7 Transport P91276 ima-2 Importin subunit alpha-2 1.8 O17915 ran-1 GTP-binding nuclear protein 1.8 Others...”

Bm1_02510, Bm3206 histone H2B 2, putative from Brugia malayi
79% identity, 36% coverage

• Release of Small RNA-containing Exosome-like Vesicles from the Human Filarial Parasite Brugia malayi
  Zamanian, PLoS neglected tropical diseases 2015
  • “...A8Q8U0_BRUMA Ras-related protein Bm4628 A8NSV0_BRUMA Ubiquitin Bm5528 A8NHQ1_BRUMA 1,4-alpha-glucan branching enzyme BM-DLST-1 A8PU77_BRUMA 2-oxoglutarate dehydrogenase Bm3206 A8NHD8_BRUMA Histone H2B Bm3425 A8NHD2_BRUMA Histone H3 Bm4113 A8Q1K1_BRUMA Histone H4 Ribosomal Proteins BM-RPS-16 A8P1D4_BRUMA 40S ribosomal protein S16 Bm2853 A8Q0J1_BRUMA 40S ribosomal protein S2 Bm2320 A8NXR7_BRUMA 40S ribosomal protein...”
• A potential role for the interaction of Wolbachia surface proteins with the Brugia malayi glycolytic enzymes and cytoskeleton in maintenance of endosymbiosis
  Melnikow, PLoS neglected tropical diseases 2013
  • “...Fructose-bisphosphate aldolase ** EDP36623.1 Bm1_15350 5 Triosephosphate isomerase ** EDP33878.1 Bm1_29130 4 Histone H2B EDP39185.1 Bm1_02510 3 L-lactate dehydrogenase ** EDP30958.1 Bm1_43730 3 Myotactin form B, putative EDP28983.1 Bm1_53510 3 High mobility group protein 1 EDP34582.1 Bm1_25620 3 Enolase ** EDP34873.1 Bm1_24115 2 Glyceraldehyde-3-phosphate dehydrogenase **...”

4m6bD / P02293,Q12692 Crystal structure of yeast swr1-z domain in complex with h2a.Z-h2b dimer (see paper)
85% identity, 26% coverage

• Ligand: peptide (4m6bD)

LOC106533547 late histone H2B.L4-like from Austrofundulus limnaeus
75% identity, 45% coverage

• Transcriptomic analysis of maternally provisioned cues for phenotypic plasticity in the annual killifish, Austrofundulus limnaeus
  Romney, EvoDevo 2017
  • “...Protein coding 4858 LOC106532313 Uncharacterized lncRNA 4619 LOC106518911 Uncharacterized lncRNA 4331 LOC106512296 Uncharacterized lncRNA 4322 LOC106533547 Late histone H2B.L4 - like Protein coding 4219 LOC106530205 Ribosyldihydronicotinamide dehydrogenase [quinone] Pseudogene 3774 LOC106512721 Uncharacterized lncRNA 3752 LOC106511212 Zinc finger protein 36, C3H1 type - like 2 Protein coding...”

NP_180440 histone H2B, putative from Arabidopsis thaliana
AT2G28720 Histone superfamily protein from Arabidopsis thaliana
78% identity, 34% coverage

• An integrative analysis of post-translational histone modifications in the marine diatom Phaeodactylum tricornutum
  Veluchamy, Genome biology 2015
  • “...Giardia intestinalis (ESU37209)]; [H2B: Phaeodactylum tricornutum (XP_002179210), Thalassiosira pseudonana (XP_002290856), Saccharomyces cerevisiae (CAA81268), Arabidopsis thaliana (NP_180440), Chlamydomonas reinhardtii (XP_001700194), Drosophila melanogaster (NP_724342), Caenorhabditis elegans (NP_505464), Homo sapiens (NP_003510), Giardia intestinalis (ESU39253), Paramecium tetraurelia (XP_001428087), Leishmania infantum (XP_001470056), Dictyostelium discoideum (XP_628972)]; [H1: Drosophila melanogaster (NP_724341), Homo sapiens...”
• Advances in biological functions and mechanisms of histone variants in plants
  Wu, Frontiers in genetics 2023
  • “...al. (2020) AT1G52740 MBD9 AT3G54560 INO80 H2B H2B.1 AT1G07790 NAP1 NRP1 FACT H2B.2 AT5G22880 H2B.3 AT2G28720 H2B.4 AT5G59910 H2B.5 AT2G37470 H2B.6 AT3G53650 H2B.7 AT3G09480 H2B.8 AT1G08170 Regulate seed development but not expressed in sperm cells H2B.9 AT3G45980 H2B.10 AT5G02570 H2B.11 AT3G46030 H3 H3.3 AT4G40030 HIRA Transcriptional...”
• Transcriptomic Analysis Reveals LncRNAs Associated with Flowering of Angelica sinensis during Vernalization
  Liu, Current issues in molecular biology 2022
  • “...and HMGB3 ), DNA/RNA ( At1g05910, RID2 and At4g26600 ) and protein modification ( H2AV, At2g28720, HTR2, HOS15, REF6, SKP1A, ASK21, SRK2G, SRK2H, DET1, BOPAt4g295601, At1g45180, At3g50840, At2g36630, At3g47890, UBP7, DER2.1, GRP3, MDH9.13, At3g24715, At3g16560, At3g62260, ESMD1, and At1g27930 ) ( Table 2 ). The expression...”
  • “...in regulating transcription, repairing DNA, replicating DNA, and stabilizing the nucleus chromosome [ 46 ]; At2g28720 and HTR2 are involved in compacting DNA into chromatin [ 47 , 48 ]; HOS15 promotes the deacetylation of histone H4 [ 49 ]; REF6 is involved in demethylating Lys-27...”
• Histone variants and modifications during abiotic stress response
  Nunez-Vazquez, Frontiers in plant science 2022
  • “...Transcriptional regulation, replacement variant ( Jiang etal., 2020a ) H2B.2 Variant At5g22880, HTB2 H2B.3 Variant At2g28720, HTB3 H2B.4 Variant At5g59910, HTB4 H2B.5 Variant At2g37470, HTB5 H2B.6 Variant At3g53650, HTB6 H2B.7 Variant At3g09480, HTB7 Development of reproductive tissues ( Jiang etal., 2020a ) H2B.8/H2B.S Variant At1g08170, HTB8...”
• Endophytic Bacillus altitudinis Strain Uses Different Novelty Molecular Pathways to Enhance Plant Growth
  Zhang, Frontiers in microbiology 2021
  • “...Trihelix transcription factor ASR3 AT1G66390 7.1 Transcription factor MYB90 AT1G21120 7.0 O -methyltransferase family protein AT2G28720 6.3 Histone AT1G56250 6.2 F-box protein VBF AT2G16600 6.0 Peptidyl-prolyl cistrans isomerase AT5G23750 5.6 Remorin family protein AT3G52280 5.5 General transcription factor group E6 AT1G68790 5.4 Protein CROWDED NUCLEI AT2G40880...”
• Plant Histone HTB (H2B) Variants in Regulating Chromatin Structure and Function
  Khadka, Plants (Basel, Switzerland) 2020
  • “...HTB variants can be divided into three classes. Class I contains HTB1(At1g07790), HTB2 (At5g22880), HTB3 (At2g28720), HTB4 (At5g59910), HTB9 (At3g45980), and HTB11 (At3g46030) and class II HTB5 (At2g37470), HTB6 (At3g53650), HTB7 (At3g09480), and HTB10 (At5g02570). Class I variants can be further divided into class I-A (H2B4,...”
• The evolution and functional divergence of the histone H2B family in plants
  Jiang, PLoS genetics 2020
  • “...cultures. Gene name AGI Peaktime Rank HTB1 AT1G07790 non-periodic 411 HTB2 AT5G22880 S 291 HTB3 AT2G28720 non-periodic 3805 HTB4 AT5G59910 S 314 HTB5 AT2G37470 S 83 HTB6 AT3G53650 S 223 HTB9 AT3G45980 S 110 HTB11 AT3G46030 S 75 Data from Cyclebase 3.0 (REF) To test the...”
• A Biostimulant Obtained from the Seaweed Ascophyllum nodosum Protects Arabidopsis thaliana from Severe Oxidative Stress
  Omidbakhshfard, International journal of molecular sciences 2020
  • “...MLP-like protein 43 AT1G75690 184.17 98.65 215.40 223.10 DnaJ/Hsp40 AT1G78070 43.04 33.13 77.16 73.50 Transducin/WD40 AT2G28720 95.98 74.93 131.89 151.73 HTB3 Histone super family protein AT2G41090 300.65 461.43 464.31 652.82 CML10 Calcium-binding EF-hand family protein AT2G44940 7.88 6.32 20.17 28.83 Integrase-type DNA-binding...”
• Establishment of Dimethyl Labeling-based Quantitative Acetylproteomics in Arabidopsis
  Liu, Molecular & cellular proteomics : MCP 2018
  • “...(Fig. 3E). A histone superfamily protein (AT2G28720) has an ethylene hormone-suppressed double acetylation UPA, AT2G28720-K39K40, whereas the same...”
  • “...factor EMB2726 (AT4G29060) (E), histone superfamily protein (AT2G28720) (F), heat shock protein 90 -7 (AT4G24190) (G), AAC1, ADP/ATP carrier 1 (AT3G08580)...”
• More

Q6DH91 Histone H2B from Danio rerio
75% identity, 44% coverage

• Comparison of proteomic profiles in the zebrafish retina during experimental degeneration and regeneration
  Eastlake, Scientific reports 2017
  • “...of histone H2B ( Table 1 ). Three different isoforms of histone H2B (Accession: G1K2L0, Q6DH91, F1QIH4), were found to be expressed at different levels. It was also observed that Q6DH91 and F1QIH4 were 2-fold upregulated in the regenerating retina as compared to control retina, whilst...”
  • “...product 1 54 1.32 4.17 3.16 DNA binding G1K2L0 Histone H2B 52 4.76 0.76 0.16 Q6DH91 Histone H2B 16 1.47 4.41 3.00 F1QIH4 Histone H2B 67 1.78 2.28 1.28 Signalling molecule Q7ZVG7 Fibrinogen gamma polypeptide 109 13.05 0.74 0.056 Q6NYE1 Fibrinogen B beta polypeptide 90 6.32...”

H2B11_ARATH / P40283 Histone H2B.11; HTB4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT5G59910 HTB4; DNA binding from Arabidopsis thaliana
78% identity, 34% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Advances in biological functions and mechanisms of histone variants in plants
  Wu, Frontiers in genetics 2023
  • “...AT1G52740 MBD9 AT3G54560 INO80 H2B H2B.1 AT1G07790 NAP1 NRP1 FACT H2B.2 AT5G22880 H2B.3 AT2G28720 H2B.4 AT5G59910 H2B.5 AT2G37470 H2B.6 AT3G53650 H2B.7 AT3G09480 H2B.8 AT1G08170 Regulate seed development but not expressed in sperm cells H2B.9 AT3G45980 H2B.10 AT5G02570 H2B.11 AT3G46030 H3 H3.3 AT4G40030 HIRA Transcriptional activation Flowering...”
• The tomato chloroplast stromal proteome compendium elucidated by leveraging a plastid protein-localization prediction Atlas
  Bhattacharya, Frontiers in plant science 2023
  • “...transcription factors & histones Solyc03g120840 TINY-like Ethylene-responsive transcription factor (TINY-like) At5g11590 Solyc06g074780 H2B.1-like Histone H2B.1-like At5g59910 Solyc01g079110 Histone H3.2-like Histone H3 variant At4g40030 Solyc04g081150 Histone H3.2-like Histone H3 variant At4g40030 Solyc08g061140 OCP3 Over-expression of cationic peroxidase At5g11270 Solyc02g072260 SAP-like protein BP-73 Solyc05g010070 Zinc finger family protein,...”
• Construction and analysis of protein-protein interaction networks based on nuclear proteomics data of the desiccation-tolerant Xerophyta schlechteri leaves subjected to dehydration stress
  Shoko, Communicative & integrative biology 2023
  • “...AT2G38810 Probable histone H2A variant 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9SII0] gi|7576225 AT3G48870 Chaperone protein ClpC2, chloroplastic [Source:UniProtKB/Swiss-Prot;Acc:Q9SJ7] gi|98960893 AT5G59910 HTB4 [Source:UniProtKB/TrEMBL;Acc:A0A384KCB6] gi|73921087 AT2G34160 Uncharacterized protein At2g34160 [Source:UniProtKB/Swiss-Prot;Acc:O22969] gi|79314743 AT3G51260 Proteasome subunit alpha type [Source:UniProtKB/TrEMBL;Acc:A0A178VPE4] gi|7630068 AT3G58730 V-type proton ATPase subunit D [Source:UniProtKB/Swiss-Prot;Acc:Q9GM1] gi|6714442 AT3G05680 Protein virilizer homolog [Source:UniProtKB/Swiss-Prot;Acc:F4J8G7] gi|9757906...”
• LEAFY homeostasis is regulated via ubiquitin-dependent degradation and sequestration in cytoplasmic condensates
  Dolde, iScience 2023
  • “...the GenBank/EMBL libraries under the following accession numbers: LFY (At1g78870), UFO (At1g16890), URI (AT3G19860), Actin2 (At5g59910), AP3 (AT3G54340). References 1 Moyroud E. Kusters E. Monniaux M. Koes R. Parcy F. LEAFY blossoms Trends Plant Sci. 15 2010 346 352 10.1016/j.tplants.2010.03.007 20413341 2 Huala E. Sussex I.M....”
• Histone variants and modifications during abiotic stress response
  Nunez-Vazquez, Frontiers in plant science 2022
  • “...( Jiang etal., 2020a ) H2B.2 Variant At5g22880, HTB2 H2B.3 Variant At2g28720, HTB3 H2B.4 Variant At5g59910, HTB4 H2B.5 Variant At2g37470, HTB5 H2B.6 Variant At3g53650, HTB6 H2B.7 Variant At3g09480, HTB7 Development of reproductive tissues ( Jiang etal., 2020a ) H2B.8/H2B.S Variant At1g08170, HTB8 Regulation of seed formation...”
• A microProtein repressor complex in the shoot meristem controls the transition to flowering
  Rodrigues, Plant physiology 2021
  • “...Prey X a At3g50500 SNRK2-2, SNRK2.2, SPK-2-2, SRK2D, SNF1-related protein kinase 2.2 Prey X X At5g59910 HTB4, Histone superfamily protein Prey X X At5g65430 14-3-3KAPPA, GF14 KAPPA, GRF8, general regulatory factor 8 Prey X X a a Identified in only one replicate. To experimentally validate that...”
• Plant Histone HTB (H2B) Variants in Regulating Chromatin Structure and Function
  Khadka, Plants (Basel, Switzerland) 2020
  • “...can be divided into three classes. Class I contains HTB1(At1g07790), HTB2 (At5g22880), HTB3 (At2g28720), HTB4 (At5g59910), HTB9 (At3g45980), and HTB11 (At3g46030) and class II HTB5 (At2g37470), HTB6 (At3g53650), HTB7 (At3g09480), and HTB10 (At5g02570). Class I variants can be further divided into class I-A (H2B4, 9, and...”
• The evolution and functional divergence of the histone H2B family in plants
  Jiang, PLoS genetics 2020
  • “...Peaktime Rank HTB1 AT1G07790 non-periodic 411 HTB2 AT5G22880 S 291 HTB3 AT2G28720 non-periodic 3805 HTB4 AT5G59910 S 314 HTB5 AT2G37470 S 83 HTB6 AT3G53650 S 223 HTB9 AT3G45980 S 110 HTB11 AT3G46030 S 75 Data from Cyclebase 3.0 (REF) To test the link between H2B.3 and...”
• More

H2B2E_MOUSE / Q64524 Histone H2B type 2-E; H2B-clustered histone 21; H2b 613 from Mus musculus (Mouse) (see 6 papers)
NP_835586 histone H2B type 2-E from Mus musculus
77% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Transcriptome analysis of the white body of the squid Euprymna tasmanica with emphasis on immune and hematopoietic gene discovery
  Salazar, PloS one 2015
  • “...signaling 69% EKC18748 2.66E-30 Histone h2b type 2-e-like Mus musculus Response to Gram-negative bacterium 86% NP_835586 1.61E-53 Lectin receptor kinase Arabidopsis thaliana Plant immune defense 42% AEE79957 4E-6 Heat shock protein 70 Azumapecten farreri Response to stress 91% AAO38780 0 MACPF domain containing protein Mytilus galloprovincialis...”
• Investigating the Therapeutic Mechanisms of Total Saikosaponins in Alzheimer's Disease: A Metabolomic and Proteomic Approach.
  Wei, Pharmaceuticals (Basel, Switzerland) 2025
  • “...Q6ZPQ6 Pitpnm2 up 0.289453333 0.01947 O88809 Dcx up 0.303026667 0.013699 Q60625 Icam5 up 0.283706667 0.044947 Q64524 H2bc21 down 0.51608 0.005131 P97792 Cxadr up 0.30167 0.03135 Q7TPR4 Actn1 up 0.416243333 0.00801 Q9R257 Hebp1 up 0.301436667 0.035898 P35282 Rab21 down 0.295966667 0.024016 G5E829 Atp2b1 up 0.278036667 0.04069 P26040...”
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...H2B clustered histone 18 Hist2h2bb MGI:2448413 Q64525 H2B* H2bc21 H2B clustered histone 21 Hist2h2be MGI:2448415 Q64524 H2B H2bc22 H2B clustered histone 22 Hist1h2bp MGI:2448409 Q8CGP2 H2B H2bc23 H2B clustered histone 23 Hist1h2bq MGI:3702051 Q8CBB6 H2B H2bc24 H2B clustered histone 24 Hist1h2br MGI:3710645 Q8CBB6 NA H2bc26-ps H2B...”
• miR-29a/b₁ Regulates the Luteinizing Hormone Secretion and Affects Mouse Ovulation
  Guo, Frontiers in endocrinology 2021
  • “...kDa 0.00035 1.33 O55100 Syngr1 Synaptogyrin-1 OS=Mus musculus GN=Syngr1 PE=1 SV=2 26 kDa 0.0039 1.33 Q64524 Hist2h2be Histone H2B type 2-E OS=Mus musculus GN=Hist2h2be PE=1 SV=3 14 kDa 0.0039 1.32 Q9QXF8 Gnmt Glycine N-methyltransferase OS=Mus musculus GN=Gnmt PE=1 SV=3 33 kDa 0.0039 1.32 Q8VDW0 Ddx39a ATP-dependent...”
• Mass spectrometry-based analysis of murine bronchoalveolar lavage fluid following respiratory exposure to 4,4'-methylene diphenyl diisocyanate aerosol
  Hettick, Xenobiotica; the fate of foreign compounds in biological systems 2018
  • “...Up Q3U7H1 Napsin A 45 515 +2.95 Up Q8CGP7 Histone H2A 14 140 +2.89 Up Q64524 Histone H2B 13 984 +2.62 Up Q542G9 Annexin 38 651 +2.55 Up Q5FWJ3 Vimentin 53 655 +2.44 Up P09041 Phosphoglycerate kinase 2 44 824 +2.43 Up D3YYR8 Serotransferrin 25 658...”
  • “...+4.36 Up P08113 Endoplasmin 92 418 +3.07 Up Q3U7H1 Napsin A 45 515 +2.91 Up Q64524 Histone H2B 13 984 +2.51 Up Q8CGP7 Histone H2A 14 140 +2.44 Up P09041 Phosphoglycerate kinase 2 44 824 +2.43 Up Q9D7P7 Chloride intracellular channel protein 3 26 828 2.01...”
• TMT-Based Quantitative Proteomics Analysis Reveals Airborne PM_2.5-Induced Pulmonary Fibrosis
  Liu, International journal of environmental research and public health 2018
  • “...PID1 1.298 PTB-containing, cubilin and LRP1-interacting protein P20852 CYP2A5 0.584 Cytochrome P450 2A5 Immune response Q64524 H2BE 2.130 Histone H2B type 2-E Q08857 CD36 1.428 Platelet glycoprotein 4 Q9Z0F8 ADAM17 1.302 Disintegrin and metalloproteinase domain-containing protein 17 P08122 COL4A2 1.319 Collagen alpha-2(IV) chain P02463 COL4A1 1.313...”
• Comprehensive characterization of the adult ND4 Swiss Webster mouse retina: Using discovery-based mass spectrometry to decipher the total proteome and phosphoproteome
  Harman, Molecular vision 2018
  • “...B2 4394.09 306.20 1921 23.4 7.01 Q9D6F9 Tubulin beta-4A chain 4210.18 486.37 1887 49.6 4.88 Q64524 Histone H2B type 2-E 4786.94 91.90 1875 14.0 10.32 P20612 Guanine nucleotide-binding protein G(t) subunit alpha-1 3889.71 344.74 1833 39.9 5.62 P68368 Tubulin alpha-4A chain 4309.22 325.60 1785 49.9 5.06...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...] Canonical H2B gene: Hist2h2bb Hist2h2bb Q64525 [ 41 ] Canonical H2B gene: Hist2h2be Hist2h2be Q64524 [ 41 ] Canonical H2B gene: Hist3h2ba Hist3h2ba Q9D2U9 [ 41 ] Canonical H2B gene: Hist3h2bb Hist3h2bb Q8CGP0 * TS H2B.1 (TH2B) TS H2B.1 (TH2B) Hist1h2ba P70696 [ 41 ,...”
• Phosphoinositide-specific phospholipase C β 1b (PI-PLCβ1b) interactome: affinity purification-mass spectrometry analysis of PI-PLCβ1b with nuclear protein.
  Piazzi, Molecular & cellular proteomics : MCP 2013

X1WHF1 Histone H2B from Danio rerio
77% identity, 42% coverage

• The Zebrafish Sperm Proteome
  Cohen-Krais, Proteomics 2025 (no snippet)

A7E2M8 Histone H2B from Danio rerio
77% identity, 42% coverage

• iTRAQ-Based Quantitative Proteomic Analysis of the Initiation of Head Regeneration in Planarians.
  Geng, PloS one 2015
  • “...10.7 39.4 3 0.38 0.53 P0C0S7 Histone H2A.Z H2AFZ 13.5 10.6 31.3 2 0.68 0.74 A7E2M8 Histone H2B HIST2H2BE 13.6 10.4 48.4 2 0.50 0.53 A3KPR4 Histone H4 HIST1H4A 11.4 11.4 53.4 3 0.61 0.71 Q6NYV3 Histone H1.0 H1F0 21.2 10.9 9.6 2 0.24 0.28 B8JN00...”

H2B1F_MOUSE / P10853 Histone H2B type 1-F/J/L; H2B 291A from Mus musculus (Mouse) (see 6 papers)
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...H2B clustered histone 6 Hist1h2be MGI:2448380 Q6ZWY9 H2B H2bc7 H2B clustered histone 7 Hist1h2bf MGI:2448383 P10853 H2B H2bc8 H2B clustered histone 8 Hist1h2bg MGI:2448386 Q6ZWY9 H2B H2bc9 H2B clustered histone 9 Hist1h2bh MGI:2448387 Q64478 H2B H2bc11 H2B clustered histone 11 Hist1h2bj MGI:2448388 P10853 H2B H2bc12 H2B...”
  • “...H2B clustered histone 14 Hist1h2bm MGI:2448404 P10854 H2B H2bc15 H2B clustered histone 15 Hist1h2bn MGI:2448407 P10853 H2B H2bc18 H2B clustered histone 18 Hist2h2bb MGI:2448413 Q64525 H2B* H2bc21 H2B clustered histone 21 Hist2h2be MGI:2448415 Q64524 H2B H2bc22 H2B clustered histone 22 Hist1h2bp MGI:2448409 Q8CGP2 H2B H2bc23 H2B...”
• Identification of chronic brain protein changes and protein targets of serum auto-antibodies after blast-mediated traumatic brain injury
  Harper, Heliyon 2020
  • “...(+1) 16 kDa 6 P61358 Rpl27 Histone H2B type 1-F/J/L IPI00114642 (+10) 14 kDa 5 P10853 Hist1h2bf Hemoglobin subunit beta-1 IPI00762198 (+3) 16 kDa 5 P02088 Hbb-b1 40S ribosomal protein S15 IPI00319231 (+1) 17 kDa 4 P62843 Rps15 Isoform 2 of 40S ribosomal protein S24 IPI00402981...”
• Cellular consequences of arginine methylation.
  Lorton, Cellular and molecular life sciences : CMLS 2019
• Use of Proteomic Imaging Coupled With Transcriptomic Analysis to Identify Biomolecules Responsive to Cochlear Injury
  Noble, Frontiers in molecular neuroscience 2018
  • “...2-C Q64523 14 11 7 Histone H2A.Z P0C0S6 14 6 0 Histone H2B type 1-F/J/L P10853 14 6 4 Histone H3.3C P02301 15 3 3 Histone H4 P62806 11 6 2 Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial P70404 43 2 0 Lactoylglutathione lyase Q9CPU0 21...”
• Diverse Protein Profiles in CNS Myeloid Cells and CNS Tissue From Lipopolysaccharide- and Vehicle-Injected APPSWE/PS1ΔE9 Transgenic Mice Implicate Cathepsin Z in Alzheimer's Disease.
  Thygesen, Frontiers in cellular neuroscience 2018
  • “...Q50HX4 Rab14 0.58 P10107 Anxa1 0.568 Q9D2V7 Coro7 0.552 Q53X15 S100a8 0.549 P51437 Camp 0.54 P10853 Hist1h2bf 0.539 Q9R0G6 Comp 0.539 Q921I1 Tf 0.378 P84244 H3f3a 0.266 Proteins were considered up-regulated when the ratio was >1.3 and down-regulated when the ratio was <0.7. Regulated proteins were...”
• Proteomic Analysis of Secretomes of Oncolytic Herpes Simplex Virus-Infected Squamous Cell Carcinoma Cells.
  Tada, Cancers 2018
  • “...HSP 90-alpha 85 57.7 49.7 1.16 0.052 P10107 Annexin A1 39 30.0 29.0 1.03 0.75 P10853 Histone H2B type 1-F/J/L 14 27.3 29.3 0.93 0.71 P63038 60-kDa heat shock protein, mitochondrial 61 32.3 20.3 1.59 0.22 P16045 Galectin-1 15 22.3 19 .0 1.18 0.067 P07356 Annexin...”
• Characterisation of adipocyte-derived extracellular vesicle subtypes identifies distinct protein and lipid signatures for large and small extracellular vesicles
  Durcin, Journal of extracellular vesicles 2017
  • “...NA Q68FD5 CLH1 Clathrin heavy chain 1 4.2 6.5E-04 24.5/17 3.9E-01 Nucleic acid binding proteins P10853 H2B1F Histone H2B type 1-F/J/L 5.6 3.0E-02 6.5/3.5 NA P62806 H4 Histone H4 4.5 2.5E-02 13.5/9.5 NA P14206 RSSA 40S ribosomal protein SA 1.8 3.6E-02 3.5/3.5 NA Q9EQK5 MVP Major...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...Hist1h2bg Q6ZWY9 [ 41 ] Canonical H2B genes: Hist1h2bf, Hist1h2bj, Hist1h2bl, Hist1h2bn, Hist1h2bq, Hist1h2br Hist1h2bf P10853 [ 41 ] Hist1h2bj P10853 [ 41 ] Hist1h2bl P10853 [ 41 ] Hist1h2bn P10853 [ 41 ] Hist1h2bq P10853 [ 41 ] Hist1h2br P10853 [ 41 ] Canonical H2B...”
• More

H2B1L_HUMAN / Q99880 Histone H2B type 1-L; Histone H2B.c; H2B/c from Homo sapiens (Human) (see 7 papers)
NP_003510 histone H2B type 1-L from Homo sapiens
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...No H2B1J P06899 H2BC11 6p22.2 Replication dependent H2B1K O60814 H2BC12 6p22.2 Replication dependent Yes H2B1L Q99880 H2BC13 6p22.1 Replication dependent No H2B1M Q99879 H2BC14 6p22.1 Replication dependent No H2B1N Q99877 H2BC15 6p22.1 Replication dependent No H2B1O P23527 H2BC17 6p22.1 Replication dependent No H2B2F Q5QNW6 H2BC18 1q21.2...”
• Transcriptome and proteomic analysis of mpox virus F3L-expressing cells
  Wang, Frontiers in cellular and infection microbiology 2024
  • “...H2AZ1 114.72 9906006.25 Q8WVV4 POF1B 48.81 57664823.88 P14136 GFAP 35.54 11165431.38 P60660 MYL6 20.05 2084907.94 Q99880 H2BC13 9.05 130966.13 P31943 HNRNPH1 9.03 63684.57 Q92841 DDX17 8.87 3004703.25 Q8IYB1 MB21D2 7.99 12719.68 Q02880 TOP2B 5.39 35568.86 P52434 POLR2H 4.81 668328.69 P52907 CAPZA1 4.2 191452.03 Q16531 DDB1 1.99...”
• ARID3C Acts as a Regulator of Monocyte-to-Macrophage Differentiation Interacting with NPM1.
  Kim, Journal of proteome research 2024
  • “...24 26.4315 26.3275 NaN NaN 21 44 P21333 25 28.5898 28.4875 NaN NaN 7 43 Q99880 26 29.063 29.0558 NaN NaN 7 42 P40925 27 26.7091 26.7141 NaN NaN 7 39 P40926 28 26.7967 26.5888 NaN NaN 6 37 P37802 29 26.4339 26.5495 NaN NaN 15...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* P06899 Histone H2B type 1-J 17593.68 * O60814 Histone H2B type 1-K 16807.41 * Q99880 Histone H2B type 1-L 16807.41 * Q99879 Histone H2B type 1-M 16807.41 * Q99877 Histone H2B type 1-N 16807.41 * P23527 Histone H2B type 1-O 17593.68 * Q16778 Histone H2B...”
• OncoRTT: Predicting novel oncology-related therapeutic targets using BERT embeddings and omics features
  Thafar, Frontiers in genetics 2023
  • “...expression RPL10L Q96L21 0.9568 Ribosomal Protein L10 Like 0 Linked to other cancer HIST1H2BL (H2BC13) Q99880 0.9363 H2B Clustered Histone 13 5 Text mining, Genetic association, RNA expression ALDH8A1 Q9H2A2 0.9322 Aldehyde Dehydrogenase 8 Family Member A1 0 Linked to other cancer CACNA1S Q13698 0.9199 Calcium...”
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...Histone H2B type 1-A HIST1H2BA 1.483903394 0.56939717 P62807 Histone H2B type 1-C/E/F/G/I HIST1H2BC 1.483903394 0.56939717 Q99880 Histone H2B type 1-L HIST1H2BL 1.483903394 0.56939717 Q16778 Histone H2B type 2-E HIST2H2BE 1.483903394 0.56939717 Q8N257 Histone H2B type 3-B HIST3H2BB 1.483903394 0.56939717 Q99879 Histone H2B type 1-M HIST1H2BM 1.483903394...”
  • “...Histone H2B type 1-A HIST1H2BA 0.323611545 1.627665 P62807 Histone H2B type 1-C/E/F/G/I HIST1H2BC 0.323611545 1.627665 Q99880 Histone H2B type 1-L HIST1H2BL 0.323611545 1.627665 Q16778 Histone H2B type 2-E HIST2H2BE 0.323611545 1.627665 Q8N257 Histone H2B type 3-B HIST3H2BB 0.323611545 1.627665 Q99879 Histone H2B type 1-M HIST1H2BM 0.323611545...”
• Unraveling molecular characteristic of fluoride neurotoxicity on U87 glial-like cells: insights from transcriptomic and proteomic approach.
  Puty, Frontiers in cellular neuroscience 2023
  • “...type 1-J + 489.46 + 489.46 O60814 Histone H2B type 1-K + 489.46 + 489.46 Q99880 Histone H2B type 1-L + 489.46 + 489.46 Q99879 Histone H2B type 1-M + 489.46 + 489.46 Q99877 Histone H2B type 1-N + 489.46 + 489.46 P23527 Histone H2B type...”
• Towards the Definition of the Molecular Hallmarks of Idiopathic Membranous Nephropathy in Serum Proteome: A DIA-PASEF Approach.
  Previtali, International journal of molecular sciences 2023
  • “...H2B1D_HUMAN; H2B1C_HUMAN; H2B2F_HUMAN; H2B1H_HUMAN; H2B1N_HUMAN; H2B1M_HUMAN; H2B1L_HUMAN O60814; P57053; P58876; P62807; Q5QNW6; Q93079; Q99877; Q99879; Q99880 H2BC12; H2BC12L; H2BC5; H2BC4; H2BC18; H2BC9; H2BC15; H2BC14; H2BC13 Histone H2B type 1-K; Histone H2B type F-S; Histone H2B type 1-D; Histone H2B type 1-C/E/F/G/I; Histone H2B type 2-F; Histone...”
• More
• An integrative analysis of post-translational histone modifications in the marine diatom Phaeodactylum tricornutum
  Veluchamy, Genome biology 2015
  • “...(CAA81268), Arabidopsis thaliana (NP_180440), Chlamydomonas reinhardtii (XP_001700194), Drosophila melanogaster (NP_724342), Caenorhabditis elegans (NP_505464), Homo sapiens (NP_003510), Giardia intestinalis (ESU39253), Paramecium tetraurelia (XP_001428087), Leishmania infantum (XP_001470056), Dictyostelium discoideum (XP_628972)]; [H1: Drosophila melanogaster (NP_724341), Homo sapiens (NP_722575), Chlamydomonas reinhardtii (XP_001693443), Arabidopsis thaliana (AAD20121), Caenorhabditis elegans (NP_491678), Saccharomyces cerevisiae...”
• Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
  Martins-de-Souza, Journal of proteome research 2012 (PubMed)
  • GeneRIF: A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
• Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
  Flachsbart, Mutation research 2010 (PubMed)
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)

A0JLV3 Histone H2B (Fragment) from Mus musculus
75% identity, 42% coverage

• Suppressor of cytokine signaling (SOCS)5 ameliorates influenza infection via inhibition of EGFR signaling
  Kedzierski, eLife 2017
  • “...NET-associated protein Q3UV87 Chitinase-3-like protein 3 (YM1) Chi3l3 1.65 1.53E-06 9 6 Produced by neutrophils A0JLV3 Histone H2B Hist1h2bj 1.32 9.49E-04 3 3 NET-associated protein G3 9V0 Proteasome activator complex subunit 2 Psme2 1.63 1.36E-02 7 5 Q5RKN9 F-actin-capping protein subunit alpha-1 Capza1 1.65 1.48E-02 4...”
• Comparative proteomic analysis identifies age-dependent increases in the abundance of specific proteins after deletion of the small heat shock proteins αA- and αB-crystallin.
  Andley, Biochemistry 2013
  • “...Alpha-2-macroglobulin, Q61838 2 166 Glutamate dehydrogenase 1, mitochondrial P26443 2 61 6278 Histone H2B (fragment), A0JLV3 8 14 1.28 2.7 2.1 catenin -1, Q02248 4 85 Serine/threonine-protein kinase MRCK beta, Q7TT50 3 195 Histone H2A type 1, P22752 3 14 -1-antitrypsin 14, Q00897 2 46 Liver...”
  • “...P22599 2 46 6308 catenin -1, Q02248 8 85 1.22 2.37 1.93 Histone H2B (fragment), A0JLV3 5 14 Histone H2A type 1, P22752 5 14 MCG140784, Q792Z1 4 26 Rho guanine nucleotide exchange factor 1, Q61210 3 103 Serine/threonine-protein kinase MRCK beta, Q7TT50 2 195 60S...”

H2B1_CHLRE / P50565 Histone H2B.1; H2B-I from Chlamydomonas reinhardtii (Chlamydomonas smithii) (see 2 papers)
78% identity, 33% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA

H2B1P_MOUSE / Q8CGP2 Histone H2B type 1-P from Mus musculus (Mouse) (see 6 papers)
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Retinal Proteomic Analysis in a Mouse Model of Endotoxin-Induced Uveitis Using Data-Independent Acquisition-Based Mass Spectrometry
  Zhang, International journal of molecular sciences 2022
  • “...Hp Haptoglobin 11.649 0.000 Q91X72 Hpx Hemopexin 4.584 0.000 P43274 H14 Histone H1.4 4.519 0.019 Q8CGP2 Hist1h2bp Histone H2B type 1-P 4.344 0.010 Q3UER8 Fgg Fibrinogen gamma chain 4.177 0.000 E9PV24 Fga Fibrinogen alpha chain 3.690 0.000 Q64525 Hist2h2bb Histone H2B type 2-B 3.307 0.013 Q9D0J8...”
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...H2B clustered histone 21 Hist2h2be MGI:2448415 Q64524 H2B H2bc22 H2B clustered histone 22 Hist1h2bp MGI:2448409 Q8CGP2 H2B H2bc23 H2B clustered histone 23 Hist1h2bq MGI:3702051 Q8CBB6 H2B H2bc24 H2B clustered histone 24 Hist1h2br MGI:3710645 Q8CBB6 NA H2bc26-ps H2B clustered histone 26, pseudogene Hist3h2bb-ps MGI:1922442 NA H2B H2bc27...”
• TBC1D10C is a cytoskeletal functional linker that modulates cell spreading and phagocytosis in macrophages
  Villagomez, Scientific reports 2021
  • “...H4 11.4 330.8 6 47.6 P62754 RS6_MOUSE 40S ribosomal protein S6 28.7 179.7 3 15.7 Q8CGP2 H2B1P_MOUSE Histone H2B type 1-P 14.0 146.7 3 26.2 P35550 FBRL_MOUSE rRNA 2'-O-methyltransferase fibrillarin 34.3 140.5 3 12.5 Q6ZWV3 RL10_MOUSE 60S ribosomal protein L10 24.6 138.3 2 11.2 Q9CRB2 NHP2_MOUSE...”
• Comprehensive characterization of the adult ND4 Swiss Webster mouse retina: Using discovery-based mass spectrometry to decipher the total proteome and phosphoproteome
  Harman, Molecular vision 2018
  • “...H2AX 5508.91 70.28 2570 15.1 10.74 P68372 Tubulin beta-4B chain 5916.98 532.34 2554 49.8 4.89 Q8CGP2 Isoform 2 of Histone H2B type 1-P 5841.76 104.21 2503 15.6 10.24 Q7TMM9 Tubulin beta-2A chain 5662.93 522.47 2448 49.9 4.89 Q9CWF2 Tubulin beta-2B chain 5564.75 526.13 2400 49.9 4.89...”
• Dgat1 and Dgat2 regulate enterocyte triacylglycerol distribution and alter proteins associated with cytoplasmic lipid droplets in response to dietary fat.
  Hung, Biochimica et biophysica acta. Molecular and cell biology of lipids 2017
  • “...Q99L04 Mitochondria/Redox Histone H2A type 1-H Hist1h2ah Q8CGP6 Nucleosome Assembly Histone H2B type 1-P Hist1h2bp Q8CGP2 Nucleosome Assembly Histone H4 Hist1h4a P62806 Nucleosome Assembly Heat shock protein HSP 90-beta Hsp90ab1 P11499 Protein Folding 14-3-3 protein zeta/delta Ywhaz P63101 Protein Localization/Transport Alpha-actinin-4 Actn4 P57780 Protein Localization/Transport Annexin...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...Hist1h2bm Hist1h2bm P10854 [ 41 ] Canonical H2B gene: Hist1h2bp Spliced isoform 1 (main) Hist1h2bp Q8CGP2 [ 41 ] Canonical H2B gene: hist1h2bp (putative spliced isoform) Hist1h2bp Q8CGP2-2 [ 41 ] Canonical H2B gene: Hist2h2bb Hist2h2bb Q64525 [ 41 ] Canonical H2B gene: Hist2h2be Hist2h2be Q64524...”
• The nonpolymorphic MHC Qa-1b mediates CD8+ T cell surveillance of antigen-processing defects.
  Oliveira, The Journal of experimental medicine 2010
  • “...P28658 Ataxin-10 35 PADIVKNLK 12-20 341 Q8VDZ8 Calcium binding protein 39 36 PDTGISSKA 52-60 126 Q8CGP2 Histone H2B type 1-P 37 PEAFPALA 385-392 392 Q9CY58 Plasminogen activator inhibitor 1 RNA-binding protein 38 PNKLVELNK 138-146 943 Q6DFV7 Nuclear receptor coactivator 7 39 PPSAKAAID 97-105 323 Q5SSG6 TATA...”
• Targeted tandem affinity purification of PSD-95 recovers core postsynaptic complexes and schizophrenia susceptibility proteins.
  Fernández, Molecular systems biology 2009
  • “...folding/signalling Hspa12a Heat shock protein 12A Q8K0U4 2 DNA binding Hist1h2bj * Histone 1, H2bb Q8CGP2 3 3 Transcription/translation Eef1a1* Eukaryotic translation elongation factor 1 alpha 1 P10126 2 2 Lsm11 U7 snRNP-specific Sm-like protein LSM11 Q8BUV6 2 3 Unclassified Clu Clusterin Q06890 2 3 Lancl1...”

LOC103381126 histone H2B type 2-F-like from Cynoglossus semilaevis
75% identity, 41% coverage

• Mucosal Exosome Proteomics of Hybrid Grouper Epinephelus fuscoguttatus♀ × E. lanceolatus♂ Infected by Pseudomonas plecoglossicida
  Yang, Animals : an open access journal from MDPI 2024
  • “...Similarly, Zhao et al. [ 15 ] proposed aminopeptidase (Anpep), calcium-transporting ATPase (LOC103382755), histone H2B (LOC103381126), and histone H2A (LOC103381127) as candidate biomarkers in mucus, potentially replacing exosomes as a pool for bacterium-infected markers in C. semilaevis . Interestingly, in contrast to our findings, these proteins...”

H2B2_CHLRE / P54345 Histone H2B.2; H2B-II from Chlamydomonas reinhardtii (Chlamydomonas smithii) (see 2 papers)
78% identity, 32% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA

H2B1B_MOUSE / Q64475 Histone H2B type 1-B; H2B-clustered histone 3; h2B-143 from Mus musculus (Mouse) (see 6 papers)
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...H2B clustered histone 1 Hist1h2ba MGI:2448375 P70696 H2B H2bc3 H2B clustered histone 3 Hist1h2bb MGI:2448377 Q64475 H2B H2bc4 H2B clustered histone 4 Hist1H2bc MGI:1915274 Q6ZWY9 H2B H2bc6 H2B clustered histone 6 Hist1h2be MGI:2448380 Q6ZWY9 H2B H2bc7 H2B clustered histone 7 Hist1h2bf MGI:2448383 P10853 H2B H2bc8 H2B...”
• Enzymatic extraction improves intracellular protein recovery from the industrial carrageenan seaweed Eucheuma denticulatum revealed by quantitative, subcellular protein profiling: A high potential source of functional food ingredients.
  Gregersen, Food chemistry: X 2021
  • “...c13559_g1_i1 c6825_g1_i1 13.5 1.6% 2.9% 2.2% 0.5% 0.3% 0.5% 0.0% 0.2% 4.8% 8.1% 8.1% 6.6% Q64475 432 Cytoplasm c14987_g1_i1 43.1 0.0% 0.0% 0.0% 0.2% 0.0% 0.0% 0.0% 2.2% 0.0% 0.0% 0.0% 0.2% Q93Y35 900 Cytoplasm c1505_g2_i1 15.8 33.8% 26.9% 27.4% 27.7% 38.8% 32.7% 30.8% 29.2% 31.7%...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...[ 39 , 40 , 99 ] H2B Canonical H2B Canonical H2B gene: Hist1h2bb Hist1h2bb Q64475 [ 41 ] Canonical H2B genes: Hist1h2bc, Hist1h2be, Hist1h2bg Hist1h2bc Q6ZWY9 [ 41 ] Hist1h2be Q6ZWY9 [ 41 ] Hist1h2bg Q6ZWY9 [ 41 ] Canonical H2B genes: Hist1h2bf, Hist1h2bj, Hist1h2bl,...”
• Effect of diets supplemented with different conjugated linoleic acid (CLA) isomers on protein expression in C57/BL6 mice.
  Della, Genes & nutrition 2016
  • “...41.8 5.2 606 P68033 9 Histone H2B type 1-B (H2B1B) Hist1h2bb 27 13.8 10.3 67 Q64475 10 Peptidyl prolyl cistrans isomerase C (PPIC) Ppic 14 22.8 7.0 172 P30412 11 2 Amino 3 ketobutyrate CoA ligase (KBL) Goat 39 42.8 6.5 2133 O88986 12 Triosephosphate isomerase...”
• Proteomic studies of nitrated alpha-synuclein microglia regulation by CD4+CD25+ T cells.
  Reynolds, Journal of proteome research 2009
  • “...-value Histone H4 P62806 IPI00407339 11367 11.21 Nucleus nucleosome component 3 -1.56 0.021 Histone H2B Q64475 IPI00554853 13592 10.31 Nucleus nucleosome component 2 -2.28 Heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) Q8BG05 IPI00269661 39652 8.46 Nucleus cytoplasmic trafficking of RNA 5 -1.62 GTP-binding nuclear protein Ran P62827...”
• Linking microarray reporters with protein functions
  Gaj, BMC bioinformatics 2007
  • “...were respectively "Histone H2A type 1" [Swiss-Prot: P22752 ], "Histone H2B type 1-B (h2B-143)" [Swiss-Prot: Q64475 ] and three other family members, while for A_66_P110436 they were "Ankyrin repeat domain-containing protein 40" [Swiss-Prot: Q5SUE8 ] and "Cisplatin resistance-associated overexpressed protein" [Swiss-Prot: Q5SUF2 ]. In both cases...”

H2B1A_MOUSE / P70696 Histone H2B type 1-A; Histone H2B, testis; Testis-specific histone H2B from Mus musculus (Mouse) (see 4 papers)
NP_783594 histone H2B type 1-A from Mus musculus
75% identity, 41% coverage

• function: Variant histone specifically required to direct the transformation of dissociating nucleosomes to protamine in male germ cells (PubMed:23884607, PubMed:28366643). Entirely replaces classical histone H2B prior nucleosome to protamine transition and probably acts as a nucleosome dissociating factor that creates a more dynamic chromatin, facilitating the large-scale exchange of histones (PubMed:23884607). In condensing spermatids, the heterodimer between H2AB1 and H2BC1/TH2B is loaded onto the nucleosomes and promotes loading of transition proteins (TNP1 and TNP2) onto the nucleosomes (PubMed:28366643). Inclusion of the H2AB1-H2BC1/TH2B dimer into chromatin opens the nucleosomes, releasing the nucleosomal DNA ends and allowing the invasion of nucleosomes by transition proteins (TNP1 and TNP2) (PubMed:28366643). Then, transition proteins drive the recruitment and processing of protamines, which are responsible for histone eviction (PubMed:28366643). Also expressed maternally and is present in the female pronucleus, suggesting a similar role in protamine replacement by nucleosomes at fertilization (PubMed:23884607). Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers (PubMed:23884607). Interacts with H2AB1; preferentially dimerizes with H2AB1 to form nucleosomes (PubMed:28366643).
• Differential localization of histone variant TH2B during the first round compared with subsequent rounds of spermatogenesis.
  Beedle, Developmental dynamics : an official publication of the American Association of Anatomists 2019
  • GeneRIF: TH2B and ZBTB16 co-localize in the neonatal testis. Upon the appearance of the primary spermatocytes, TH2B no longer co-localized with the ZBTB16 positive spermatogonia but were instead detected within the differentiating spermatogonia.
• Histone H2B monoubiquitination regulates heart development via epigenetic control of cilia motility.
  Robson, Proceedings of the National Academy of Sciences of the United States of America 2019
  • GeneRIF: These data suggest that Rnf20 functions at the Rfx3 locus regulating cilia motility and cardiac situs and identify H2Bub1 as an upstream transcriptional regulator controlling tissue-specific expression of cilia genes. Our findings mechanistically link the two functional gene ontologies that have been implicated in human CHD: chromatin remodeling and cilia function.
• RNF20 Links Histone H2B Ubiquitylation with Inflammation and Inflammation-Associated Cancer.
  Tarcic, Cell reports 2016
  • GeneRIF: RNF20 and H2Bub1 promotes chronic colonic inflammation and inflammation-associated colorectal cancer in mice and humans, partly by augmenting NF-kappaB activity and attenuating the antitumoral T cell response.
• Disruption of Th2a and Th2b genes causes defects in spermatogenesis.
  Shinagawa, Development (Cambridge, England) 2015 (PubMed)
  • GeneRIF: These results suggest that a loss of TH2A and TH2B function in chromatin dynamics or a decrease in the total histone levels causes defects in both cohesin release and histone replacement during spermatogenesis.
• Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming.
  Padavattan, Biochemical and biophysical research communications 2015 (PubMed)
  • GeneRIF: Crystal structure and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming.
• Actin cytoskeleton differentially alters the dynamics of lamin A, HP1α and H2B core histone proteins to remodel chromatin condensation state in living cells.
  Toh, Integrative biology : quantitative biosciences from nano to macro 2015 (PubMed)
  • GeneRIF: demonstrate an actin-driven differential modulation of core histone H2B and heterochromatin HP1alpha protein dynamics with chromatin
• Chromatin-to-nucleoprotamine transition is controlled by the histone H2B variant TH2B.
  Montellier, Genes & development 2013
  • GeneRIF: TH2B is a unique histone variant that plays a key role in the histone-to-protamine packing of the male genome and guides genome-wide chromatin transitions that both precede and follow transmission of the male genome to the egg.
• MAP3K4/CBP-regulated H2B acetylation controls epithelial-mesenchymal transition in trophoblast stem cells.
  Abell, Cell stem cell 2011
  • GeneRIF: MAP3K4/CBP-regulated acetylation controls epithelial-mesenchymal transition in trophoblast stem cells
• More
• CHARGE syndrome-associated proteins FAM172A and CHD7 influence male sex determination and differentiation through transcriptional and alternative splicing mechanisms.
  Bélanger, FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2022
  • “...28 0.296 40S ribosomal protein S16 Rps16 P14131 16 0.295 Histone H2B type 1A Hist1h2ba P70696 14 0.288 40S ribosomal protein S15a Rps15a P62245 15 0.281 1433 protein epsilon Ywhae P62259 29 0.257 ATP synthase subunit alpha Atp5a1 Q03265 55 0.255 40S ribosomal protein S7 Rps7...”
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...name Previous symbol MGI ID UniProt ID H2B H2bc1 H2B clustered histone 1 Hist1h2ba MGI:2448375 P70696 H2B H2bc3 H2B clustered histone 3 Hist1h2bb MGI:2448377 Q64475 H2B H2bc4 H2B clustered histone 4 Hist1H2bc MGI:1915274 Q6ZWY9 H2B H2bc6 H2B clustered histone 6 Hist1h2be MGI:2448380 Q6ZWY9 H2B H2bc7 H2B...”
• Inflammation leads to distinct populations of extracellular vesicles from microglia
  Yang, Journal of neuroinflammation 2018
  • “...101 P35979 RPL12 60S ribosomal protein L12 101 P14131 RPS16 40S ribosomal protein S16 100 P70696 HIST1H2BA Histone H2B type 1-A 100 P12970 RPL7A 60S ribosomal protein L7a 98 P60710 ACTB Actin, cytoplasmic 1 94 Q9CXW4 RPL11 60S ribosomal protein L11 85 Q9CZM2 RPL15 60S ribosomal...”
  • “...ribosomal protein L4 P35979 RPL12 60S ribosomal protein L12 P14131 RPS16 40S ribosomal protein S16 P70696 HIST1H2BA Histone H2B type 1-A P12970 RPL7A 60S ribosomal protein L7a P60710 ACTB Actin, cytoplasmic 1 Q9CXW4 RPL11 60S ribosomal protein L11 Q9CZM2 RPL15 60S ribosomal protein L15 P02301 H3F3C...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...] Canonical H2B gene: Hist3h2bb Hist3h2bb Q8CGP0 * TS H2B.1 (TH2B) TS H2B.1 (TH2B) Hist1h2ba P70696 [ 41 , 79 ] subH2B (H2BL.1) subH2B (H2BL.1) 1700024p04rik Q9D9Z7 [ 38 , 100 ] H2B.L.2 H2B.L.2 H2bfm Q9DAB5 [ 38 ] H3 Canonical H3.1 Canonical H3.1 Hist1h3a P68433...”
• Phosphoinositide-specific phospholipase C β 1b (PI-PLCβ1b) interactome: affinity purification-mass spectrometry analysis of PI-PLCβ1b with nuclear protein.
  Piazzi, Molecular & cellular proteomics : MCP 2013
• Specialized compartments of cardiac nuclei exhibit distinct proteomic anatomy.
  Franklin, Molecular & cellular proteomics : MCP 2011

P35069 Histone H2B.3 from Tigriopus californicus
75% identity, 42% coverage

• Shotgun proteomics as a viable approach for biological discovery in the Pacific oyster.
  Timmins-Schiffman, Conservation physiology 2013
  • “...kinase O15990 A,B,C,D CGI_10022730 Actin O17320 A,B,C,D CGI_10008058 Histone H2A P02269 A,B,C,D CGI_10008057 Histone H2B.3 P35069 A,B,C,D CGI_10008056 Histone H4 Q28DR4 A,B,C,D CGI_10025180 Peptidyl-prolyl cis-trans isomerase P54985 A,B,C,D CGI_10004092 Extracellular superoxide dismutase Q08420 A,B,C,D CGI_10006610 Cytosol aminopeptidase Q65FE6 A,B,C,D CGI_10013347 ATP synthase subunit Q05825 A,B,D CGI_10012330...”

B0WZ30 Histone H2B from Culex quinquefasciatus
75% identity, 42% coverage

• Proteome-wide analysis of Anopheles culicifacies mosquito midgut: new insights into the mechanism of refractoriness
  Vijay, BMC genomics 2018
  • “...culicifacies in species B S.no UniProt no. Protein coverage Peptides M.wt (kDa) Function Ratio 1. B0WZ30 Histone H2B (similar to Culex quinquefasciatus ) 32 5 13.8 DNA binding 0.61 2. Q1HQX3 AAEL012326-PA (similar to Aedes aegypti ) 31 6 16.8 calcium ion binding 0.62 3. F5HME4...”

H2B3_CHLRE / P54346 Histone H2B.3; H2B-III from Chlamydomonas reinhardtii (Chlamydomonas smithii) (see 2 papers)
78% identity, 33% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• High light-induced changes in whole-cell proteomic profile and its correlation with the organization of thylakoid super-complex in cyclic electron transport mutants of Chlamydomonas reinhardtii
  Yadav, Frontiers in plant science 2023 (no snippet)

A0JNS9 Histone H2B from Mus musculus
75% identity, 41% coverage

• Specialized compartments of cardiac nuclei exhibit distinct proteomic anatomy.
  Franklin, Molecular & cellular proteomics : MCP 2011
• The nonpolymorphic MHC Qa-1b mediates CD8+ T cell surveillance of antigen-processing defects.
  Oliveira, The Journal of experimental medicine 2010
  • “...Aralar2 69 AGIENKFGLYLP 648-659 676 Q9QXX4 Calcium-binding mitochondrial carrier protein Aralar2 70 TKAVTKYTSSK 117-127 127 A0JNS9 Histone H2B 71 GTKAVTKYTSSK 116-127 127 A0JNS9 Histone H2B 72 SEGTKAVTKYTSSK 114-127 127 A0JNS9 Histone H2B 73 VSEGTKAVTKYTSSK 113-127 127 A0JNS9 Histone H2B 74 AVSEGTKAVTKYTSSK 112-127 127 A0JNS9 Histone H2B...”

H2B4_CHLRE / P54347 Histone H2B.4; H2B-IV from Chlamydomonas reinhardtii (Chlamydomonas smithii) (see 2 papers)
78% identity, 33% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• High light-induced changes in whole-cell proteomic profile and its correlation with the organization of thylakoid super-complex in cyclic electron transport mutants of Chlamydomonas reinhardtii
  Yadav, Frontiers in plant science 2023 (no snippet)

H2B1K_MOUSE / Q8CGP1 Histone H2B type 1-K from Mus musculus (Mouse) (see 6 papers)
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• ISG15 Is Required for the Dissemination of Vaccinia Virus Extracellular Virions
  Bécares, Microbiology spectrum 2023
  • “...Ddx5 1.02 3.00 P43275 Histone H1.1 H1-1 0.93 3.00 P43276 Histone H1.5 H1-5 0.93 6.00 Q8CGP1 Histone H2B type 1-K H2bc12 0.93 2.36 P15864 Histone H1.2 H1-2 0.91 3.70 C0HKE1 Histone H2A type 1-B H2ac4 0.85 3.20 P27661 Histone H2AX H2ax 0.78 2.80 P97315 Cysteine and...”
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...H2B clustered histone 11 Hist1h2bj MGI:2448388 P10853 H2B H2bc12 H2B clustered histone 12 Hist1h2bk MGI:2448399 Q8CGP1 H2B H2bc13 H2B clustered histone 13 Hist1h2bl MGI:2448403 P10853 H2B H2bc14 H2B clustered histone 14 Hist1h2bm MGI:2448404 P10854 H2B H2bc15 H2B clustered histone 15 Hist1h2bn MGI:2448407 P10853 H2B H2bc18 H2B...”
• Protein identification in imaging mass spectrometry through spatially targeted liquid micro-extractions.
  Ryan, Rapid communications in mass spectrometry : RCM 2018
  • “...in mouse pup full body tissue sections. Accession Number Description Kidney Q91Y97 Fructose-bisphosphate aldolase B Q8CGP1 Histone H2B type 1-K Q8C196 Carbamoyl-phosphate synthase [ammonia] Q9JIL4 Na(+)/H(+) exchange regulatory cofactor NHE-RF3 Q9QXD1 Peroxisomal acyl-coenzyme A oxidase 2 P51667 Myosin regulatory light chain 2 Q9QXD6 Fructose-1,6-bisphosphatase 1 P52825...”
• Isozyme-specific comprehensive characterization of transglutaminase-crosslinked substrates in kidney fibrosis.
  Tatsukawa, Scientific reports 2018
  • “...Fibrinogen chain + + Q9Z2X1 Heterogeneous nuclear ribonucleoprotein F + + Q91X17 Uromodulin + + Q8CGP1 Histone H2B type 1-K + P62960 Nuclease-sensitive element-binding protein 1 + Q9WV32 Actin-related protein 2/3 complex subunit 1B + Q8BSL7 ADP-ribosylation factor 2 + Q8JZQ5 Amiloride-sensitive amine oxidase [copper-containing] +...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...* Canonical H2B gene: Hist1h2bh Hist1h2bh Q64478 [ 41 ] Canonical H2B gene: Hist1h2bk Hist1h2bk Q8CGP1 [ 41 ] Canonical H2B gene: Hist1h2bm Hist1h2bm P10854 [ 41 ] Canonical H2B gene: Hist1h2bp Spliced isoform 1 (main) Hist1h2bp Q8CGP2 [ 41 ] Canonical H2B gene: hist1h2bp (putative...”
• Global identification and analysis of isozyme-specific possible substrates crosslinked by transglutaminases using substrate peptides in mouse liver fibrosis.
  Tatsukawa, Scientific reports 2017
  • “...protein subunit -2-like 1 + Q8CGP5 Histone H2A type 1-F + P27661 Histone H2A.x + Q8CGP1 Histone H2B type 1-K + Q02257 Junction plakoglobin + Q8VD63 REVERSED Testis-specific Y-encoded-like protein 4 + Q9JJZ2 Tubulin -8 chain + Q921H8 3-ketoacyl-CoA thiolase A, peroxisomal + P35979 60S ribosomal...”
• Exploring experimental cerebral malaria pathogenesis through the characterisation of host-derived plasma microparticle protein content
  Tiberti, Scientific reports 2016
  • “...H4_MOUSE Histone H4 Only ID 60 P11672 NGAL_MOUSE Neutrophil gelatinase-associated lipocalin (NGAL) Only ID 61 Q8CGP1 H2B1K_MOUSE Histone H2B type 1-K Only ID 62 P50446 K2C6A_MOUSE Keratin, type II cytoskeletal 6A (CK-6A) Only ID 63 O08677 KNG1_MOUSE Kininogen-1 light chain, Isoform 3 Only ID List of...”
• HDAC 3-selective inhibitor RGFP966 demonstrates anti-inflammatory properties in RAW 264.7 macrophages and mouse precision-cut lung slices by attenuating NF-κB p65 transcriptional activity
  Leus, Biochemical pharmacology 2016
  • “...Second, database search against the selected protein sequences (P43276, P43277, P43274, P43275, P15864, P10853, Q64525, Q8CGP1, P0C0S6, P68433, P62806, Q8CGP6, Q8R1M2, Q64523, P27661, P10922, Q9D1P2, O55128) was performed setting the digestion enzyme to trypsin with up to five allowed missed cleavage sites. 2.18 Statistical analysis Statistical...”
• More

H2B3_SOLLC / O65819 Histone H2B.3; LeH2B-3 from Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (see paper)
76% identity, 37% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA

C5X4Q7 Histone H2B from Sorghum bicolor
78% identity, 34% coverage

• Label-free quantitative proteomics of Sorghum bicolor reveals the proteins strengthening plant defense against insect pest Chilo partellus
  Tamhane, Proteome science 2021
  • “...C5Y2G1 similar to Filamin B like protein Connects cell membrane constituents to actin filaments 23,144 C5X4Q7 Histone H2B DNA binding, Nucleosome assembly 30,485 C5XZI6 similar to B-cell receptor-associated protein 31-like containing protein ER to Golgi vesicle-mediated transport, Intracellular protein transport, B cell receptor-associated protein 31 4299...”

G3HPV7 Histone H4 from Cricetulus griseus
75% identity, 26% coverage

• Perturbing cohesin dynamics drives MRE11 nuclease-dependent replication fork slowing.
  Carvajal-Maldonado, Nucleic acids research 2019
  • “...0.17 N/A 1 G3HDT9 Histone H4 0.04 29.12 6 0.62 118.58 4 0.45 15.90 5 G3HPV7 Histone H4 0.07 21.56 264 0.03 22.53 179 0.13 24.47 196 Replicative Helicase G3H7V9 DNA helicase MCM2 0.01 14.26 67 0.07 23.19 49 0.23 26.90 38 G3I1H0 DNA helicase MCM3...”
• Discovering proteins for chemoprevention and chemotherapy by curcumin in liver fluke infection-induced bile duct cancer
  Khoontawad, PloS one 2018
  • “...0.74 30 G3I4H6 Fructose-bisphosphate aldolase 1.70 1.33 0.80 31 G3IDM2 Cofilin-1 1.70 1.26 0.75 32 G3HPV7 Histone H4 1.67 1.26 0.76 33 G3IAL6 Serum albumin 1.65 1.06 0.64 34 G3H377 Creatine kinase B-type 1.62 1.05 0.68 35 G3IMS5 Serum albumin 1.58 0.95 0.62 36 G3H576 Annexin...”

LOC115819396 uncharacterized protein LOC115819396 from Chanos chanos
75% identity, 11% coverage

• The Proteome and Citrullinome of Hippoglossus hippoglossus Extracellular Vesicles-Novel Insights into Roles of the Serum Secretome in Immune, Gene Regulatory and Metabolic Pathways
  Magnadóttir, International journal of molecular sciences 2021
  • “...(A2M_recep domain-containing, MG2 domain-containing protein) European perch A0A6J2W3P0_CHACN Chanos chanos 8 (7) 312 uncharacterized protein LOC115819396 (Histone H4, Histone H3, Histone H2B) Milkfish * A0A665V532_ECHNA Echeneis naucrates 8 (6) 310 Plasminogen Live sharksucker A0A3Q3L7G2_9TELE Mastacembelus armatus 6 (6) 308 Complement component c3b, tandem duplicate 2 Zig-zag...”

H2B6_ARATH / O23629 Histone H2B.6; H2BAt; HTB9 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
NP_190184 Histone superfamily protein from Arabidopsis thaliana
AT3G45980 HTB9; DNA binding from Arabidopsis thaliana
76% identity, 34% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• The absence of histone H2B monoubiquitination in the Arabidopsis hub1 (rdo4) mutant reveals a role for chromatin remodeling in seed dormancy.
  Liu, The Plant cell 2007
  • GeneRIF: role is proposed for chromatin remodeling in seed dormancy by H2B monoubiquitination through HUB1 and HUB2
• Microgravity induces changes in microsome-associated proteins of Arabidopsis seedlings grown on board the international space station
  Mazars, PloS one 2014
  • “...subcomplex subunit 13-B P56774 ATCG00730 0.39674 Cytochrome b6-f complex subunit 4 (17 kDa polypeptide) Nucleosome O23629 AT3G45980 0.36438 Histone H2B.6 (H2BAt) (HTB9) P26568 AT1G06760 0.46852 Histone H1.1 Q94F49 AT5G27670 0.21652 Probable histone H2A.5 (HTA7) Q9FJE8 AT5G59870 0.23441 Probable histone H2A.7 (HTA6) Q9LQQ4 AT1G07790 0.34323 Histone H2B.1...”
• Revealing cis- and trans-regulatory elements underlying nuclear distribution and function of the Arabidopsis histone H2B.8 variant
  Khadka, BMC plant biology 2024
  • “...and used as a template for PCR amplification of H2B.5 (At2g37470), H2B.8 (At1g08170) and H2B.9 (At3g45980) coding sequences using primers (supplemental Table 1 ) flanked with Bam HI and Sma I sites at the 5 and 3 ends, respectively. Parental plasmid pUC19 - 35S - MBD5...”
• H3.1K27M-induced misregulation of the TSK/TONSL-H3.1 pathway causes genomic instability
  Yuan, 2024
• Do plant histone variants stand idly by while DNA viruses invade the nucleus?
  Jiang, Stress biology 2023
  • “...H3.2 Down 01094g01011 AT1G09200 Unknown Histone H2A.1 Down 00223g03023 AT5G02560 2,3,5,8 Histone H2B.1 Down 00436g10003 AT3G45980 2,3,5 Histone H2B.3 Down 05159g00002 AT3G45980 2,3,5 Histone H2B.1 Down 07275g00001 AT3G45980 2,3,5 Histone H2B.1 Down 05506g00009 AT3G45980 2,3,5 Histone H3.2 Down 02216g02012 AT1G09200 Unknown Histone H3.2 Down 05892g00006 AT1G09200...”
• Advances in biological functions and mechanisms of histone variants in plants
  Wu, Frontiers in genetics 2023
  • “...AT3G53650 H2B.7 AT3G09480 H2B.8 AT1G08170 Regulate seed development but not expressed in sperm cells H2B.9 AT3G45980 H2B.10 AT5G02570 H2B.11 AT3G46030 H3 H3.3 AT4G40030 HIRA Transcriptional activation Flowering time Zhao et al. (2021) ; Male Gametogenesis Ingouff et al. (2010) ; Cell proliferation and organogenesis Otero et...”
• Chromatin remodeling of histone H3 variants underlies epigenetic inheritance of DNA methylation
  Lee, 2023
• Chromatin remodeling of histone H3 variants by DDM1 underlies epigenetic inheritance of DNA methylation
  Lee, Cell 2023
  • “...Histone octamers consisting of Arabidopsis H2A.W (AT5G59870), H3.3 (At5g10980), H3.1 (At1g09200), H2A (AT3G20670) and H2B (AT3G45980), and Xenopus H4 were assembled as described previously 117 . Briefly, core histones were expressed in E. coli , solubilized from inclusion bodies, and purified by sequential anion and cation...”
• Histone variants and modifications during abiotic stress response
  Nunez-Vazquez, Frontiers in plant science 2022
  • “...H2B.8/H2B.S Variant At1g08170, HTB8 Regulation of seed formation ( Jiang etal., 2020a ) H2B.9 Variant At3g45980, HTB9 H2B.10 Variant At5g02570, HTB10 Development of reproductive tissues ( Jiang etal., 2020a ) H2B.11 Variant At3g46030, HTB11 H3 H3.1 Canonical At5g65360, HTR1 CAF1 Transcriptional repression ( Stroud etal., 2012...”
• An alternative splicing variant of PtRD26 delays leaf senescence by regulating multiple NAC transcription factors in Populus
  Wang, The Plant cell 2021
  • “...(Potri.001G248100), DHX15-1 (Potri.002G192500), SL30A-1 (Potri.016G062500), DHX8-1 (Potri.015G024400), SFSWA (Potri.001G356800), AtPRD26/ANAC072 (AT4G27410), SAG12 (AT5G45890), and HTB9 (AT3G45980). Data availability High-resolution temporal profile data have been deposited in the Sequence Read Archive (SRA) ( https://www.ncbi.nlm.nih.gov/sra/ ) with the accession number PRJNA561520. Supplemental data Supplemental Figure 1 . Venn...”
• More

7ybfA / P04910,P04913 Crystal structure of inner membrane protein sad1 in complex with histone h2a-h2b (see paper)
83% identity, 27% coverage

• Ligand: peptide (7ybfA)

P27807 Histone H2B.1 from Triticum aestivum
78% identity, 34% coverage

• In Vitro and In Silico Approaches to Generating and Identifying Angiotensin-Converting Enzyme I Inhibitory Peptides from Green Macroalga Ulva lactuca.
  Garcia-Vaquero, Marine drugs 2019
  • “...AAGAAP 456.499 1.01 0.352249 UniProtKB accession number Q7M1V0 AAK 288.347 0.77 0.113614 UniProtKB accession number P27807 AAL 273.332 0.84 0.310569 UniProtKB accession number A9UGV6 AAS 247.251 0.82 0.123531 UniProtKB accession number A2WQG7 AM 220.287 0.8 0.74549 UniProtKB accession number Q8IWT0 ATKPAN 600.32312 0.88 0.129647 UniProtKB accession...”
• Quantitative proteomics analysis reveals the tolerance of wheat to salt stress in response to Enterobacter cloacae SBP-8
  Singh, PloS one 2017
  • “...starch synthase 1 chloroplastic S31 0 0.477 0.307 P27806 Histone H1 S32 1.786 1.716 0.477 P27807 Histone H2B 1 S33 0.631 0 0.718 P30523 Glucose 1 phosphate adenyltransferase small subunit chloroplastic S34 0.477 0.650 0 P31251 Ubiquitin activating enzyme E1 2 S35 1.552 0.683 0 P31252...”
• Deep sequencing of wheat sRNA transcriptome reveals distinct temporal expression pattern of miRNAs in response to heat, light and UV
  Ragupathy, Scientific reports 2016
  • “...Glutenin; low molecular weight subunit PTDUCD1 precursor Q6ERC2 Cluster: Cytidine/deoxycytidylate deaminase-like protein miR1439 13 1 P27807 Cluster: Histone H2B.1 - DNA binding Unknown Q8GRI3 Cluster: Glutathione transferase F6 Q6RUJ2 Cluster: Glutamine synthetase Q9SWW5 Cluster: Glutathione gamma-glutamylcysteinyltransferase 1 - Phytochelatin biosynthetic pathway Q5QPY8 Cluster: Glycosyltransferase Q9SEW1 Cluster:...”
  • “...NADPH-cytochrome P450 reductase Q5UBW9 Cluster: NAR2.1 Q9ATQ0 Cluster: LRK14 - Ser/Thr kinase miR159 2 1 P27807 Cluster: Histone H2B.1 Q40867 Cluster: Heat shock protein 17.9 Q8LL15 Cluster: Glutathione-S-transferase Q6RZV1 Cluster: 4-nitrophenylphosphatase-like protein Q6ZJ08 Cluster: Monodehydroascorbate reductase Q94KE7 Cluster: Early light-inducible protein ELIP Q66PW8 Cluster: Mitochondrial 2-oxoglutarate/malate...”

E1B8G9 Histone H2B from Bos taurus
73% identity, 41% coverage

• Post translational modifications of milk proteins in geographically diverse goat breeds
  Rout, Scientific reports 2021
  • “...Bos taurus TARP M562 F1MNW4 Inter-alpha-trypsin inhibitor heavy chain H2 Bos taurus ITIH2 M60; M63 E1B8G9 Histone H2B Bos taurus HIST3H2BB M93 F1MQL3 Peptidase S1 domain-containing protein Bos taurus LOC615237 Acetylation Q8IY18 Structural maintenance of chromosomes protein 5 Homo sapiens SMC5 C111 Q71DI3 Histone H3.2 Homo...”

LOC114581794 histone H2B 1/2/3/4/6-like from Podarcis muralis
75% identity, 41% coverage

• Functional Protein Composition in Femoral Glands of Sand Lizards (Lacerta agilis)
  Ibáñez, Molecules (Basel, Switzerland) 2022
  • “...FG-specific *** A0A670K7U8_PODMU Histone H4 101 Podarcis muralis 21 not FG-specific *** A0A670K3F4_PODMU Histone H2B LOC114581794 126 Podarcis muralis 22 not FG-specific *** Antioxidant defense A0A670I2N3_PODMU Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) SOD1 155 Podarcis muralis 17 not FG-specific *** A0A670I4X7_PODMU Thioredoxin domain-containing protein PRDX4 276 Podarcis...”

Q27442 Histone H2B from Anopheles gambiae
75% identity, 42% coverage

• Sustained activation of Akt elicits mitochondrial dysfunction to block Plasmodium falciparum infection in the mosquito host
  Luckhart, PLoS pathogens 2013
  • “...0.011 Q7PPF9 Chromatin integrity gi|55234461|gb| EAA00131.2 histone H2B AGAP012199 [ Anopheles gambiae str. PEST] 0.00068 Q27442 gi|312384904|gb| EFR29519.1 histone H3 AND_23756 [ Anopheles darlingi ] 0.0079 E3WLC5 gi|158298153|gb| XP_318361.3 histone H4 AGAP003909 [ Anopheles gambiae str. PEST] 0.00012 B1Q2A0 Metabolism gi|157015094|gb| EAA12479.4 dihydrolipoamide acetyltransferase AGAP007975 [...”

Smp_036220 putative histone H2B from Schistosoma mansoni
G4V6E9 Histone H2B from Schistosoma mansoni
75% identity, 43% coverage

• Proteomic identification of IPSE/alpha-1 as a major hepatotoxin secreted by Schistosoma mansoni eggs
  Abdulla, PLoS neglected tropical diseases 2011
  • “...18 expressed protein Smp_096790 6 20 4.72 3.90E-08 22.0 9, 13, 14, 16 histone H2B Smp_036220 5 42 3.77 2.20E-06 13.6 9, 11, 12 + aldo-keto reductase Smp_053220.1 7 18 5.07 3.60E-09 35.5 9, 20 + anti-inflammatory protein 16 Smp_113760 10 60 3.04 2.80E-06 9.0 913...”
• A comparative proteomics analysis of the egg secretions of three major schistosome species
  Carson, Molecular and biochemical parasitology 2020
  • “...98 97 96 G4VJT9 Fructose-bisphosphate aldolase Q5DFZ8 Fructose-bisphosphate aldolase A0A095AKM1 Fructose-bisphosphate aldolase 96 97 98 G4V6E9 Histone H2B Q5DDU9 Histone H2B A0A095B4U1 Histone H2B 95 100 95 G4VT44 Putative calmodulin Q5DA21 Calmodulin 3b A0A094ZPX2 Calmodulin 90 97 98 G4M131 Fatty acid binding protein O45035 Fatty acid-binding...”

G3HHM2 Histone H3.1t from Cricetulus griseus
73% identity, 16% coverage

• Perturbing cohesin dynamics drives MRE11 nuclease-dependent replication fork slowing.
  Carvajal-Maldonado, Nucleic acids research 2019
  • “...0.32 21.69 72 G3H2T7 Histone H3 0.07 9.51 122 0.00 18.26 50 0.22 30.15 52 G3HHM2 Histone H3.1t 0.06 24.16 98 0.17 N/A 1 0.17 N/A 1 G3HDT9 Histone H4 0.04 29.12 6 0.62 118.58 4 0.45 15.90 5 G3HPV7 Histone H4 0.07 21.56 264 0.03...”
• Discovering proteins for chemoprevention and chemotherapy by curcumin in liver fluke infection-induced bile duct cancer
  Khoontawad, PloS one 2018
  • “...27 G3I6I6 Tubulin alpha-1A chain 1.78 1.29 0.73 28 G3HG95 Lamin-A/C 1.74 1.39 0.80 29 G3HHM2 Histone H3.1t 1.72 1.18 0.74 30 G3I4H6 Fructose-bisphosphate aldolase 1.70 1.33 0.80 31 G3IDM2 Cofilin-1 1.70 1.26 0.75 32 G3HPV7 Histone H4 1.67 1.26 0.76 33 G3IAL6 Serum albumin 1.65...”

H2B_PENVA / P83863 Histone H2B from Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei) (see 2 papers)
75% identity, 45% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
  function: A mixture of histones H2B and H4 has antimicrobial activity against the Gram-positive bacterium M.luteus.
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA.
• From inside to outside: exploring extracellular antimicrobial histone-derived peptides as multi-talented molecules.
  Muñoz-Camargo, The Journal of antibiotics 2024
  • “...Antibacterial activity E. coli [ 42 ] H2B Litopenaeus vannamei hemocytes H2B 116bp +15.75 TSGKAAKKAGKAQKSITKGDKKKRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK P83863 Antibacterial activity M. luteus 3 M [ 3 ] Human H3.1 Full length H3 136bp +22 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA P68431 Antimicrobial activity P. aeruginosa 128g/mL B. cereus 32g/mL C. albicans 64g/m E....”
• Endogenous molecules induced by a pathogen-associated molecular pattern (PAMP) elicit innate immunity in shrimp.
  Chen, PloS one 2014
  • “...8 + + + Q6PV61 13.3 430 32 21 H2B 7, 8 + + + P83863 12.8 538 21 22 H4 7, 8 + + + P83865 11.4 518 42 23 Rab 11 GTPase 5 + + AER34937 10.9 27 9 *1.Antimicrobial peptides, 2.proPO system, 3....”

F2E328 Histone H2B from Hordeum vulgare subsp. vulgare
78% identity, 34% coverage

• Characterization of the Moroccan Barley Germplasm Preserved in the Polish Genebank as a First Step towards Selecting Forms with Increased Drought Tolerance
  Boczkowska, International journal of molecular sciences 2023
  • “...oxidase 561295698564061223 HORVU6Hr1G087200 J7QBS2 Putative proton-dependent oligopeptide/low-affinity nitrate transporter HORVU6Hr1G086940 A0A287V1V4 BFN domain-containing protein HORVU6Hr1G087190 F2E328 Histone H2B HORVU6Hr1G087090 F2E586 monogalactosyldiacylglycerol synthase HORVU6Hr1G086910 M0Y667 Serine-rich protein...”
• Na2CO3-responsive mechanisms in halophyte Puccinellia tenuiflora roots revealed by physiological and proteomic analyses
  Zhao, Scientific reports 2016
  • “...Paeonia suffruticosa 39,853 9.31 0.1940.005 0.2130.000 0.1050.005 * 0.1060.005 * Chromosome assembly and transcription (4) F2E328 Histone H2B H. vulgare var . distichum 16,236 10.02 0.2150.009 * 0.4710.035 * 0.2390.018 * 0.1940.043 * F2DVK7 Predicted protein, nucleosome assembly protein * (NAP) H. vulgare var . distichum...”

K1PUQ5 Histone H2B from Magallana gigas
75% identity, 42% coverage

• Byssus Structure and Protein Composition in the Highly Invasive Fouling Mussel Limnoperna fortunei.
  Li, Frontiers in physiology 2018
  • “...2 Ala (7.70%) Asp (7.67%) Glu (8.78%) Ile (9.92%) Leu (13.22%) Ser (7.71%) AN_PEROXIDASE comp125734_c0_seq1 K1PUQ5 Histone H2B [ Crassostrea gigas ] 180.88 35.77 4 Ala (6.77%) Asp (6.75%) Gly (10.20%) Ile (9.14%) Leu (14.78%) Lys (6.76%) Thr (8.03%) Val (9.12%) comp155404_c0_seq1 V5LVI9 Heat shock protein...”

P93354 Histone H2B from Nicotiana tabacum
76% identity, 35% coverage

• Characterization of host cell proteins in the downstream process of plant-Based biologics using LC-MS profiling
  Panapitakkul, Biotechnology reports (Amsterdam, Netherlands) 2024
  • “...names p-value Q8S950 Kinesin-like protein NACK1 OS= Nicotiana tabacum OX=4097 GN NACK1 PE=1 SV=1 0.001 P93354 Histone H2B OS= Nicotiana tabacum OX=4097 GN HIS2B PE=2 SV=3 0.003 Q7FNT3 Photosystem II protein D1 OS= Atropa belladonna OX=33,113 GN=psbA PE=3 SV=1 0.005 Q3C1G3 Photosystem II protein D1 OS=...”

H2B_DROME / P02283 Histone H2B from Drosophila melanogaster (Fruit fly) (see paper)
NP_724342 histone H2B from Drosophila melanogaster
Q76FE5 Histone H2B from Drosophila mauritiana
75% identity, 42% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• An integrative analysis of post-translational histone modifications in the marine diatom Phaeodactylum tricornutum
  Veluchamy, Genome biology 2015
  • “...(XP_002179210), Thalassiosira pseudonana (XP_002290856), Saccharomyces cerevisiae (CAA81268), Arabidopsis thaliana (NP_180440), Chlamydomonas reinhardtii (XP_001700194), Drosophila melanogaster (NP_724342), Caenorhabditis elegans (NP_505464), Homo sapiens (NP_003510), Giardia intestinalis (ESU39253), Paramecium tetraurelia (XP_001428087), Leishmania infantum (XP_001470056), Dictyostelium discoideum (XP_628972)]; [H1: Drosophila melanogaster (NP_724341), Homo sapiens (NP_722575), Chlamydomonas reinhardtii (XP_001693443), Arabidopsis thaliana...”
• Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer
  Clapier, Proteins 2008
  • GeneRIF: determined the 2.45 A crystal structure of the nucleosome core particle from D. melanogaster and compared it to that of X. laevis bound to the identical 147 base-pair DNA fragment. Differences primarily reflect 15 amino acid substitutions in H2A- H2B
  • “...(Hs), and yeast (Sc). Drosophila H2A, H2B, H3, H4 sequences correspond to accession codes NP_724343, NP_724342, NP_724345, NP_724344, respectively. Only residues that differ from the Drosophila sequence are shown. Amino acid substitutions that differentiate the Drosophila and Xenopus histone core regions are highlighted in yellow and...”
• Biochemical analysis of chromatin containing recombinant Drosophila core histones.
  Levenstein, The Journal of biological chemistry 2002 (PubMed)
  • GeneRIF: we studied the assembly and properties of chromatin that contains unmodified recombinant core histones
• Mapping the electrostatic potential of the nucleosome acidic patch
  Zhang, Scientific reports 2021
  • “...dimer refolding Drosophila melanogaster ( Dm. ) canonical histones H2A (Uniprot-id: P84051) and H2B (Uniprot-id: P02283) were expressed in E. coli BL21 Rosetta 2 (DE3) cells (Novagen) and purified under denaturing conditions from inclusion bodies as described before 10 . Briefly, histones are extracted from inclusion...”
• De novo reconstitution of chromatin using wheat germ cell-free protein synthesis
  Endo, FEBS open bio 2021
  • “...formic acid/80% (v/v) acetonitrile]. Computation D.melanogaster histone sequences with UniProt IDs of DmH2A (P84051), DmH2B (P02283), DmH3 (P02299) and DmH4 (P84040) were used [ 30 ]. Wheat Triticumaestivum histone sequences were also retrieved from UniProt, including TaH2A (A03AB6IP09), TaH2B (W5A7K6), TaH3 (W5GCP8) and TaH4 (A0A3B6U3I5). Pairwise...”
• Reconstitution of Drosophila and human chromatins by wheat germ cell-free co-expression system
  Okimune, BMC biotechnology 2020
  • “...a Source References DmH2A His2A P84051 13.4 124 D. melanogaster [ 26 ] DmH2B His2B P02283 13.7 123 D. melanogaster [ 15 ] DmH3 His3 P02299 15.4 136 D. melanogaster [ 15 ] DmH4 His4 P84040 11.4 103 D. melanogaster [ 15 ] HsH2A HIST2H2AA3 Q6FI13...”
  • “...manufacturer protocol. Cloning Genes encoding Drosophila core histones, DmH2A (UniProt ID: P84051), DmH2B (UniProt ID: P02283), DmH3 (UniProt ID: P02299), and DmH4 (UniProt ID: P84040), linker histone H1 (UniProt ID: P02255) and Drosophila chromatin assembly factors dAcf1 (UniProt ID: Q9V9T4), dISWI (UniProt ID: Q24368), and dNAP1...”
• Quantitative iTRAQ-based proteomic analysis of differentially expressed proteins in aging in human and monkey.
  Wang, BMC genomics 2019
  • “...identified in aged of human Number Accession protein symbol Description gene symbol MeanSD E_Value 1 Q76FE5 H2B Histone H2B ABCF2 0.310.1 6.00E-28 2 Q13201 MMRN1 Multimerin-1 MMRN1 0.770.18 0 3 P08571 CD14 Monocyte differentiation antigen CD14 CD14 0.480.04 0 4 P13796 PLSL Plastin-2 HEL-S-37 0.190.08 0...”

B6T1G5 Histone H2B from Zea mays
78% identity, 34% coverage

• Genotype-Specific Growth and Proteomic Responses of Maize Toward Salt Stress
  Soares, Frontiers in plant science 2018
  • “...NADPH quinone oxidoreductase 1 5.1E-03 13 96.74 Low B6SWV1 Glucose-6-phosphate 1-dehydrogenase 8.0E-04 14 73.31 Low B6T1G5 Histone H2B 3.0E-02 8 89.45 Low B6T8I3 Disease resistance response protein 206 1.1E-04 3 87.74 Low B6UHQ8 Blue copper protein 3.1E-03 2 51.37 Low C0P3T3 Peroxidase 8.0E-05 5 106.75 Low...”
• Comparative Proteomic Analysis of the Response of Maize (Zea mays L.) Leaves to Long Photoperiod Condition
  Wu, Frontiers in plant science 2016
  • “...Histone H2A 14/10.05 2 0.403 1.82E-07 down B4FYZ0 Histone H2B 16.1/10.05 1 1.434 0.00987423 up B6T1G5 Histone H2B 16/10.08 1 1.352 0.0308925 up P49120 Histone H2B.4 15.2/10.02 1 0.669 0.0210391 down LIPIDS AND FATTY ACIDS B4FJG4 DNA-directed RNA polymerase II 8.2 kDa polypeptide 8.3/5.06 1 0.556...”

H2B3B_MOUSE / Q8CGP0 Histone H2B type 3-B; H2B-clustered histone 26; H2B.U histone 1 from Mus musculus (Mouse) (see 6 papers)
H2B3B_HUMAN / Q8N257 Histone H2B type 3-B; H2B type 12; H2B-clustered histone 26; H2B.U histone 1 from Homo sapiens (Human) (see 5 papers)
M0RBQ5 Histone H2B from Rattus norvegicus
NP_778225 histone H2B type 3-B from Homo sapiens
73% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...H2B2F Q5QNW6 H2BC18 1q21.2 Replication dependent Yes H2B2E Q16778 H2BC21 1q21.2 Replication dependent No H2B3B Q8N257 H2BC26 1q42.13 Replication dependent No H3.1 (canonical) P68431 H3C1/2/3/4/6/7/8/10/11/12 6p22.1-6p22.2 Replication dependent No H3.2 (canonical) Q71DI3 H3C13/14/15 1q21.2 Replication dependent No H3.3 P84243 H3-3A/B 1q42.12|17q25.1 Replication independent Yes H3.T Q16695...”
• The deubiquitinase USP40 preserves endothelial integrity by targeting the heat shock protein HSP90β
  Miao, Experimental & molecular medicine 2024
  • “...Nuclear fragile X mental retardation-interacting protein 2 GN=NUFIP2 Q7Z417 76kDa Histone H2B type 3-B GN=HIST3H2BB Q8N257 14kDa Histone H2A type 2-C GN=HIST2H2AC Q16777 14kDa ATP-dependent RNA helicase DDX3X GN=DDX3X O00571 73kDa Heterogeneous nuclear ribonucleoprotein U GN=HNRNPU Q00839 91kDa Isoform 2 of Highly divergent homeobox GN=HDX Q7Z353-2...”
• Proteomic Dynamics of Multidrug Resistance Mechanisms in Lucena 1 Cell Line.
  Beraldo-Neto, Cells 2024
  • “...P62736 147.82 19 1 Actin, aortic smooth muscle P08183 147.56 29 23 ATP-dependent translocase ABCB1 Q8N257 130.83 18 1 Histone H2B type 3-B Q02952 126.10 13 13 A-kinase anchor protein 12 P09960 125.99 19 18 Leukotriene A-4 hydrolase Q6FI13 124.98 11 1 Histone H2A type 2-A...”
• Exercise-Dependent Modulation of Immunological Response Pathways in Endurance Athletes With and Without Atrial Fibrillation.
  Dorian, Journal of the American Heart Association 2024
  • “...antigen CD2 P06729 4.9 8.20E07 Platelet factor 4 P02776 3.8 9.70E03 Histone H2B type 3B Q8N257 3.0 2.20E06 Growth hormone variant P01242 2.9 4.20E05 Histone H2B type 2E Q16778 2.6 5.40E06 Histone H2B type 1K O60814 2.5 4.90E06 Histone H2B type 2E Q16778 2.4 4.00E06 Histone...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* A0A2R8Y619 Histone H2B type 2-E1 311.58 * Q5QNW6 Histone H2B type 2-F 16807.41 * Q8N257 Histone H2B type 3-B 17593.68 * P57053 Histone H2B type F-S 16800.03 * Q6NXT2 Histone H3.3C 3853.37 * P62805 Histone H4 7844.59 * P05107 Integrin beta-2 2518.87 * P33241 Lymphocyte-specific...”
• Unraveling molecular characteristic of fluoride neurotoxicity on U87 glial-like cells: insights from transcriptomic and proteomic approach.
  Puty, Frontiers in cellular neuroscience 2023
  • “...type 2-E + 489.46 + 489.46 Q5QNW6 Histone H2B type 2-F + 489.46 + 489.46 Q8N257 Histone H2B type 3-B + 458,83 + 458.83 P57053 Histone H2B type F-S + 489.46 + 489.46 P00338 L-lactate dehydrogenase A chain + 412.77 + 412.77 P41219 Peripherin + 15.8...”
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...Histone H2B type 1-L HIST1H2BL 1.483903394 0.56939717 Q16778 Histone H2B type 2-E HIST2H2BE 1.483903394 0.56939717 Q8N257 Histone H2B type 3-B HIST3H2BB 1.483903394 0.56939717 Q99879 Histone H2B type 1-M HIST1H2BM 1.483903394 0.56939717 Q99877 Histone H2B type 1-N HIST1H2BN 1.483903394 0.56939717 O60814 Histone H2B type 1-K HIST1H2BK 1.483903394...”
  • “...Histone H2B type 1-L HIST1H2BL 0.323611545 1.627665 Q16778 Histone H2B type 2-E HIST2H2BE 0.323611545 1.627665 Q8N257 Histone H2B type 3-B HIST3H2BB 0.323611545 1.627665 Q99879 Histone H2B type 1-M HIST1H2BM 0.323611545 1.627665 Q99877 Histone H2B type 1-N HIST1H2BN 0.323611545 1.627665 O60814 Histone H2B type 1-K HIST1H2BK 0.323611545...”
• Molecular Fingerprint of Human Pathological Synoviocytes in Response to Extractive Sulfated and Biofermentative Unsulfated Chondroitins
  Vassallo, International journal of molecular sciences 2022
  • “...1.0 P42677 RPS27 40S ribosomal protein S27 1.2 1.0 Q687X5 STEAP4 Metalloreductase STEAP4 1.2 1.0 Q8N257 H2BU1 Histone H2B type 3-B 1.2 1.0 Q86VB7 CD163 Scavenger receptor cysteine-rich type 1 protein M130 0.7 1.0 Q9NVJ2 ARL8B ADP-ribosylation factor-like protein 8B 1.2 1.0 P16930 FAH Fumarylacetoacetase 1.2...”
• More
• Acetylation-Mediated Post-Translational Modification of Pyruvate Dehydrogenase Plays a Critical Role in the Regulation of the Cellular Acetylome During Metabolic Stress
  Rajakumar, Metabolites 2024
  • “...NC 130 Histone H2B; Histone H2B type 1; Histone H2B type 1-A 109; 109; 109 M0RBQ5 UP 131 Histone H2B 12 A0A0G2JXE0 132 Histone H2B; Histone H2B type 1 16 M0RBQ5 NC 133 Histone H2B; Histone H2B type 1 17 M0RBQ5 NC 134 Histone H2B; Histone...”
  • “...Histone H2B type 1 24 M0RBQ5 NC 136 Histone H2B; Histone H2B type 1 13 M0RBQ5 NC 137 Histone H2B 12 M0RBQ5 NC 138 Zinc finger protein 821 305 D3ZEI3 UP 139 General transcription factor 3C polypeptide 1 1220 F1LNV7 NC 140 General transcription factor 3C...”
• Tandem Mass Tag Analysis of the Effect of the Anterior Cingulate Cortex in Nonerosive Reflux Disease Rats with Shugan Jiangni Hewei Granules Treatment
  Wang, Computational and mathematical methods in medicine 2022
  • “...as follows: kininogen-1 (Kng1, F7EUK4), four nodes; T-Kng1 (Map1, P01048), four nodes; histone H2B (Hist3h2bb, M0RBQ5), four nodes; proenkephalin-A (Penk, P04094), four nodes; pro-MCH (Pmch, G3V6L0, CPB1), three nodes; and fibrillin 1 (Fbn1, G3V9M6, TTR), three nodes (see Figure 7 ). 3.9. Validation of the Differently...”
• Requirement of ATM-dependent monoubiquitylation of histone H2B for timely repair of DNA double-strand breaks.
  Moyal, Molecular cell 2011
  • GeneRIF: ATM-dependent monoubiquitylation of histone H2B is required for timely repair of DNA double-strand breaks
• Extrachromosomal histone H2B mediates innate antiviral immune responses induced by intracellular double-stranded DNA.
  Kobiyama, Journal of virology 2010
  • GeneRIF: The present findings provide evidence indicating that the extrachromosomal histone H2B is engaged in the signaling pathway initiated by dsDNA to trigger antiviral innate immune responses.
• EBNA1-mediated recruitment of a histone H2B deubiquitylating complex to the Epstein-Barr virus latent origin of DNA replication.
  Sarkari, PLoS pathogens 2009
  • GeneRIF: USP7 can stimulate EBNA1-DNA interactions and EBNA1 can alter histone modification at oriP through recruitment of USP7.
• Sperm nuclear histone H2B: correlation with sperm DNA denaturation and DNA stainability.
  Zini, Asian journal of andrology 2008 (PubMed)
  • GeneRIF: infertile men have a higher proportion of spermatozoa with diffuse histone H2B
• Identification of histone H2B as a regulated plasminogen receptor.
  Herren, Biochemistry 2006 (PubMed)
  • GeneRIF: Histone H2B represents a regulated plasminogen receptor, which contributes significantly to the plasminogen binding capacity of cells.
• Proteomic Analysis of Protective Effects of Dl-3-n-Butylphthalide against mpp + -Induced Toxicity via downregulating P53 pathway in N2A Cells
  Zhao, Proteome science 2023
  • “...Q8CIH5 Plcg2 \1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 \"" 0.000269 Q8CIB5 Fermt2 Fermitin family homolog 2 0.033909 Q8CGP0 Hist3h2bb Histone H2B type 3-B 0.00061 Q8CGN4 Bcor BCL-6 corepressor 0.007849 Q8CG29 Myo1f Myosin IF 0.004777 Q8CG03 Pde5a \cGMP-specific 3',5'-cyclic phosphodiesterase \"" 0.001232 Q8CFT3 Ngfr \Nerve growth factor receptor (TNFR...”
• Proteomic Profiling and Functional Analysis of B Cell-Derived Exosomes upon Pneumocystis Infection
  Ma, Journal of immunology research 2022
  • “...type 1-K H2ac15 1.564 4.561 E -02 P62806 Histone H4 H4c1 1.516 3.010 E -03 Q8CGP0 Histone H2B type 3-B H2bu1-ps 1.513 3.093 E -04 P10854 Histone H2B type 1-M H2bc14 1.475 1.079 E -03 P10922 Histone H1.0 H1f0 1.465 3.718 E -02 P02301 Histone H3.3C...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...] Canonical H2B gene: Hist3h2ba Hist3h2ba Q9D2U9 [ 41 ] Canonical H2B gene: Hist3h2bb Hist3h2bb Q8CGP0 * TS H2B.1 (TH2B) TS H2B.1 (TH2B) Hist1h2ba P70696 [ 41 , 79 ] subH2B (H2BL.1) subH2B (H2BL.1) 1700024p04rik Q9D9Z7 [ 38 , 100 ] H2B.L.2 H2B.L.2 H2bfm Q9DAB5 [...”
• 17beta-estradiol counteracts neuropathic pain: a behavioural, immunohistochemical, and proteomic investigation on sex-related differences in mice
  Vacca, Scientific reports 2016
  • “...7 OS Mus musculus GN Krt7 PE 1 SV 1 17-estradiol* 0,1 Extracell Space other Q8CGP0 Histone H2B type 3 B OS Mus musculus GN Hist3h2bb PE 1 SV 3 17-estradiol* 0,1 Extracell Space other P13541 Myosin 3 OS Mus musculus GN Myh3 PE 2 SV...”
• Phosphoinositide-specific phospholipase C β 1b (PI-PLCβ1b) interactome: affinity purification-mass spectrometry analysis of PI-PLCβ1b with nuclear protein.
  Piazzi, Molecular & cellular proteomics : MCP 2013

H2B1O_HUMAN / P23527 Histone H2B type 1-O; H2B-clustered histone 17; Histone H2B.2; Histone H2B.n; H2B/n from Homo sapiens (Human) (see 5 papers)
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...H2B1M Q99879 H2BC14 6p22.1 Replication dependent No H2B1N Q99877 H2BC15 6p22.1 Replication dependent No H2B1O P23527 H2BC17 6p22.1 Replication dependent No H2B2F Q5QNW6 H2BC18 1q21.2 Replication dependent Yes H2B2E Q16778 H2BC21 1q21.2 Replication dependent No H2B3B Q8N257 H2BC26 1q42.13 Replication dependent No H3.1 (canonical) P68431 H3C1/2/3/4/6/7/8/10/11/12...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* Q99879 Histone H2B type 1-M 16807.41 * Q99877 Histone H2B type 1-N 16807.41 * P23527 Histone H2B type 1-O 17593.68 * Q16778 Histone H2B type 2-E 17593.68 * A0A2R8Y619 Histone H2B type 2-E1 311.58 * Q5QNW6 Histone H2B type 2-F 16807.41 * Q8N257 Histone H2B...”
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...elongation factor 1-alpha-like 3 EEF1A1P5 0.669922678 0.5779335 P57053 Histone H2B type F-S H2BFS 1.483903394 0.56939717 P23527 Histone H2B type 1-O HIST1H2BO 1.483903394 0.56939717 P06899 Histone H2B type 1-J HIST1H2BJ 1.483903394 0.56939717 Q5QNW6 Histone H2B type 2-F HIST2H2BF 1.483903394 0.56939717 Q93079 Histone H2B type 1-H HIST1H2BH 1.483903394...”
  • “...Protein Z-dependent protease inhibitor SERPINA10 0.297543726 1.7488264 P57053 Histone H2B type F-S H2BFS 0.323611545 1.627665 P23527 Histone H2B type 1-O HIST1H2BO 0.323611545 1.627665 P06899 Histone H2B type 1-J HIST1H2BJ 0.323611545 1.627665 Q5QNW6 Histone H2B type 2-F HIST2H2BF 0.323611545 1.627665 Q93079 Histone H2B type 1-H HIST1H2BH 0.323611545...”
• Unraveling molecular characteristic of fluoride neurotoxicity on U87 glial-like cells: insights from transcriptomic and proteomic approach.
  Puty, Frontiers in cellular neuroscience 2023
  • “...type 1-M + 489.46 + 489.46 Q99877 Histone H2B type 1-N + 489.46 + 489.46 P23527 Histone H2B type 1-O + 489.46 + 489.46 Q16778 Histone H2B type 2-E + 489.46 + 489.46 Q5QNW6 Histone H2B type 2-F + 489.46 + 489.46 Q8N257 Histone H2B type...”
• Light Microscopy and Proteomic Patterns of Ovulation in Cervical Mucus
  Fernandez-Hermida, Life (Basel, Switzerland) 2022
  • “...inhibitor Kazal-type 5 P03973 SLPI 57.2 6.61 Antileukoproteinase P68871 HBB 54.2 5.86 Hemoglobin subunit beta P23527 HIST1H2BO 120.6 8.06 Histone H2B type 1-O P02768 ALB 83.2 5.74 Serum albumin P02538 KRT6A 38.7 7.02 Keratin, type II cytoskeletal 6A Q9UBC9 SPRR3 85.5 7.06 Small proline-rich protein 3...”
• Tocotrienol-Rich Fraction and Levodopa Regulate Proteins Involved in Parkinson's Disease-Associated Pathways in Differentiated Neuroblastoma Cells: Insights from Quantitative Proteomic Analysis
  Magalingam, Nutrients 2022
  • “...type 1-B HIST1H2BB 13,950 0.015 0.130 P06899 Histone H2B type 1-J HIST1H2BJ 13,904 0.015 0.130 P23527 Histone H2B type 1-O HIST1H2BO 13,906 0.015 0.130 P68363 Tubulin alpha-1B chain TUBA1B 50,152 0.048 0.124 P63104 14-3-3 protein zeta/delta YWHAZ 27,745 0.013 0.039 P62136 Serine/threonine-protein phosphatase PP1-alpha catalytic subunit...”
• Investigating Glioblastoma Multiforme Sub-Proteomes: A Computational Study of CUSA Fluid Proteomic Data
  Moresi, International journal of molecular sciences 2022
  • “...found in Newly Diagnosed and Recurrent GBMs pools. Uniprot Protein Name ND Zones R Zones P23527 Histone H2B type 1-O CORE A CORE Q96KK5 Histone H2A type 1-H CORE A+ A CORE A+ A P62805 Histone H4 A+ A+ P04908 Histone H2A type 1-B/E A CORE...”
• 6-Hydroxydopamine Induces Neurodegeneration in Terminally Differentiated SH-SY5Y Neuroblastoma Cells via Enrichment of the Nucleosomal Degradation Pathway: a Global Proteomics Approach
  Magalingam, Journal of molecular neuroscience : MN 2022
  • “...1-alpha 1 EEF1A1 100282 4.78E-02 0.111 P06899 Histone H2B type 1-J HIST1H2BJ 27808 1.13E-02 0.108 P23527 Histone H2B type 1-O HIST1H2BO 27812 1.13E-02 0.108 P33778 Histone H2B type 1-B HIST1H2BB 27900 1.13E-02 0.108 Q16778 Histone H2B type 2-E HIST2H2BE 27,840 1.13E-02 0.108 P62829 60S ribosomal protein...”
• More

H2B1H_HUMAN / Q93079 Histone H2B type 1-H; H2B-clustered histone 9; Histone H2B.j; H2B/j from Homo sapiens (Human) (see 6 papers)
NP_003515 histone H2B type 1-H from Homo sapiens
G1U155 Histone H2B from Oryctolagus cuniculus
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers (Probable). The octamer wraps approximately 147 bp of DNA (Probable). Found in a complex with PPAR9; DTX3L AND STAT1; the interaction is likely to induce DTX3L-mediated ubiquitination of H2BC9/H2BJ (PubMed:26479788).
• Identification of HIST1H2BH as the hub gene associated with multiple myeloma using integrated bioinformatics analysis.
  Zhang, Hematology (Amsterdam, Netherlands) 2024 (PubMed)
  • GeneRIF: Identification of HIST1H2BH as the hub gene associated with multiple myeloma using integrated bioinformatics analysis.
• Saliva from nymph and adult females of Haemaphysalis longicornis: a proteomic study
  Tirloni, Parasites & vectors 2015
  • “...nucleotide 2.00 G1TXI1 nucleophosmin Metabolism, nucleotide 3.33 G1U9T4 nucleoside diphosphate kinase B Metabolism, nucleotide 3.33 G1U155 histone H2B type 1-like Nuclear regulation 3.00 P51662 annexin A1 Protein export machinery 5.50 G1TDI4 transthyretin Protein export machinery 3.00 G1SJZ9 thioredoxin Protein modification machinery 1.33 G1SEK8 metalloendopeptidase inhibitor Proteinase...”
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...H2B1B P33778 H2BC3 6p22.2 Replication dependent No H2B1D P58876 H2BC5 6p22.2 Replication dependent No H2B1H Q93079 H2BC9 6p22.2 Replication dependent No H2B1J P06899 H2BC11 6p22.2 Replication dependent H2B1K O60814 H2BC12 6p22.2 Replication dependent Yes H2B1L Q99880 H2BC13 6p22.1 Replication dependent No H2B1M Q99879 H2BC14 6p22.1 Replication...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* P62807 Histone H2B type 1-C/E/F/G/I 16807.41 * P58876 Histone H2B type 1-D 16807.41 * Q93079 Histone H2B type 1-H 16807.41 * P06899 Histone H2B type 1-J 17593.68 * O60814 Histone H2B type 1-K 16807.41 * Q99880 Histone H2B type 1-L 16807.41 * Q99879 Histone H2B...”
• The exquisite specificity of human protein arginine methyltransferase 7 (PRMT7) toward Arg-X-Arg sites
  Bondoc, PloS one 2023
  • “...are highly similar. The amino acid sequences of H . sapiens histone H2B (UniProt accession Q93079 ) and X . laevis histone H2B (UniProt accession P02281 ) were aligned using Clustal Omega. Highlighted is the region spanning amino acids 2337 which contains the target sequence 29-RKRSR-33...”
• Towards the Definition of the Molecular Hallmarks of Idiopathic Membranous Nephropathy in Serum Proteome: A DIA-PASEF Approach.
  Previtali, International journal of molecular sciences 2023
  • “...0.3 H2B1K_HUMAN; H2BFS_HUMAN; H2B1D_HUMAN; H2B1C_HUMAN; H2B2F_HUMAN; H2B1H_HUMAN; H2B1N_HUMAN; H2B1M_HUMAN; H2B1L_HUMAN O60814; P57053; P58876; P62807; Q5QNW6; Q93079; Q99877; Q99879; Q99880 H2BC12; H2BC12L; H2BC5; H2BC4; H2BC18; H2BC9; H2BC15; H2BC14; H2BC13 Histone H2B type 1-K; Histone H2B type F-S; Histone H2B type 1-D; Histone H2B type 1-C/E/F/G/I; Histone H2B...”
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...Histone H2B type 1-J HIST1H2BJ 1.483903394 0.56939717 Q5QNW6 Histone H2B type 2-F HIST2H2BF 1.483903394 0.56939717 Q93079 Histone H2B type 1-H HIST1H2BH 1.483903394 0.56939717 P33778 Histone H2B type 1-B HIST1H2BB 1.483903394 0.56939717 Q96A08 Histone H2B type 1-A HIST1H2BA 1.483903394 0.56939717 P62807 Histone H2B type 1-C/E/F/G/I HIST1H2BC 1.483903394...”
  • “...Histone H2B type 1-J HIST1H2BJ 0.323611545 1.627665 Q5QNW6 Histone H2B type 2-F HIST2H2BF 0.323611545 1.627665 Q93079 Histone H2B type 1-H HIST1H2BH 0.323611545 1.627665 P33778 Histone H2B type 1-B HIST1H2BB 0.323611545 1.627665 Q96A08 Histone H2B type 1-A HIST1H2BA 0.323611545 1.627665 P62807 Histone H2B type 1-C/E/F/G/I HIST1H2BC 0.323611545...”
• Unraveling molecular characteristic of fluoride neurotoxicity on U87 glial-like cells: insights from transcriptomic and proteomic approach.
  Puty, Frontiers in cellular neuroscience 2023
  • “...type 1-C/E/F/G/I + 489.46 + 489.46 P58876 Histone H2B type 1-D + 489.46 + 489.46 Q93079 Histone H2B type 1-H + 489.46 + 489.46 P06899 Histone H2B type 1-J + 489.46 + 489.46 O60814 Histone H2B type 1-K + 489.46 + 489.46 Q99880 Histone H2B type...”
• 6-Hydroxydopamine Induces Neurodegeneration in Terminally Differentiated SH-SY5Y Neuroblastoma Cells via Enrichment of the Nucleosomal Degradation Pathway: a Global Proteomics Approach
  Magalingam, Journal of molecular neuroscience : MN 2022
  • “...type 1-C/E/F/G/I HIST1H2BC 27,812 1.19E-02 0.094 Q5QNW6 Histone H2B type 2-F HIST2H2BF 27,840 1.19E-02 0.094 Q93079 Histone H2B type 1-H HIST1H2BH 27,784 1.19E-02 0.094 Q99877 Histone H2B type 1-N HIST1H2BN 27,844 1.19E-02 0.094 Q99879 Histone H2B type 1-M HIST1H2BM 27,978 1.19E-02 0.094 P60709 Actin cytoplasmic 1...”
• Ellagic Acid Triggers the Necrosis of Differentiated Human Enterocytes Exposed to 3-Nitro-Tyrosine: An MS-Based Proteomic Study
  Díaz-Velasco, Antioxidants (Basel, Switzerland) 2022
  • “...related to nucleosome P58876 Histone H2B type 1-H H2BC9 0.048 0.73 Histone related to nucleosome Q93079 D-dopachrome decarboxylase DDT 0.024 0.74 Tautomerization of D-dopachrome P30046 D-dopachrome decarboxylase-like protein DDTL 0.024 0.74 Lyase activity A6NHG4 Eukaryotic translation initiation factor 3 subunit D EIF3D 0.022 0.75 Early steps...”
• More

B4FYZ0 Histone H2B from Zea mays
80% identity, 34% coverage

• Comparative Proteomic Analysis of the Response of Maize (Zea mays L.) Leaves to Long Photoperiod Condition
  Wu, Frontiers in plant science 2016
  • “...RNA polymerase 40.6/9.09 2 0.54 0.000402232 down B4G237 Histone H2A 14/10.05 2 0.403 1.82E-07 down B4FYZ0 Histone H2B 16.1/10.05 1 1.434 0.00987423 up B6T1G5 Histone H2B 16/10.08 1 1.352 0.0308925 up P49120 Histone H2B.4 15.2/10.02 1 0.669 0.0210391 down LIPIDS AND FATTY ACIDS B4FJG4 DNA-directed RNA...”
• A functional genomics approach to dissect the mode of action of the Stagonospora nodorum effector protein SnToxA in wheat.
  Vincent, Molecular plant pathology 2012 (no snippet)

LOC112736609 histone H2B from Arachis hypogaea
LOC112787272 histone H2B from Arachis hypogaea
76% identity, 34% coverage

• Genome-Wide Identification and Characterization of Long Non-Coding RNAs in Peanut
  Zhao, Genes 2019
  • “...associated with seed), the target gene (LOC112787272 in black module ( Figure 6 a) and LOC112736609 in brown module ( Figure 6 c)) of hub lncRNAs encodes histone H2B, which is associated with activation and regulation of methyltransferases [ 44 ]. Target gene LOC112730895 of hub...”
• Genome-Wide Identification and Characterization of Long Non-Coding RNAs in Peanut
  Zhao, Genes 2019
  • “...post-harvest seed, and green module ( Figure 6 d) associated with seed), the target gene (LOC112787272 in black module ( Figure 6 a) and LOC112736609 in brown module ( Figure 6 c)) of hub lncRNAs encodes histone H2B, which is associated with activation and regulation of...”

H2B1C_HUMAN / P62807 Histone H2B type 1-C/E/F/G/I; Histone H2B.1 A; Histone H2B.a; H2B/a; Histone H2B.g; H2B/g; Histone H2B.h; H2B/h; Histone H2B.k; H2B/k; Histone H2B.l; H2B/l from Homo sapiens (Human) (see 8 papers)
H2B1C_MOUSE / Q6ZWY9 Histone H2B type 1-C/E/G from Mus musculus (Mouse) (see 6 papers)
G3HDT7 Histone H2B from Cricetulus griseus
B2R4S9 Histone H2B from Homo sapiens
G3V9C7 Histone H2B from Rattus norvegicus
H9GWB1 Histone H2B from Canis lupus familiaris
NP_003509 histone H2B type 1-C/E/F/G/I from Homo sapiens
NP_003513 histone H2B type 1-C/E/F/G/I from Homo sapiens
NP_003514 histone H2B type 1-C/E/F/G/I from Homo sapiens
NP_003516 histone H2B type 1-C/E/F/G/I from Homo sapiens
NP_003517 histone H2B type 1-C/E/F/G/I from Homo sapiens
P62808 Histone H2B type 1 from Bos taurus
LOC696506 histone H2B type 1 from Macaca mulatta
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  function: Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Interacts with VRK1; the interaction is mediated by the nucleosome acidic patch, a cluster of negatively charged residues of H2A and H2B forming a cleft within the nucleosome core (PubMed:35390161).
• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Interacts with VRK1; the interaction is mediated by the nucleosome acidic patch, a cluster of negatively charged residues of H2A and H2B forming a cleft within the nucleosome core (By similarity).
• Perturbing cohesin dynamics drives MRE11 nuclease-dependent replication fork slowing.
  Carvajal-Maldonado, Nucleic acids research 2019
  • “...0.33 21.56 68 G3I968 Histone H2A 0.21 3.99 8 0.35 4.89 7 0.03 8.40 7 G3HDT7 Histone H2B NO 11.39 29 0.06 24.93 57 0.32 21.69 72 G3H2T7 Histone H3 0.07 9.51 122 0.00 18.26 50 0.22 30.15 52 G3HHM2 Histone H3.1t 0.06 24.16 98 0.17...”
• Hydroxyphenylation of Histone Lysines: Post-translational Modification by Quinone Imines
  Ravindra, ACS chemical biology 2016
  • “...were created in BioConfirm software using Chinese hamster histone sequences from Uniprot (H2A: G3HDU4, H2B: G3HDT7, H3: G3HDS5, and H4: G3H2T6). The data files were extracted using the Molecular Feature Extraction function in Mass Hunter and matched with these databases including the variable modifications to get...”
• New insights into molecular pathways associated with flatfish ovarian development and atresia revealed by transcriptional analysis
  Tingaud-Sequeira, BMC genomics 2009
  • “...Q8AYL1 Zona pellucida C2 [ Oryzias latipes ] 9E-69 161 (67%) zpc2 pgsP0018J23 FF287569 -1.40 B2R4S9 Histone 1, H2bc, isoform CRA_a [ H. sapiens ] 3E-35 77 (97%) hist1h2be pgsP0029D07 FF291286 -1.39 P62260 14-3-3 protein epsilon [ R. norvegicus ] 2E-20 65 (76%) ywhae pgsP0030I24 FF291759...”
• Integrated proteomic and metabolomic profiling of lymph after trauma-induced hypercoagulopathy and antithrombotic therapy
  Zheng, Thrombosis journal 2024
  • “...alpha chain, C8a), P01836 (Ig kappa chain C region, A allele), P00697 (Lysozyme C-1, Lyz1), G3V9C7 (Histone H2B, Hist1h2bk), M0R485 (Peptidoglycan recognition protein 2, Pglyrp2), P55314 (Complement component C8 beta chain, C8b), Q91YB6 (Complement inhibitory factor H, Cfh), D3ZPI8 (Complement C8 gamma chain, C8g). Although these...”
• Proteomic Expression Changes in Large Cerebral Arteries After Experimental Subarachnoid Hemorrhage in Rat Are Regulated by the MEK-ERK1/2 Pathway.
  Müller, Journal of molecular neuroscience : MN 2017
  • “...with RBPJ 1 2.64 Q9WVA3 Mitotic checkpoint protein BUB3 2.61 Q8CIE6 Coatomer subunit alpha 2.59 G3V9C7 Histone H2B type 1-K 2.57 Q9Z340 Partitioning defective 3 homolog 2.55 P97633 Casein kinase I isoform alpha 2.47 P41499 Tyrosine-protein phosphatase non-receptor type 11 2.46 P60711 Actin, cytoplasmic 1 2.45...”
• Proteomic Analysis of the Spatio-temporal Based Molecular Kinetics of Acute Spinal Cord Injury Identifies a Time- and Segment-specific Window for Effective Tissue Repair
  Devaux, Molecular & cellular proteomics : MCP 2016
  • “...Cytochrome c oxidasesubunit 6B1 D3ZFG5 Protein Pmp2 G3V9C7 Histone H2B D3ZNW5 Neurofascin D3ZUY8 Adaptorproteincomplex AP-2, alpha 1 subunit (Predicted) D4A0I5...”
• Influence of age on rat bone-marrow mesenchymal stem cells potential
  Fafián-Labora, Scientific reports 2015
  • “...0,007 D3ZBN0 Histone H1.5 4 1,911 0,0166 0,4907 0,0135 0,9905 0,9189 1,4031 0,0552 0,8838 0,2767 G3V9C7 Histone H2B 20 1,2535 0,0051 0,9957 0,9764 0,8311 0,1792 1,4957 0,0005 0,7706 0,0027 M0RBX6 Histone H3 6 1,1323 0,058 1,4413 0,0125 1,201 0,0272 0,5991 0,0004 0,494 0,0002 P62804 Histone H4...”
• Longitudinal quantification of the gingival crevicular fluid proteome during progression from gingivitis to periodontitis in a canine model
  Davis, Journal of clinical periodontology 2016
  • “...Structural Actin binding 1.83 (1.18, 2.81) 0.0358 1.79 (1.16, 2.76) 0.0358 1.02 (0.66, 1.57) 1.0000 H9GWB1 Histone H2B Structural DNA packaging 1.69 (1.17, 2.44) 0.0358 1.43 (0.99, 2.06) 0.1262 1.18 (0.82, 1.70) 0.8201 J9P2B7 Histone H2A Structural DNA packaging 1.54 (1.03, 2.31) 0.0816 1.67 (1.12, 2.50)...”
• Glucose metabolism induces mono-ubiquitination of histone H2B in mammalian cells.
  Gao, Biochemical and biophysical research communications 2011 (PubMed)
  • GeneRIF: glucose-glycolysis-uH2B signal pathway is well conserved from yeast to mammalian cells, providing an evolutionarily-conserved regulatory mechanism of histone modifications.
• Antimicrobial peptides in the first line defence of human colon mucosa.
  Tollin, Peptides 2003 (PubMed)
  • GeneRIF: Histone H2B antimicrobial peptides participate in the colonic defense against bacteria and fungi.
• Antimicrobial peptides in the first line defence of human colon mucosa.
  Tollin, Peptides 2003 (PubMed)
  • GeneRIF: Histone H2B antimicrobial peptides participate in the colonic defense against bacteria and fungi.
• Antimicrobial peptides in the first line defence of human colon mucosa.
  Tollin, Peptides 2003 (PubMed)
  • GeneRIF: Histone H2B antimicrobial peptides participate in the colonic defense against bacteria and fungi.
• A modified "cross-talk" between histone H2B Lys-120 ubiquitination and H3 Lys-79 methylation.
  Darwanto, The Journal of biological chemistry 2010
  • GeneRIF: a catalytic and inhibitory loop mechanism may better describe the cross-talk relationship between H2B ubiquitination and H3 Lys-79 methylation
• Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
  Flachsbart, Mutation research 2010 (PubMed)
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Antimicrobial peptides in the first line defence of human colon mucosa.
  Tollin, Peptides 2003 (PubMed)
  • GeneRIF: Histone H2B antimicrobial peptides participate in the colonic defense against bacteria and fungi.
• Antimicrobial peptides in the first line defence of human colon mucosa.
  Tollin, Peptides 2003 (PubMed)
  • GeneRIF: Histone H2B antimicrobial peptides participate in the colonic defense against bacteria and fungi.
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...H2AFJ 12p12.3 Replication independent Yes TH2A (H2A1A) Q96QV6 H2AC1 6p2122 Replication dependent No H2B1C/E/F/G/I (canonical) P62807 H2BC4/6/7/8/10 6p22.2 Replication dependent No H2BK1 A0A2R8Y619 H2BK1 7q36.1 Not known Yes H2B.N P0DW85 H2BN1 17q11.2 Not known Yes H2BFWT Q7Z2G1 H2BW1 Xq22.2 Replication independent Yes H2BFM P0C1H6 H2BW2 Xq22.2...”
  • “...provided between parentheses. The isoform used for the canonical H2B sequence is H2B1C/E/F/G/I (UniProt ID: P62807 ), encoded by H2BC4/6/7/8/10 genes. B , a schematic representation of amino acid sequence alignment of histone H2B variants with major differences compared with the canonical H2B sequence (UniProt ID:...”
• Bacterial histone HBb from Bdellovibrio bacteriovorus compacts DNA by bending
  Hu, Nucleic acids research 2024
  • “...representative eukaryotic, archaeal, and bacterial histones from Homo sapiens (UniProtKB/Swiss-Prot entry for H2A: P04908; H2B: P62807; H3: P68431; H4: P62805), Methanothermus fervidus (HMfA: P48781; HMfB: P19267), Bdellovibrio bacteriovorus (Q6MRM1), Leptospira interrogans (Q8F3E8), Plesiocystis pacifica (A6GF99), Enhygromyxa salina (NCBI entry WP_052547863.1), and Nannocystis exedens (WP_096326703.1). -Helices are...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* Q96A08 Histone H2B type 1-A 7130.46 * P33778 Histone H2B type 1-B 17593.68 * P62807 Histone H2B type 1-C/E/F/G/I 16807.41 * P58876 Histone H2B type 1-D 16807.41 * Q93079 Histone H2B type 1-H 16807.41 * P06899 Histone H2B type 1-J 17593.68 * O60814 Histone H2B...”
• The exquisite specificity of human protein arginine methyltransferase 7 (PRMT7) toward Arg-X-Arg sites
  Bondoc, PloS one 2023
  • “...RER Ac-KKGG R E R GGKKY-amide 1404.63 1404.4 97.0% a Obtained from UNIPROT accession number P62807. b Obtained from UNIPROT accession number P02281. c Theoretical molecular weight using Expasy Compute pI/Mw tool. d Theoretical/experimental molecular weight determined by GenScript. e Experimentally determined HPLC purity reported on...”
• Quantitative proteomic analyses uncover regulatory roles of Nrf2 in human endothelial cells.
  Amin, Cell stress & chaperones 2023
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...Histone H2B type 1-B HIST1H2BB 1.483903394 0.56939717 Q96A08 Histone H2B type 1-A HIST1H2BA 1.483903394 0.56939717 P62807 Histone H2B type 1-C/E/F/G/I HIST1H2BC 1.483903394 0.56939717 Q99880 Histone H2B type 1-L HIST1H2BL 1.483903394 0.56939717 Q16778 Histone H2B type 2-E HIST2H2BE 1.483903394 0.56939717 Q8N257 Histone H2B type 3-B HIST3H2BB 1.483903394...”
  • “...Histone H2B type 1-B HIST1H2BB 0.323611545 1.627665 Q96A08 Histone H2B type 1-A HIST1H2BA 0.323611545 1.627665 P62807 Histone H2B type 1-C/E/F/G/I HIST1H2BC 0.323611545 1.627665 Q99880 Histone H2B type 1-L HIST1H2BL 0.323611545 1.627665 Q16778 Histone H2B type 2-E HIST2H2BE 0.323611545 1.627665 Q8N257 Histone H2B type 3-B HIST3H2BB 0.323611545...”
• Protocol to prepare doubly labeled fluorescent nucleosomes for single-molecule fluorescence microscopy.
  Ghoneim, STAR protocols 2023
  • “...Purified plasmids of wild-type (WT) human histones H2A (UniProt # P0C0S8 ), H2B (UniProt # P62807 ), H3 (UniProt # Q71DI3 ) AND H4 (UniProt # P62805 ). The H3 we use in this protocol has the common G102A and C110A mutations (numbering of residues starts...”
  • “...(M -1 cm -1 ) b H2A a P0C0S8 13960 4470 SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHL QLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK c H2B P62807 13775 7450 PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYN KRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK H3 d Q71DI3 15239 4470 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQ SSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA H4 P62805 11236 5960 SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAM DVVYALKRQGRTLYGFGG # Numbering of residues starts after the first methionine. a H2A K119C #...”
• Towards the Definition of the Molecular Hallmarks of Idiopathic Membranous Nephropathy in Serum Proteome: A DIA-PASEF Approach.
  Previtali, International journal of molecular sciences 2023
  • “...Histone H2A.J 0.3 H2B1K_HUMAN; H2BFS_HUMAN; H2B1D_HUMAN; H2B1C_HUMAN; H2B2F_HUMAN; H2B1H_HUMAN; H2B1N_HUMAN; H2B1M_HUMAN; H2B1L_HUMAN O60814; P57053; P58876; P62807; Q5QNW6; Q93079; Q99877; Q99879; Q99880 H2BC12; H2BC12L; H2BC5; H2BC4; H2BC18; H2BC9; H2BC15; H2BC14; H2BC13 Histone H2B type 1-K; Histone H2B type F-S; Histone H2B type 1-D; Histone H2B type 1-C/E/F/G/I;...”
• More
• Metataxonomic analysis and host proteome response in dairy cows with high and low somatic cell count: a quarter level investigation
  Winther, Veterinary research 2023
  • “...variation in the second component of the PCA plotwas mainly driven by histones (P0C0S9, P62803, P62808, P02253, P84227) and actin proteins (P60712, F1N650) present mostly in the high SCC samples. In addition, proteins P22226, P28783, and P79105 were also correlated with high SCC samples and are...”
  • “...that were responsible for the variation in the second component of the PCA. P0C0S9, P62803, P62808, P02253, and P84227 are histones, P60712 and F1N650 are actin, and P22226, P28783, and P79105 are proteins related to an immune response. Differential expression analysis uncovers a specific expression pattern...”
• Snapshot imprinting as a tool for surface mapping and identification of novel biomarkers of senescent cells.
  Piletska, Nanoscale advances 2022
  • “...Q96QV6 Histone H2A type 2-C 17.2 14 0.1 0.1 O60814; P06899; P23527; P33778; P58876; P62807; P62808; Q16778; Q2M2T1; Q32L48; Q5QNW6; Q93079; Q99877; Q99879; P57053; Q96A08; Q99880; Q8N257 Histone H2B type 1-B 19 15.2 1.7 1.1 The cell division cycle 7-related protein kinase (CDC7) is a serine/threonine...”
• Proteomic changes in the milk of water buffaloes (Bubalus bubalis) with subclinical mastitis due to intramammary infection by Staphylococcus aureus and by non-aureus staphylococci
  Pisanu, Scientific reports 2019
  • “...LM P02253 Histone H1.2* 3.08 3.06 3.11 S F6MFD5 Peptidoglycan-recognition protein 3.08 3.26 2.86 I P62808 Histone H2B type 1 3.04 3.04 3.04 S Q9TU25 Ras-related C3 botulinum toxin substrate 2 2.97 2.99 2.95 I Q9TU03 Rho GDP-dissociation inhibitor 2* 2.97 3.13 2.79 S Q2TBL6 Transaldolase*...”
• Characterization of paucibacillary ileal lesions in sheep with subclinical active infection by Mycobacterium avium subsp. paratuberculosis
  Pisanu, Veterinary research 2018
  • “...respectively Accession Gene name Description All PTB vs K PTB1 vs K PTB2 vs K P62808 H2B Histone H2B type 1 138.55 159.95 122.71 P63048 UBA52 Ubiquitin-60S ribosomal protein L40 70.26 67.05 72.67 A0JNJ5 MYL1 Myosin light chain 1/3, skeletal muscle isoform 16.55 23.39 11.42 Q17QN3...”
• Protein Composition of the Bovine Herpesvirus 1.1 Virion
  Barber, Veterinary sciences 2017
  • “...virions Histone H4 P62803 3 9,9,1 Histone H2A.V Q32LA7 2 2,1,0 Histone H2B type 1 P62808 2 1,1,0 60S ribosomal protein L7 Q58DT1 2 0,1,1 60S ribosomal protein L8 Q3T0S6 2 3,1,0 60S ribosomal protein L14 Q3T0U2 2 3,1,0 40S ribosomal protein S6 Q5E995 2 2,2,0...”
• The intracellular bacterium Anaplasma phagocytophilum selectively manipulates the levels of vertebrate host proteins in the tick vector Ixodes scapularis.
  Villar, Parasites & vectors 2016
  • “...Innate immunity D8X187 Serpin peptidase inhibitor clade B ovalbumin member 1 +2.1 ns Innate immunity P62808 Histone H2B type 1 +3.4 ns Adaptive immunity W5PGJ7 PYD and CARD Domain-Containing uncharacterized protein +2.9 ns Adaptive immunity P49928 Cathelin-related peptide SC5 +3.1 ns Anti-bacterial immunity P82018 Cathelicidin-2 +2.7...”
  • “...HSP70 FDLTGIPPAPR RKELEQVCNPIITK P68432 Histone H3.1 RVTIMPKDIQLAR SAPATGGVK SAPATGGVKKPHRYRPGTVALR F1MN93 TOP1 uncharacterized protein AGNEKEEGETADTVGCCSLR HLQDLMEGLTAK P62808 Histone H2B type 1 AMGIMNSFVNDIFER EIQTAVRLLLPGELAK EIQTAVR ESYSVYVYK SRKESYSVYVYK STITSREIQTAVRLLLPGELAK STITSREIQTAVR VLKQVHPDTGISSK W5PLV3 RAB5B uncharacterized protein TAMNVNDLFLAIAK P62803 Histone H4 None Q9TTS3 Acetyl-CoA carboxylase 1 None To confirm the origin...”
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...H2B clustered histone 3 Hist1h2bb MGI:2448377 Q64475 H2B H2bc4 H2B clustered histone 4 Hist1H2bc MGI:1915274 Q6ZWY9 H2B H2bc6 H2B clustered histone 6 Hist1h2be MGI:2448380 Q6ZWY9 H2B H2bc7 H2B clustered histone 7 Hist1h2bf MGI:2448383 P10853 H2B H2bc8 H2B clustered histone 8 Hist1h2bg MGI:2448386 Q6ZWY9 H2B H2bc9 H2B...”
• Identification of Arvicola terrestris scherman Sperm Antigens for Immune Contraceptive Purposes
  Chorfa, International journal of molecular sciences 2021
  • “...1.26 2.07 2 (20.95) 122.51 PPIA P17742 18,089 7.68 3.05 7.45 2 (17.83) 206.22 Hist1h2bc Q6ZWY9 13,898 9.68 1.67 2.60 5 (28.57) 319.82 GRHL3 Q5FWH3 67,554 6.40 1.30 0.97 2 (2.66) 88.29 Complement activation C3 P01027 173,622 6.02 1.37 2.56 26 (48.50) 7024.70 C1QC Q02105 27,193...”
• Biochemical isolation of myonuclei employed to define changes to the myonuclear proteome that occur with aging.
  Cutler, Aging cell 2017
  • “...ribonucleoprotein R RNA processing 1.84 0.002 P30275 Ckmt1 Creatine kinase Utype, mitochondrial Metabolism 1.85 0.046 Q6ZWY9 Hist1h2bc Histone H2B type 1C/E/G Chromatin maintenance 1.90 0.047 P70168 Kpnb1 Importin subunit beta1 Nuclear Transport 1.90 0.035 P62315 Snrpd1 Small nuclear ribonucleoprotein Sm D1 RNA processing 1.94 0.026 Q9CQF3...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...H2B gene: Hist1h2bb Hist1h2bb Q64475 [ 41 ] Canonical H2B genes: Hist1h2bc, Hist1h2be, Hist1h2bg Hist1h2bc Q6ZWY9 [ 41 ] Hist1h2be Q6ZWY9 [ 41 ] Hist1h2bg Q6ZWY9 [ 41 ] Canonical H2B genes: Hist1h2bf, Hist1h2bj, Hist1h2bl, Hist1h2bn, Hist1h2bq, Hist1h2br Hist1h2bf P10853 [ 41 ] Hist1h2bj P10853 [...”
• Label-free mass spectrometric analysis reveals complex changes in the brain proteome from the mdx-4cv mouse model of Duchenne muscular dystrophy
  Murphy, Clinical proteomics 2015
  • “...A3 5 295.10 0.01295 1.35 Q91VR2 ATP synthase subunit gamma, mitochondrial 4 251.82 0.00255 1.35 Q6ZWY9 Histone H2B type 1-C/E/G 2 121.60 0.04212 1.34 Q61171 Peroxiredoxin-2 2 141.40 0.01279 1.33 Q9D051 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial 4 262.12 0.00408 1.32 O35737 Heterogeneous nuclear ribonucleoprotein...”
• Concurrent Label-Free Mass Spectrometric Analysis of Dystrophin Isoform Dp427 and the Myofibrosis Marker Collagen in Crude Extracts from mdx-4cv Skeletal Muscles
  Murphy, Proteomes 2015
  • “...c oxidase subunit 2 3 118.8 0.015387 3.52 P22599 Alpha-1-antitrypsin 1-2 3 186.1 0.004003 3.46 Q6ZWY9 Histone H2B type 1-C/E/G 3 310.5 0.006482 3.46 P26039 Talin-1 3 199.2 0.001177 3.36 P18826 Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform 3 235.7 0.008094 3.34 P15864 Histone...”
• Identification and quantification of the basal and inducible Nrf2-dependent proteomes in mouse liver: biochemical, pharmacological and toxicological implications.
  Walsh, Journal of proteomics 2014
  • “...0.005 P21981 Protein-glutamine gamma-glutamyltransferase 2 16 0.66 0.049 Q9WU19 Hydroxyacid oxidase 1 9 0.65 <0.001 Q6ZWY9 Histone H2B type 1-C/E/G 30 0.65 0.020 O08917 Flotillin-1 2 0.63 0.002 0.69 0.018 P32020 Non-specific lipid-transfer protein 72 0.62 0.003 Q99P30 Peroxisomal coenzyme A diphosphatase NUDT7 28 0.62 0.008...”
• Cell cycle-dependent expression and subcellular localization of fructose 1,6-bisphosphatase.
  Mamczur, Histochemistry and cell biology 2012
  • “...ID: P0C0S6 13.5 53 543 UniProt ID: Q64522 14 46 903 Histone H2B UniProt ID: Q6ZWY9 14 44 1,012 Histone H4 UniProt ID: P62806 11.3 50 939 Table4 The KLN-205 non-histone nuclear proteins interacting with muscle FBPase identified by mass spectrometry Protein type Protein Accession numbers...”
• More
• Microarray analysis of relative gene expression stability for selection of internal reference genes in the rhesus macaque brain
  Noriega, BMC molecular biology 2010
  • “...15 0.080 COL6A1 --- MmugDNA.15324.1.S1_at - 16 0.080 EEF1A1 LOC702809/LOC703715/LOC704199/LOC704438/LOC709017/LOC715351 MmuSTS.4277.1.S1_at - 17 0.080 HIST1H2BC LOC696506 MmunewRS.953.1.S1_x_at - 18 0.080 COX7C LOC693275/LOC702058/LOC706698 MmugDNA.43583.1.S1_x_at + 19 0.081 RAD9A LOC712345 MmugDNA.26624.1.S1_at - 20 0.081 API5 API5 MmugDNA.34847.1.S1_at - HRT: treatment rank/1444 stability value descriptor "GEN = " gene...”
  • “...17 0.064 YWHAE LOC720295 MmugDNA.14868.1.S1_at - 18 0.064 RPS24 LOC701477/LOC702961/LOC704054/LOC705596/LOC707085/LOC711145/LOC715668/LOC717801 MmugDNA.6998.1.S1_at ++++ 19 0.064 HIST1H2BC LOC696506 MmunewRS.953.1.S1_at - 20 0.064 ATP6V1F LOC705175 MmugDNA.5612.1.S1_at - 1444 probe sets annotated for genes in the independently verified set were analyzed. Probe sets in the table are in order of...”

H2B2F_HUMAN / Q5QNW6 Histone H2B type 2-F; H2B-clustered histone 18 from Homo sapiens (Human) (see 4 papers)
H2B2B_MOUSE / Q64525 Histone H2B type 2-B; H2B-clustered histone 18; H2b-616 from Mus musculus (Mouse) (see 6 papers)
G5BKL1 Histone H2B from Heterocephalus glaber
NP_783597 histone H2B type 2-B from Mus musculus
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...H2B1N Q99877 H2BC15 6p22.1 Replication dependent No H2B1O P23527 H2BC17 6p22.1 Replication dependent No H2B2F Q5QNW6 H2BC18 1q21.2 Replication dependent Yes H2B2E Q16778 H2BC21 1q21.2 Replication dependent No H2B3B Q8N257 H2BC26 1q42.13 Replication dependent No H3.1 (canonical) P68431 H3C1/2/3/4/6/7/8/10/11/12 6p22.1-6p22.2 Replication dependent No H3.2 (canonical) Q71DI3...”
• Novel approach to exploring protease activity and targets in HIV-associated obstructive lung disease using combined proteomic-peptidomic analysis.
  Samorodnitsky, Respiratory research 2024
  • “...91.9697 0.0009 0.0247 Tubulin beta-4B chain P68371 55.6507 90.7484 0.0022 0.0414 Histone H2B type 2-F Q5QNW6 56.8110 91.3487 0.0036 0.0414 Tubulin alpha-1A chain Q71U36 64.6865 91.1127 0.0045 0.0414 Glyceraldehyde-3-phosphate dehydrogenase P04406 65.3887 91.5802 0.0046 0.0414 Myosin-9 P35579 61.5678 88.5792 0.0046 0.0414 Aldehyde dehydrogenase, dimeric NADP-preferring P30838...”
• An Exosome-Laden Hydrogel Wound Dressing That Can Be Point-of-Need Manufactured in Austere and Operational Environments.
  Wisdom, Bioengineering (Basel, Switzerland) 2024
  • “...soluble proteins associated with other intracellular compartments than PM/endosomes P62805 H4C1 Histone H4 50 5 Q5QNW6 H2BC18 Histone H2B type 2-F 36 5 P10412 H1-4 Histone H1.4 23 5 P07305 H1-0 Histone H1.0 16 3 1 Peptides were detected but were below the signal-to-noise threshold for...”
• Determination of biomarker candidates for the placenta accreta spectrum by plasma proteomic analysis.
  Melekoglu, Scientific reports 2024
  • “...Insulin-like growth factor-binding protein complex acid labile subunit IGFALS 21.02 0.11 18.69 0.25 2.3364 <0.001 Q5QNW6 Isoform 2 of Histone H2B type 2-F HIST2H2BF 24.9 0.02 21.95 0.15 2.95295 <0.001 P80108 Phosphatidylinositol-glycan-specific phospholipase D GPLD1 19.37 0.22 17.82 1.25 1.54757 <0.001 P62277 40S ribosomal protein S13...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* Q16778 Histone H2B type 2-E 17593.68 * A0A2R8Y619 Histone H2B type 2-E1 311.58 * Q5QNW6 Histone H2B type 2-F 16807.41 * Q8N257 Histone H2B type 3-B 17593.68 * P57053 Histone H2B type F-S 16800.03 * Q6NXT2 Histone H3.3C 3853.37 * P62805 Histone H4 7844.59 *...”
• Sequence similarity between SARS-CoV-2 nucleocapsid and multiple sclerosis-associated proteins provides insight into viral neuropathogenesis following infection
  Lake, Scientific reports 2023
  • “...EPHX EPOX Homo sapiens (Human) P61968 LIM domain transcription factor LMO4 LMO4 Homo sapiens (Human) Q5QNW6 Histone H2B type 2-F H2BC18 HIST2H2BF Homo sapiens (Human) P01344 Insulin-like growth factor II IGF2 PP1446 Homo sapiens (Human) A4QPB2 Low-density lipoprotein receptor-related protein 5-like protein LRP5L Homo sapiens (Human)...”
• Towards the Definition of the Molecular Hallmarks of Idiopathic Membranous Nephropathy in Serum Proteome: A DIA-PASEF Approach.
  Previtali, International journal of molecular sciences 2023
  • “...H2A.J 0.3 H2B1K_HUMAN; H2BFS_HUMAN; H2B1D_HUMAN; H2B1C_HUMAN; H2B2F_HUMAN; H2B1H_HUMAN; H2B1N_HUMAN; H2B1M_HUMAN; H2B1L_HUMAN O60814; P57053; P58876; P62807; Q5QNW6; Q93079; Q99877; Q99879; Q99880 H2BC12; H2BC12L; H2BC5; H2BC4; H2BC18; H2BC9; H2BC15; H2BC14; H2BC13 Histone H2B type 1-K; Histone H2B type F-S; Histone H2B type 1-D; Histone H2B type 1-C/E/F/G/I; Histone...”
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...Histone H2B type 1-O HIST1H2BO 1.483903394 0.56939717 P06899 Histone H2B type 1-J HIST1H2BJ 1.483903394 0.56939717 Q5QNW6 Histone H2B type 2-F HIST2H2BF 1.483903394 0.56939717 Q93079 Histone H2B type 1-H HIST1H2BH 1.483903394 0.56939717 P33778 Histone H2B type 1-B HIST1H2BB 1.483903394 0.56939717 Q96A08 Histone H2B type 1-A HIST1H2BA 1.483903394...”
  • “...Histone H2B type 1-O HIST1H2BO 0.323611545 1.627665 P06899 Histone H2B type 1-J HIST1H2BJ 0.323611545 1.627665 Q5QNW6 Histone H2B type 2-F HIST2H2BF 0.323611545 1.627665 Q93079 Histone H2B type 1-H HIST1H2BH 0.323611545 1.627665 P33778 Histone H2B type 1-B HIST1H2BB 0.323611545 1.627665 Q96A08 Histone H2B type 1-A HIST1H2BA 0.323611545...”
• More
• Acute Hypoxia Alters Extracellular Vesicle Signatures and the Brain Citrullinome of Naked Mole-Rats (Heterocephalus glaber)
  D'Alessio, International journal of molecular sciences 2022
  • “...Skin-specific protein 32 V G5C656 Puratrophin-1 V G5APA7 Selenoprotein P V G5BH20 Histone H2B V G5BKL1 Histone H2B V G5ALS8 Keratin, type II cytoskeletal 1 (fragment) V G5ALS9 Keratin, type II cytoskeletal 1b (fragment) V G5B0M0 Junction plakoglobin V G5CAP7 Glyceraldehyde-3-phosphate dehydrogenase (fragment) V G5C5U7 Plectin-1...”
• Autoimmunity to isomerized histone H2B in systemic lupus erythematosus.
  Doyle, Autoimmunity 2013
  • GeneRIF: Autoimmunity to isoAsp H2B suggests that this form of the autoantigen may be critical in the induction of anti-histone autoantibodies in murine models of human SLE.
• The activity-dependent histone variant H2BE modulates the life span of olfactory neurons.
  Santoro, eLife 2012
  • GeneRIF: The activity-dependent histone variant H2BE modulates the life span of olfactory neurons.
• Histone H2B as a functionally important plasminogen receptor on macrophages.
  Das, Blood 2007
  • GeneRIF: H2B plays a very prominent and functionally important role as plasminogen receptor.
• Altered histone abundance as a mode of ovotoxicity during 7,12-dimethylbenz[a]anthracene exposure with additive influence of obesity†
  Rishi, Biology of reproduction 2024
  • “...a response to DMBA in obese mice (HPOC vs. HPOD). Uniprot ID Protein names log2(FC) Q64525 Histone H2B type 2-B 0.31 Table 1.4 List of histone proteins altered as a response to obesity in DMBA-exposed mice (HPLD vs. HPOD). Uniprot Protein name log2(FC) P62806 Histone H4...”
• Histone malonylation is regulated by SIRT5 and KAT2A
  Zhang, iScience 2023
  • “...6 KmalSAPAPK ( m / z 589.81, z= 2+) from mouse histone H2B type 2-B (Q64525) obtained by data-independent acquisition, that indicates that malonylation of K5 is increased in S5KO mouse brain tissues compared to wildtype (WT). (E) Quantification using the peak areas of four transitions...”
• ISG15 Is Required for the Dissemination of Vaccinia Virus Extracellular Virions
  Bécares, Microbiology spectrum 2023
  • “...Long-chain specific acyl-CoA dehydrogenase, mitochondrial Acadl 1.37 2.70 Nucleus P15864 Histone H1.2 H1-2 1.84 6.00 Q64525 Histone H2B type 2-B Hist2h2bb 1.64 3.04 P43277 Histone H1.3 H1-3 1.49 2.36 P17095 High mobility group protein HMG-I/HMG-Y Hmga1 1.38 2.74 P62806 Histone H4 H4c1 1.10 6.00 P43274 Histone...”
• Retinal Proteomic Analysis in a Mouse Model of Endotoxin-Induced Uveitis Using Data-Independent Acquisition-Based Mass Spectrometry
  Zhang, International journal of molecular sciences 2022
  • “...0.010 Q3UER8 Fgg Fibrinogen gamma chain 4.177 0.000 E9PV24 Fga Fibrinogen alpha chain 3.690 0.000 Q64525 Hist2h2bb Histone H2B type 2-B 3.307 0.013 Q9D0J8 Ptms Parathymosin 3.082 0.007 Q1WWK3 H1f5 Hist1h1b protein 2.537 0.023 Q6W8Q3 Pcp4l1 Purkinje cell protein 4-like protein 1 2.568 0.000 Q3TE95 Rcn2...”
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...H2B clustered histone 15 Hist1h2bn MGI:2448407 P10853 H2B H2bc18 H2B clustered histone 18 Hist2h2bb MGI:2448413 Q64525 H2B* H2bc21 H2B clustered histone 21 Hist2h2be MGI:2448415 Q64524 H2B H2bc22 H2B clustered histone 22 Hist1h2bp MGI:2448409 Q8CGP2 H2B H2bc23 H2B clustered histone 23 Hist1h2bq MGI:3702051 Q8CBB6 H2B H2bc24 H2B...”
• Isozyme-specific comprehensive characterization of transglutaminase-crosslinked substrates in kidney fibrosis.
  Tatsukawa, Scientific reports 2018
  • “...c, somatic + Q99LB2 Dehydrogenase/reductase SDR family member 4 + P58252 Elongation factor 2 + Q64525 Histone H2B type 2-B + Q9ERE2 Keratin, type II cuticular Hb1 (Fragment) + Q78PY7 Staphylococcal nuclease domain-containing protein 1 + Q9ERD7 Tubulin -3 chain + P62270 40S ribosomal protein S18...”
• Biochemical isolation of myonuclei employed to define changes to the myonuclear proteome that occur with aging.
  Cutler, Aging cell 2017
  • “...ribonucleoprotein A0 RNA processing 0.71 0.046 P70372 Elavl1 ELAVlike protein 1 RNA processing 0.75 0.013 Q64525 Hist2h2bb Histone H2B type 2B Chromatin maintenance 0.75 0.013 A0A087WRG2 U2surp Isoform of Q6NV83, U2 snRNPassociated SURP motifcontaining protein RNA processing 0.80 0.021 P70288 Hdac2 Histone deacetylase 2 Chromatin maintenance...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...gene: hist1h2bp (putative spliced isoform) Hist1h2bp Q8CGP2-2 [ 41 ] Canonical H2B gene: Hist2h2bb Hist2h2bb Q64525 [ 41 ] Canonical H2B gene: Hist2h2be Hist2h2be Q64524 [ 41 ] Canonical H2B gene: Hist3h2ba Hist3h2ba Q9D2U9 [ 41 ] Canonical H2B gene: Hist3h2bb Hist3h2bb Q8CGP0 * TS H2B.1...”
• More

H2B1H_MOUSE / Q64478 Histone H2B type 1-H; H2B-clustered histone 9; h2B-221 from Mus musculus (Mouse) (see 6 papers)
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Comparative Proteomic Study of Retinal Ganglion Cells Undergoing Various Types of Cellular Stressors.
  Starr, bioRxiv : the preprint server for biology 2024
  • “...increase in chromodomain-helicase-DNA-binding protein 4 (Q6PDQ2), histone H2B type 3-A (Q9D2U9), Histone H2B type 1-H (Q64478), and other nuclear proteins ( Table 2 ). Among the reduced biological processes following ONC, we found that positive regulation of telomer and telomerase and spindle localization includes organelle localization...”
  • “...Acidic leucine-rich nuclear phosphoprotein 32 family member E P97822 0.035 elevated Histone H2B type 1-H Q64478 0.024 elevated Cullin-associated NEDD8-dissociated protein 1 Q6ZQ38 0.048 elevated Heterogeneous nuclear ribonucleoprotein F Q9Z2X1 0.029 elevated Eukaryotic initiation factor 4A-II E9Q561 0.012 elevated Protein DEK Q7TNV0 0.030 elevated Ras-related protein...”
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...H2B clustered histone 8 Hist1h2bg MGI:2448386 Q6ZWY9 H2B H2bc9 H2B clustered histone 9 Hist1h2bh MGI:2448387 Q64478 H2B H2bc11 H2B clustered histone 11 Hist1h2bj MGI:2448388 P10853 H2B H2bc12 H2B clustered histone 12 Hist1h2bk MGI:2448399 Q8CGP1 H2B H2bc13 H2B clustered histone 13 Hist1h2bl MGI:2448403 P10853 H2B H2bc14 H2B...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...Hist1h2br (putative spliced isoform) Hist1h2bq Q8CBB6 * Hist1h2br Q8CBB6 * Canonical H2B gene: Hist1h2bh Hist1h2bh Q64478 [ 41 ] Canonical H2B gene: Hist1h2bk Hist1h2bk Q8CGP1 [ 41 ] Canonical H2B gene: Hist1h2bm Hist1h2bm P10854 [ 41 ] Canonical H2B gene: Hist1h2bp Spliced isoform 1 (main) Hist1h2bp...”
• Proteomic Expression Changes in Large Cerebral Arteries After Experimental Subarachnoid Hemorrhage in Rat Are Regulated by the MEK-ERK1/2 Pathway.
  Müller, Journal of molecular neuroscience : MN 2017
  • “...expressional decrease that does not persist after MEK1/2 inhibition Accession number Protein name Log 2 Q64478 Histone H2B type 1-H 4.82 P05811 Alpha-crystallin B chain 4.47 Q8BGD9 Eukaryotic translation initiation factor 4B 4.09 P08009 Glutathione S-transferase Yb-3 3.64 Q5U2R0 Methionine adenosyltransferase 2 subunit beta 3.39 P62860...”
• The nonpolymorphic MHC Qa-1b mediates CD8+ T cell surveillance of antigen-processing defects.
  Oliveira, The Journal of experimental medicine 2010
  • “...127 A0JNS9 Histone H2B 74 AVSEGTKAVTKYTSSK 112-127 127 A0JNS9 Histone H2B 75 PEPAKSAPAPK 2-12 126 Q64478 Histone H2B type 1-H 76 PEPAKSAPAPKKG 2-14 126 Q64478 Histone H2B type 1-H 77 LGVKNSEPA 59-67 576 Q80UG5 Septin-9 78 LGVKNSEPAA 59-68 576 Q80UG5 Septin-9 79 SSPANISSLEFEDA 583-596 773 P51125...”

H2B2E_HUMAN / Q16778 Histone H2B type 2-E; H2B-clustered histone 21; Histone H2B-GL105; Histone H2B.q; H2B/q from Homo sapiens (Human) (see 6 papers)
G5BH20 Histone H2B from Heterocephalus glaber
NP_003519 histone H2B type 2-E from Homo sapiens
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  function: Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...H2B1O P23527 H2BC17 6p22.1 Replication dependent No H2B2F Q5QNW6 H2BC18 1q21.2 Replication dependent Yes H2B2E Q16778 H2BC21 1q21.2 Replication dependent No H2B3B Q8N257 H2BC26 1q42.13 Replication dependent No H3.1 (canonical) P68431 H3C1/2/3/4/6/7/8/10/11/12 6p22.1-6p22.2 Replication dependent No H3.2 (canonical) Q71DI3 H3C13/14/15 1q21.2 Replication dependent No H3.3 P84243...”
• From inside to outside: exploring extracellular antimicrobial histone-derived peptides as multi-talented molecules.
  Muñoz-Camargo, The Journal of antibiotics 2024
  • “...LTA [ 89 ] H2B human Amniotic human fluid Full length H2B 126bp +18.75 MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK Q16778 Endotoxin activity binding LPS [ 12 ] H2B Rhacophorus schlegelii Skin H2B 126bp +18.75 MPEPAKSAPAAKKGSKKAVSKVQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK Q75VN4 Antibacterial activity E. coli [ 42 ] H2B Litopenaeus vannamei hemocytes H2B 116bp +15.75...”
• Protein expression changes in Tibetan middle-to-long distance runners after the transition from high altitude to low altitude: Implications for enhancing endurance training.
  Wang, Sports medicine and health science 2024
  • “...variable region (Fragment) Ig H 1.88 0.04 up Q15166 Serum paraoxonase/lactonase3 PON3 1.82 0.02 up Q16778 HistoneH2Btype2-E HIST2H2BE 1.59 0.02 up A0A087WWD4 Neuralcelladhesionmolecule1 NCAM1 2.00 0.01 up Q8WTR4 Glycerophosphodiesterphosphodiesterasedomain-containingprotein5 GDPD5 1.23 0.04 up A2N0T6 VH6Djprotein (Fragment) VH6DJ 2.20 0.03 up P84243 HistoneH3.3 H3F3A 3.38 0.01 up...”
  • “...Golevl ProtID GO:0003677 DNA binding MF < 0.01 0.10 3 3 27 220 5 Q7L7L0 Q16778 P84243 GO:0016788 hydrolase activity, acting on ester bonds MF 0.07 0.10 2 4 27 220 4 Q15166 Q8WTR4 GO:0016020 membrane CC 0.08 0.10 4 14 27 220 2 Q6LAM1 Q20BI4...”
• Exercise-Dependent Modulation of Immunological Response Pathways in Endurance Athletes With and Without Atrial Fibrillation.
  Dorian, Journal of the American Heart Association 2024
  • “...type 3B Q8N257 3.0 2.20E06 Growth hormone variant P01242 2.9 4.20E05 Histone H2B type 2E Q16778 2.6 5.40E06 Histone H2B type 1K O60814 2.5 4.90E06 Histone H2B type 2E Q16778 2.4 4.00E06 Histone H2A type 1A Q96QV6 2.3 7.40E06 Histone H2A type 1 P0C0S8 2.1 4.90E06...”
• Composition and Function of Neutrophil Extracellular Traps.
  Wang, Biomolecules 2024
  • “...Wang, Chen, Xin, Beverley, Carlsen, Popov, Chang, Wang, and Soong [ 35 ] Histones H2B (Q16778) Spontaneous, PMA, LPS, A23187 nucleus Leishmania spp. Wang et al., 2011 Wang, Chen, Xin, Beverley, Carlsen, Popov, Chang, Wang, and Soong [ 35 ] Histone H4 (P62805) Spontaneous, PMA, LPS,...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* Q99877 Histone H2B type 1-N 16807.41 * P23527 Histone H2B type 1-O 17593.68 * Q16778 Histone H2B type 2-E 17593.68 * A0A2R8Y619 Histone H2B type 2-E1 311.58 * Q5QNW6 Histone H2B type 2-F 16807.41 * Q8N257 Histone H2B type 3-B 17593.68 * P57053 Histone H2B...”
• Unraveling molecular characteristic of fluoride neurotoxicity on U87 glial-like cells: insights from transcriptomic and proteomic approach.
  Puty, Frontiers in cellular neuroscience 2023
  • “...type 1-N + 489.46 + 489.46 P23527 Histone H2B type 1-O + 489.46 + 489.46 Q16778 Histone H2B type 2-E + 489.46 + 489.46 Q5QNW6 Histone H2B type 2-F + 489.46 + 489.46 Q8N257 Histone H2B type 3-B + 458,83 + 458.83 P57053 Histone H2B type...”
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...Histone H2B type 1-C/E/F/G/I HIST1H2BC 1.483903394 0.56939717 Q99880 Histone H2B type 1-L HIST1H2BL 1.483903394 0.56939717 Q16778 Histone H2B type 2-E HIST2H2BE 1.483903394 0.56939717 Q8N257 Histone H2B type 3-B HIST3H2BB 1.483903394 0.56939717 Q99879 Histone H2B type 1-M HIST1H2BM 1.483903394 0.56939717 Q99877 Histone H2B type 1-N HIST1H2BN 1.483903394...”
  • “...Histone H2B type 1-C/E/F/G/I HIST1H2BC 0.323611545 1.627665 Q99880 Histone H2B type 1-L HIST1H2BL 0.323611545 1.627665 Q16778 Histone H2B type 2-E HIST2H2BE 0.323611545 1.627665 Q8N257 Histone H2B type 3-B HIST3H2BB 0.323611545 1.627665 Q99879 Histone H2B type 1-M HIST1H2BM 0.323611545 1.627665 Q99877 Histone H2B type 1-N HIST1H2BN 0.323611545...”
• More
• Acute Hypoxia Alters Extracellular Vesicle Signatures and the Brain Citrullinome of Naked Mole-Rats (Heterocephalus glaber)
  D'Alessio, International journal of molecular sciences 2022
  • “...cytoskeletal 27 G5B7I2 Pre-mRNA-splicing factor SYF1 G5BSE8 Histone H2A G5C2U0 Piezo-type mechanosensitive ion channel component G5BH20 Histone H2B G5BAY8 Lysine-specific demethylase 5C G5B251 Heat shock cognate 71 kDa protein G5APP5 Complement component C8 beta chain G5AV43 Biliverdin reductase A G5AVH0 Transient receptor potential cation channel subfamily...”
  • “...core protein V G5BUY9 Skin-specific protein 32 V G5C656 Puratrophin-1 V G5APA7 Selenoprotein P V G5BH20 Histone H2B V G5BKL1 Histone H2B V G5ALS8 Keratin, type II cytoskeletal 1 (fragment) V G5ALS9 Keratin, type II cytoskeletal 1b (fragment) V G5B0M0 Junction plakoglobin V G5CAP7 Glyceraldehyde-3-phosphate dehydrogenase...”
• Nucleotide variation in histone H2BL drives crossalk of histone modification and promotes tumour cell proliferation by upregulating c-Myc.
  Zhang, Life sciences 2021 (PubMed)
  • GeneRIF: Nucleotide variation in histone H2BL drives crossalk of histone modification and promotes tumour cell proliferation by upregulating c-Myc.
• Overexpression of ring finger protein 20 inhibits the progression of liver fibrosis via mediation of histone H2B lysine 120 ubiquitination.
  Chen, Human cell 2021 (PubMed)
  • GeneRIF: Overexpression of ring finger protein 20 inhibits the progression of liver fibrosis via mediation of histone H2B lysine 120 ubiquitination.
• Cancer-associated histone mutation H2BG53D disrupts DNA-histone octamer interaction and promotes oncogenic phenotypes.
  Wan, Signal transduction and targeted therapy 2020
  • GeneRIF: Cancer-associated histone mutation H2BG53D disrupts DNA-histone octamer interaction and promotes oncogenic phenotypes.
• The H2BG53D oncohistone directly upregulates ANXA3 transcription and enhances cell migration in pancreatic ductal adenocarcinoma.
  Wan, Signal transduction and targeted therapy 2020
  • GeneRIF: The H2BG53D oncohistone directly upregulates ANXA3 transcription and enhances cell migration in pancreatic ductal adenocarcinoma.
• HIV-Infected Patients: Cross Site-Specific Hydrolysis of H2a and H2b Histones and Myelin Basic Protein with Antibodies against These Three Proteins.
  Baranova, Biomolecules 2020
  • GeneRIF: HIV-Infected Patients: Cross Site-Specific Hydrolysis of H2a and H2b Histones and Myelin Basic Protein with Antibodies against These Three Proteins.
• TRAIP regulates Histone H2B monoubiquitination in DNA damage response pathways.
  Han, Oncology reports 2019 (PubMed)
  • GeneRIF: hese results suggest that TRAIP is a novel regulator of H2B monoubiquitination in DNA damage response and cancer development in lung adenocarcinoma.
• let-7b and let-7c microRNAs promote histone H2B ubiquitylation and inhibit cell migration by targeting multiple components of the H2B deubiquitylation machinery.
  Spolverini, Oncogene 2017
  • GeneRIF: Findings uncover a novel function of let-7 miRNAs as regulators of H2B ubiquitylation, suggesting an additional mechanism whereby these miRNAs can exert their tumor-suppressive effects.
• Downregulation of histone H2A and H2B pathways is associated with anthracycline sensitivity in breast cancer.
  Braunstein, Breast cancer research : BCR 2016
  • GeneRIF: Gene expression analysis identified deregulation of histone H2A and H2B genes in all four cell lines ;histone pathways are associated with epirubicin resistance
• More

B6T9A0 Histone H2B from Zea mays
GRMZM2G305027 histone H2B.1-like from Zea mays
80% identity, 34% coverage

• Evaluation of the effects of humic acids on maize root architecture by label-free proteomics analysis
  Nunes, Scientific reports 2019
  • “...1.0E-05 D1ME28 Uncharacterized protein 2.5 1.0E-05 K7WEL8 Uncharacterized protein 2.4 3.4E-03 K7VX77 Hexokinase 2.4 1.0E-05 B6T9A0 Histone H2B 2.3 0.01 K7V792 Uncharacterized protein 2.3 3.7E-03 B4FZ29 Argininosuccinate synthase 2.2 0.02 B6T8I3 Disease resistance response protein 206 2.1 0.04 B4FH88 C-1-tetrahydrofolate synthase. cytoplasmic 2.1 1.0E-05 B6TLS0 Ubiquitin...”
• Quantitative trait loci and candidate genes for iron and zinc bio-fortification in genetically diverse germplasm of maize (Zea mays L): A systematic review
  Basnet, Heliyon 2022
  • “...8 6 S8_125472630 GRMZM2G048200 S8_67381104 GRMZM2G027546 S8_93112257 AC206644.4_FGT003 S9_136390177 GRMZM2G406737 9 3 S9_136389202 GRMZM2G489070 S9_139191545 GRMZM2G305027 S10_54119964 GRMZM2G073371 10 3 S10_136070835 GRMZM2G152076 S10_81182541 GRMZM2G123410 In Rice, chromosome number 3 contains a special RIN O 1 gene that codes for phytic acid biosynthesis by considering this gene...”
• Identification of Genomic Regions Associated with Agronomic and Disease Resistance Traits in a Large Set of Multiple DH Populations
  Sadessa, Genes 2022
  • “...2.08 10 6 0.21 0.34 GRMZM2G165357 uncharacterized LOC100193447 S9_150809900 9 9.68 10 7 0.16 0.45 GRMZM2G305027 D-type cyclin S10_85581257 10 5.47 10 6 0.49 0.3 GRMZM2G060798 uncharacterized LOC100279979 ASI_WW S2_194040196 2 1.11 10 8 0.24 0.2 GRMZM2G137541 uncharacterized LOC100286191 S2_2055642 2 2.63 10 6 0.35 0.1...”

H2B3A_MOUSE / Q9D2U9 H2B.U histone 2; Histone H2B type 3-A from Mus musculus (Mouse) (see 7 papers)
D3ZNZ9 Histone H2B from Rattus norvegicus
73% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA.
• Proteome-wide lysine acetylation in cortical astrocytes and alterations that occur during infection with brain parasite Toxoplasma gondii
  Bouchut, PloS one 2015
  • “...histone cluster 1, H2bm -3.5 P62804 histone cluster 1, H4m -3.7 M0RCB8 histone H3.3B-like -6 D3ZNZ9 histone cluster 3, H2ba -10.1 Cytoskeleton P68370 tubulin alpha-1A chain -2.3 Differentiation P62161 calmodulin -2.4 Metabolism Q9EQS0 transaldolase -2.3 P16617 phosphoglycerate kinase 1 -3 P56574 isocitrate dehydrogenase [NADP], mitochondrial precursor...”
• Comparative Proteomic Study of Retinal Ganglion Cells Undergoing Various Types of Cellular Stressors.
  Starr, bioRxiv : the preprint server for biology 2024
  • “...processes were accompanied by an increase in chromodomain-helicase-DNA-binding protein 4 (Q6PDQ2), histone H2B type 3-A (Q9D2U9), Histone H2B type 1-H (Q64478), and other nuclear proteins ( Table 2 ). Among the reduced biological processes following ONC, we found that positive regulation of telomer and telomerase and...”
  • “...1 P50096 0.047 elevated Peptidyl-prolyl cis-trans isomerase A P17742 0.020 elevated Histone H2B type 3-A Q9D2U9 0.024 elevated Acidic leucine-rich nuclear phosphoprotein 32 family member E P97822 0.035 elevated Histone H2B type 1-H Q64478 0.024 elevated Cullin-associated NEDD8-dissociated protein 1 Q6ZQ38 0.048 elevated Heterogeneous nuclear ribonucleoprotein...”
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...clustered histone 26, pseudogene Hist3h2bb-ps MGI:1922442 NA H2B H2bc27 H2B clustered histone 27 Hist3h2ba MGI:1925553 Q9D2U9 SubH2Bv/H2B.L** H2bl1 H2B.L histone variant 1 1700024P04Rik MGI:1916632 Q9D9Z7 H2B.W H2bw2 H2B.W histone 2 H2bfm MGI:1916639 Q9DAB5 * This variant has never been characterized experimentally and so has no Strasbourg...”
• Comprehensive Proteomic Profiling of Urinary Exosomes and Identification of Potential Non-invasive Early Biomarkers of Alzheimer's Disease in 5XFAD Mouse Model
  Song, Frontiers in genetics 2020
  • “...protein HSP 90-beta; Endoplasmin P11499;P08113 Hsp90ab1;Hsp90b1 1 0 3 NA NA Histone H2B type 3-A Q9D2U9 Hist3h2ba 1 3 3 0.50 0.05 Histone H3.3 P84244 H3f3a 1 3 3 0.29 0.05 mRNA cap guanine-N7 methyltransferase Q9D0L8 Rnmt 1 3 3 0.30 0.05 Neuropilin and tolloid-like protein...”
• Maternal High Fat Diet and in-Utero Metformin Exposure Significantly Impact upon the Fetal Renal Proteome of Male Mice.
  Nüsken, Journal of clinical medicine 2019
  • “...0 3 Nipsnap1 Q9CR51 V-type proton ATPase subunit G 1 <0.05 14.3 0 3 Atp6v1g1 Q9D2U9 Histone H2B type 3-A <0.001 12.0 0 3 Hist3h2ba Q02013 Aquaporin-1 <0.05 10.1 0 3 Aqp1 A0A1L1SUX8 Thy-1 membrane glycoprotein <0.05 10.0 0 3 Thy1 B1AQR8 Galectin <0.05 9.2 0...”
  • “...<0.001 16.6 0 3 Nipsnap1 P11438 Lysosome-associated membrane glycoprotein 1 <0.05 15.5 0 3 Lamp1 Q9D2U9 Histone H2B type 3-A <0.05 13.6 0 3 Hist3h2ba $ G3UXX5 DNA-directed RNA polymerases I and III subunit RPAC1 <0.05 11.3 0 3 Polr1c $ Q9EP89 Serine beta-lactamase-like protein LACTB,...”
• Isozyme-specific comprehensive characterization of transglutaminase-crosslinked substrates in kidney fibrosis.
  Tatsukawa, Scientific reports 2018
  • “...nuclear ribonucleoprotein U + P63158 High mobility group protein B1 + Q8R1M2 Histone H2A.J + Q9D2U9 Histone H2B type 3-A + P84244 Histone H3.3 + P62960 Nuclease-sensitive element-binding protein 1 + P09405 Nucleolin + Q8BK67 Protein RCC2 + P27005 Protein S100-A8 + P54276 REVERSED DNA mismatch...”
• Global identification and analysis of isozyme-specific possible substrates crosslinked by transglutaminases using substrate peptides in mouse liver fibrosis.
  Tatsukawa, Scientific reports 2017
  • “...+ Q9CWF2 Tubulin -2B chain + Q63836 Selenium-binding protein 2 + Q9Z1T2 REVERSED Thrombospondin-4 + Q9D2U9 Histone H2B type 3-A + Q9D646 Keratin, type I cuticular Ha4 + Q9Z2K1 Keratin, type I cytoskeletal 16 + Q9Z2T6 Keratin, type II cuticular Hb5 + Q921I1 Serotransferrin + P68372...”
  • “...II cytoskeletal 8 + + + Q99LB2 Dehydrogenase/reductase SDR family member 4 + + + Q9D2U9 Histone H2B type 3-A + + + Q9JJN0 DNA polymerase + + Q6ZWV3 60S ribosomal protein L10 + + Q8K0E8 Fibrinogen chain + + Q8VCM7 Fibrinogen chain + + P02089...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...] Canonical H2B gene: Hist2h2be Hist2h2be Q64524 [ 41 ] Canonical H2B gene: Hist3h2ba Hist3h2ba Q9D2U9 [ 41 ] Canonical H2B gene: Hist3h2bb Hist3h2bb Q8CGP0 * TS H2B.1 (TH2B) TS H2B.1 (TH2B) Hist1h2ba P70696 [ 41 , 79 ] subH2B (H2BL.1) subH2B (H2BL.1) 1700024p04rik Q9D9Z7 [...”
• Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
  Ayyar, Journal of proteomics 2017
  • “...H1.4 Condense nucleosome chains into chromatin fibers; regulator of gene transcription by chromatin remodeling UP/DOWN Q9D2U9 Hist3h2ba Histone H2B type 3-A Component of nucleosome; role in transcription , DNA repair, DNA replication and chromosomal stability UP P84245 H3.3 Histone H3.3 Incorporated into chromatin independently of DNA...”
• More

H2B7_CHICK / P0C1H5 Histone H2B 7; H2B VII from Gallus gallus (Chicken) (see 4 papers)
R0M210 Histone H2B (Fragment) from Anas platyrhynchos
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA.
• Plasma Proteome Alterations of Laying Hens Subjected to Heat Stress and Fed a Diet Supplemented with Pequi Oil (<i>Caryocar brasiliense Camb.</i>): New Insights in the Identification of Heat Stress Biomarkers
  da, Biomolecules 2024
  • “..., H2B-II , H2B-III , H2B-IV , H2B-VI 345.93 P0C1H4 Histone H2B 5 H2B-V 345.93 P0C1H5 Histone H2B 7 H2B-VII 86.92 Q9PSW9 Histone H2B 8 H2B-VIII 345.93 A0A8V0YNS6 Histone H2B HIST1H2B5 345.93 A0A8V0XA69 Immunoglobulin V-set domain-containing protein - 523.52 A0A8V0Z0S7 phosphopyruvate hydratase ENO 81.44 A2N890 VH1...”
• TMT-based quantitative proteomic analysis of IBDV-infected CEF cells reveals a favorable role of chicken IRF10 in IBDV replication via suppressing type-I interferon expression
  Zhang, Poultry science 2024
  • “...sequence-specific DNA binding A0A8V0XYM6 RBM43 2.8 RNA-binding A0A8V0ZK53 ZFP36L2 2.6 mRNA 3-UTR AU-rich region binding P0C1H5 H2B-VII 4.2 protein-containing complex binding O93327 H2AFY 2.7 ADP-D-ribose modification-dependent protein binding P09860 TNNC1 0.32 calcium-dependent protein binding P02588 TNNC2 0.34 calcium ion binding A0A1D5NWB1 LIMD2 0.36 actin filament binding...”
• Histones from Avian Erythrocytes Exhibit Antibiofilm activity against methicillin-sensitive and methicillin-resistant Staphylococcus aureus.
  Rose-Martel, Scientific reports 2017
  • “...Histone H2B 1/2/3/4/6Histone H2B 8Histone H2B 7 27 P0C1H3 191 75 26 Q9PSW9 75 25 P0C1H5 69 Band 6 Histone H2A (III, IV) 18 P35062, P02263 151 72 Histone H2A.V 6 P02272 54 Histone H2A (fragment) 3 F1P5G5 16 Band 7 Histone H4 29 P62801 14.60.4...”
• The proteome of the infectious bronchitis virus Beau-R virion.
  Dent, The Journal of general virology 2015
• Improvement in Emulsifying Capacity of Goose Liver Protein Treated by pH Shifting with Addition of Sodium Tripolyphosphate and Its Proteomics Analysis.
  Zhang, Foods (Basel, Switzerland) 2022
  • “...U3J1L1, P01989, R0JSM9, and R0LAD1, and was also highly negatively related with particle size and R0M210, R0M714, and R0LFA3. The emulsifying activity index (EAI) demonstrated highly positive correlation with protein solubility, and was correlated with R0JKI4, R0KK84, R0L1Y3, R0LCM7, A0A068C605, and U3IW62. goose liver protein pH...”
  • “...R0KA48, R0KFP7, U3J1L1, P01989, R0JSM9, R0LAD1, R0LCM7, and A0A068C605 and highly and negatively related with R0M210, R0M714, and R0LFA3. The EAI showed a high relationship with A0A0K1R5T3, P01989, R0JKI4, R0KA48, R0KFP7, R0KK84, R0L1Y3, R0JSM9, R0LAD1, R0LCM7, A0A068C605, U3IQ39, and U3IW62. However, the EAI was highly negatively...”

O22582 Histone H2B from Gossypium hirsutum
76% identity, 35% coverage

• Grapevine cell early activation of specific responses to DIMEB, a resveratrol elicitor.
  Zamboni, BMC genomics 2009
  • “...1620332_at Histone H3 A2Y533 TC59489 x 1622440_at Histone H3 A2Y533 TC64779 x 1622737_at Histone H2B O22582 TC64405 x 1610854_at Proliferating cell nuclear antigen P22177 TC54817 x 1610422_at Patellin-6 Q9SCU1 TC61622 x 1610607_at Gip1-like protein Q93WR4 TC66111 x 1613373_at Formin-like protein 1 Q8S0F0 TC55249 x 1607792_at Putative...”

H2B1_ARATH / Q9LQQ4 Histone H2B.1; HTB1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT1G07790 HTB1; DNA binding from Arabidopsis thaliana
76% identity, 34% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Interacts with AHL27.
• iTRAQ-based quantitative proteomic analysis reveals the lateral meristem developmental mechanism for branched spike development in tetraploid wheat (Triticum turgidum L.)
  Chen, BMC genomics 2018
  • “...methylation Aegilops tauschii TRIAE_CS42_1AL_TGACv1_001923_AA0036820 W4ZPI7 2.274 1.851 A0A178V1F6 endopeptidase Aegilops tauschii Traes_6DL_2807D89841 W5GUY7 2.323 1.992 Q9LQQ4 histone H2B.2-like Aegilops tauschii Traes_4BL_58958C7B9 W5E3M3 2.388 1.806 Q8H0V1 CDK5RAP1-like protein Aegilops tauschii Temporal and spatial expression of candidate genes To look for correlations between mRNA levels and protein abundance,...”
• Microgravity induces changes in microsome-associated proteins of Arabidopsis seedlings grown on board the international space station
  Mazars, PloS one 2014
  • “...H1.1 Q94F49 AT5G27670 0.21652 Probable histone H2A.5 (HTA7) Q9FJE8 AT5G59870 0.23441 Probable histone H2A.7 (HTA6) Q9LQQ4 AT1G07790 0.34323 Histone H2B.1 (HTB1) Cell wall metabolism Q9FM65 AT5G55730 0.3768 Fasciclin-like arabinogalactan protein 1 O22126 AT2G45470 0.87579 Fasciclin-like arabinogalactan protein 8 (AtAGP8) Q39099 AT2G06850 0.53895 Xyloglucan endotransglucosylase/hydrolase protein 4...”
• An R2R3-type MYB transcription factor, GmMYB77, negatively regulates isoflavone accumulation in soybean [Glycine max (L.) Merr.]
  Liu, Plant biotechnology journal 2025 (no snippet)
• Advances in biological functions and mechanisms of histone variants in plants
  Wu, Frontiers in genetics 2023
  • “...al. (2018) ; Circadian clock Tong et al. (2020) AT1G52740 MBD9 AT3G54560 INO80 H2B H2B.1 AT1G07790 NAP1 NRP1 FACT H2B.2 AT5G22880 H2B.3 AT2G28720 H2B.4 AT5G59910 H2B.5 AT2G37470 H2B.6 AT3G53650 H2B.7 AT3G09480 H2B.8 AT1G08170 Regulate seed development but not expressed in sperm cells H2B.9 AT3G45980 H2B.10 AT5G02570...”
• Histone variants and modifications during abiotic stress response
  Nunez-Vazquez, Frontiers in plant science 2022
  • “...etal., 2017 ) Variant At2g38810, HTA8 Variant At1g52740, HTA9 Variant At3g54560, HTA11 H2B H2B.1 Variant At1g07790, HTB1 NAP1, NRP1, FACT Transcriptional regulation, replacement variant ( Jiang etal., 2020a ) H2B.2 Variant At5g22880, HTB2 H2B.3 Variant At2g28720, HTB3 H2B.4 Variant At5g59910, HTB4 H2B.5 Variant At2g37470, HTB5 H2B.6...”
• Target pollen isolation using automated infrared laser-mediated cell disruption
  Kaneshiro, Quantitative plant biology 2022
  • “...The fluorescent protein tdTomato was fused with Arabidopsis thaliana H2B ( HISTONE 2 B ; At1g07790 ), which was driven by the A. thaliana UBQ10 ( UBIQUITIN 10 ; At4g05320 ) promoter (634 bp). Each fragment was cloned into the pGreen0029 vector (Hellens et al., 2000...”
• Dynamics of the cell fate specifications during female gametophyte development in Arabidopsis
  Susaki, PLoS biology 2021
  • “...the 2,568-bp upstream region of GPR1 (At3g23860) and the full-length coding region of H2B (HTB1: At1g07790) fused to mNeonGreen (Allele Biotechnology, San Diego, California, USA) with the (SGGGG) 2 linker, and the 1,959-bp downstream regions were cloned into the binary vector pPZP211 [ 19 ]. CDR1LIKE2pro...”
  • “...regions of AKV (At4g05440 [ 22 ]) and the full-length coding region of H2B (HTB1: At1g07790) fused to mScarletI with the (SGGGG) 2 linker). To enhance the expression level of H2BmScarletI, the 5 UTR of AtADH (alcohol dehydrogenase) was inserted between the AKV promoter and H2B...”
• A live imaging system to analyze spatiotemporal dynamics of RNA polymerase II modification in Arabidopsis thaliana
  Shibuta, Communications biology 2021
  • “...HiFi DNA Assembly Master Mix. To construct pRPS5a:EGFP-IntF2A-H2B-mRuby and pRPS5a:Ser2P-mintbody-IntF2A-H2B-mRuby, the cDNA sequences encoding HTB1 (AT1G07790), IntF2A (an artificially synthesized sequence was used as the template), and mRuby3 were amplified by PCR and recombined into the Nde I and Sal I-digested pRI201-AN vector using the NEBuilder...”
• Persistent directional growth capability in Arabidopsis thaliana pollen tubes after nuclear elimination from the apex
  Motomura, Nature communications 2021
  • “...in the present study are as follows: WIT1 (AT5G11390), WIT2 (AT1G68910), CALS3/GSL12 (AT5G13000), HISTONE 2B (AT1G07790), GCS1/HAPLESS2 (AT4G11720), RANGAP1 (AT3G63130), HTR10/MGH3 (AT1G19890), SYP132 (AT5G08080), PRK6 (AT5G20690), and ACA3 (AT5G04180). Plant materials and growth conditions Arabidopsis thaliana Columbia-0 (Col-0) was used as the wild-type plant and the...”
• Detection of a biolistic delivery of fluorescent markers and CRISPR/Cas9 to the pollen tube
  Nagahara, Plant reproduction 2021
  • “...) and self-ligation of the PCR product to remove the H2B ( HISTONE 2 B; At1g07790 ) sequence. The sequences of AtUBQ10p::sGFP (sSNv25), AtUBQ10p::tdTomato (sSNv26), and AtUBQ10p::H2B-mClover (sSNv28) followed by the Nos -terminator sequence were isolated from the DKv909, DKv922, and DKv916 vectors, respectively (Kurihara et...”
• More

H2B1M_MOUSE / P10854 Histone H2B type 1-M; H2B 291B from Mus musculus (Mouse) (see 6 papers)
H2B1D_HUMAN / P58876 Histone H2B type 1-D; H2B-clustered histone 5; HIRA-interacting protein 2; Histone H2B.1 B; Histone H2B.b; H2B/b from Homo sapiens (Human) (see 7 papers)
L8IS67 Histone H2B from Bos mutus
F2Z584 Histone H2B from Sus scrofa
NP_619790 histone H2B type 1-D from Homo sapiens
Q2KII5 Histone H2B from Bos taurus
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Comparative Analysis of Erythrocyte Proteomes of Water Buffalo, Dairy Cattle, and Beef Cattle by Shotgun LC-MS/MS
  Guo, Frontiers in veterinary science 2019
  • “...beta (Fragment) 7 3 13221.97 7.15 Q32PA4 14 kDa phosphohistidine phosphatase 1 1 13930.38 5.49 L8IS67 Histone H2B 5 4 13936 10.31 L8II47 Nuclear transport factor 2 1 1 14478.33 5.1 B5A5S9 Fatty acid binding protein 4 1 1 14671.65 5.22 Q0II81 Regulator of G-protein signaling...”
• Proteomic Analysis of Porcine-Derived Collagen Membrane and Matrix
  Lee, Materials (Basel, Switzerland) 2020
  • “...DCN I3LC73 Fatty acid synthase FASN F1RII7 Hemoglobin subunit beta HBB A0A287B959 Histone H2A HIST1H2AC F2Z584 Histone H2B HIST1H2BD P62802 Histone H4 no symbol for pig A0A286ZZ03 Ig-like and FN type III dom.-cont. protein 1 IGFN1 F1SQ09 Lumican precursor LUM A0A287AB52 Microfibril associated protein 4 MFAP4...”
• Epigenetic landscape of testis specific histone H2B variant and its influence on sperm function.
  Patankar, Clinical epigenetics 2021
  • GeneRIF: Epigenetic landscape of testis specific histone H2B variant and its influence on sperm function.
• Structural Basis of Dot1L Stimulation by Histone H2B Lysine 120 Ubiquitination.
  Valencia-Sánchez, Molecular cell 2019
  • GeneRIF: We report cryo-EM structures of human Dot1L bound to (1) H2BK120Ub and (2) unmodified nucleosome substrates at 3.5 A and 4.9 A, respectively. Comparison of both structures, complemented with biochemical experiments, provides critical insights into the mechanism of Dot1L stimulation by H2BK120Ub.
• Changes in protein fluxes in skeletal muscle during sequential stages of muscle regeneration after acute injury in male mice.
  Bizieff, Scientific reports 2024
  • “...Trifunctional enzyme subunit alpha Q8BMS1 Mitochondria 0.2670.249%* 12.7989.815% 6.1653.573% 3.0621.035% 8 Histone H2B type 1-M P10854 Histone 4.2021.405%* 6.1511.995% 3.1121.227%* 1.0660.478% 9 Phosphoglycerate kinase 1 P09411 Glycolysis 1.0200.52% 12.8256.042% 10.1093.629%* 2.6040.595% 10 NADH dehydrogenase iron-sulfur protein 6 P52503 OxPhos 2.6730.083% 8.1622.842% 6.1572.794% 3.5140.437% 11 ATP synthase...”
• Proteomic Profiling and Functional Analysis of B Cell-Derived Exosomes upon Pneumocystis Infection
  Ma, Journal of immunology research 2022
  • “...H4c1 1.516 3.010 E -03 Q8CGP0 Histone H2B type 3-B H2bu1-ps 1.513 3.093 E -04 P10854 Histone H2B type 1-M H2bc14 1.475 1.079 E -03 P10922 Histone H1.0 H1f0 1.465 3.718 E -02 P02301 Histone H3.3C H3f3c 1.458 6.179 E -03 Transcription regulation Q9CQE8 RNA transcription,...”
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...H2B clustered histone 13 Hist1h2bl MGI:2448403 P10853 H2B H2bc14 H2B clustered histone 14 Hist1h2bm MGI:2448404 P10854 H2B H2bc15 H2B clustered histone 15 Hist1h2bn MGI:2448407 P10853 H2B H2bc18 H2B clustered histone 18 Hist2h2bb MGI:2448413 Q64525 H2B* H2bc21 H2B clustered histone 21 Hist2h2be MGI:2448415 Q64524 H2B H2bc22 H2B...”
• The central nervous system can directly regulate breast cancer progression and blockage by quercetin.
  Luo, Annals of translational medicine 2021
  • “...Hpx 1.3109 0.0258 Q03963 Eif2ak2 1.2984 0.0003 Q9Z0E6 Gbp2 1.2746 0.0108 P01865 Igh-1a 1.2709 0.0012 P10854 H2bc14 1.2568 0.0400 Q6Q899 Ddx58 1.2532 0.0319 Q64112 Ifit2 1.2506 0.0018 P68369 Tuba1a 1.2302 0.0326 Q60766 Irgm1 1.2302 0.0086 Q9CQ10 Chmp3 1.2266 0.0004 Q6PHZ2 Camk2d 1.2244 0.0228 P14824 Anxa6 1.2156...”
  • “...Hnrnpc 0.8176 0.0110 P62806 H4c1 0.8052 0.0468 Q9Z0E6 Gbp2 0.7987 0.0141 Q6Q899 Ddx58 0.7976 0.0336 P10854 H2bc14 0.7942 0.0146 Q60766 Irgm1 0.7787 0.0053 P01635 Ig kappa chain V-V region K2 (Fragment) 0.7760 0.0110 Q9ESB3 Hrg 0.7732 0.0122 P68369 Tuba1a 0.7719 0.0071 Q03963 Eif2ak2 0.7640 0.0021 Q61107...”
• Isozyme-specific comprehensive characterization of transglutaminase-crosslinked substrates in kidney fibrosis.
  Tatsukawa, Scientific reports 2018
  • “...ribonucleoprotein A/B + Q8VEK3 Heterogeneous nuclear ribonucleoprotein U + Q8CGP7 Histone H2A type 1-K + P10854 Histone H2B type 1-M + O89017 Legumain + P26041 Moesin + P17225 Polypyrimidine tract-binding protein 1 + Q61656 Probable ATP-dependent RNA helicase DDX5 + P26043 Radixin + Q62093 Splicing factor,...”
• Proteomic and functional analysis identifies galectin-1 as a novel regulatory component of the cytotoxic granule machinery.
  Clemente, Cell death & disease 2017
  • “...46 8 Galectin-1 P10812 14866/5.3 62 10 Histone H2A P22752 14182/10.9 63 7 Histone H2B P10854 13936/10.3 65 18 Table 2 List of proteins identified by 2D electrophoresis of CTL granule preparation Spot Protein ID Accession no MW/pI Coverage (%) Matched peptides 1 -spectrin/fodrin Q62261 274425/5.7...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...] Canonical H2B gene: Hist1h2bk Hist1h2bk Q8CGP1 [ 41 ] Canonical H2B gene: Hist1h2bm Hist1h2bm P10854 [ 41 ] Canonical H2B gene: Hist1h2bp Spliced isoform 1 (main) Hist1h2bp Q8CGP2 [ 41 ] Canonical H2B gene: hist1h2bp (putative spliced isoform) Hist1h2bp Q8CGP2-2 [ 41 ] Canonical H2B...”
• Biochemical isolation of myonuclei employed to define changes to the myonuclear proteome that occur with aging.
  Cutler, Aging cell 2017
  • “...age log2 fold change P value Uniprot ID Gene Symbol Protein name Role 3.40 0.001 P10854 Hist1h2bm Histone H2B type 1M Chromatin maintenance 3.19 0.003 P84228 Hist1h3b Histone H3.2 Chromatin maintenance 2.03 0.005 D3Z7R4 Syt1 Isoform of P46096, Synaptotagmin1 Vesicular trafficking 1.77 0.024 Q9CWF2 Tubb2b Tubulin...”
• More
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...TSH2B Q96A08 H2BC1 6p22.2 Replication dependent No H2B1B P33778 H2BC3 6p22.2 Replication dependent No H2B1D P58876 H2BC5 6p22.2 Replication dependent No H2B1H Q93079 H2BC9 6p22.2 Replication dependent No H2B1J P06899 H2BC11 6p22.2 Replication dependent H2B1K O60814 H2BC12 6p22.2 Replication dependent Yes H2B1L Q99880 H2BC13 6p22.1 Replication...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* P33778 Histone H2B type 1-B 17593.68 * P62807 Histone H2B type 1-C/E/F/G/I 16807.41 * P58876 Histone H2B type 1-D 16807.41 * Q93079 Histone H2B type 1-H 16807.41 * P06899 Histone H2B type 1-J 17593.68 * O60814 Histone H2B type 1-K 16807.41 * Q99880 Histone H2B...”
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...Histone H2B type 1-N HIST1H2BN 1.483903394 0.56939717 O60814 Histone H2B type 1-K HIST1H2BK 1.483903394 0.56939717 P58876 Histone H2B type 1-D HIST1H2BD 1.483903394 0.56939717 P99999 Cytochrome c CYCS 3.813895941 1.93126548 P62805 Histone H4 HIST1H4A 5.92928535 2.56785823 P31150 Rab GDP dissociation inhibitor alpha GDI1 7.200903224 2.84817788 P50395 Rab...”
  • “...Histone H2B type 1-N HIST1H2BN 0.323611545 1.627665 O60814 Histone H2B type 1-K HIST1H2BK 0.323611545 1.627665 P58876 Histone H2B type 1-D HIST1H2BD 0.323611545 1.627665 Q5XKE5 Keratin, type II cytoskeletal 79 KRT79 0.401826019 1.3153571 P68104 Elongation factor 1-alpha 1 EEF1A1 0.444543649 1.169603 Q5VTE0 Putative elongation factor 1-alpha-like 3...”
• Unraveling molecular characteristic of fluoride neurotoxicity on U87 glial-like cells: insights from transcriptomic and proteomic approach.
  Puty, Frontiers in cellular neuroscience 2023
  • “...type 1-B + 489.46 + 489.46 P62807 Histone H2B type 1-C/E/F/G/I + 489.46 + 489.46 P58876 Histone H2B type 1-D + 489.46 + 489.46 Q93079 Histone H2B type 1-H + 489.46 + 489.46 P06899 Histone H2B type 1-J + 489.46 + 489.46 O60814 Histone H2B type...”
• Towards the Definition of the Molecular Hallmarks of Idiopathic Membranous Nephropathy in Serum Proteome: A DIA-PASEF Approach.
  Previtali, International journal of molecular sciences 2023
  • “...1-J; Histone H2A.J 0.3 H2B1K_HUMAN; H2BFS_HUMAN; H2B1D_HUMAN; H2B1C_HUMAN; H2B2F_HUMAN; H2B1H_HUMAN; H2B1N_HUMAN; H2B1M_HUMAN; H2B1L_HUMAN O60814; P57053; P58876; P62807; Q5QNW6; Q93079; Q99877; Q99879; Q99880 H2BC12; H2BC12L; H2BC5; H2BC4; H2BC18; H2BC9; H2BC15; H2BC14; H2BC13 Histone H2B type 1-K; Histone H2B type F-S; Histone H2B type 1-D; Histone H2B type...”
• 6-Hydroxydopamine Induces Neurodegeneration in Terminally Differentiated SH-SY5Y Neuroblastoma Cells via Enrichment of the Nucleosomal Degradation Pathway: a Global Proteomics Approach
  Magalingam, Journal of molecular neuroscience : MN 2022
  • “...type 1-K HIST1H2BK 27,780 1.19E-02 0.094 P57053 Histone H2B type F-S H2BFS 27,888 1.19E-02 0.094 P58876 Histone H2B type 1-D HIST1H2BD 27,872 1.19E-02 0.094 P62807 Histone H2B type 1-C/E/F/G/I HIST1H2BC 27,812 1.19E-02 0.094 Q5QNW6 Histone H2B type 2-F HIST2H2BF 27,840 1.19E-02 0.094 Q93079 Histone H2B type...”
• Ellagic Acid Triggers the Necrosis of Differentiated Human Enterocytes Exposed to 3-Nitro-Tyrosine: An MS-Based Proteomic Study
  Díaz-Velasco, Antioxidants (Basel, Switzerland) 2022
  • “...related to nucleosome Q5QNW6 Histone H2B type 1-D H2BC5 0.048 0.73 Histone related to nucleosome P58876 Histone H2B type 1-H H2BC9 0.048 0.73 Histone related to nucleosome Q93079 D-dopachrome decarboxylase DDT 0.024 0.74 Tautomerization of D-dopachrome P30046 D-dopachrome decarboxylase-like protein DDTL 0.024 0.74 Lyase activity A6NHG4...”
• Unravelling the neuroprotective mechanisms of carotenes in differentiated human neural cells: Biochemical and proteomic approaches
  Magalingam, Food chemistry. Molecular sciences 2022
  • “...type 1-N HIST1H2BN 27,844 2.19E-02 0.523 P04792 Heat shock protein beta-1 HSPB1 45,566 1.29E-02 0.573 P58876 Histone H2B type 1-D HIST1H2BD 27,872 3.09E-02 0.623 P31150 Rab GDP dissociation inhibitor alpha GDI1 101,166 1.56E-02 0.638 P62805 Histone H4 HIST1H4A 22,734 3.50E-03 0.643 Q99879 Histone H2B type 1-M...”
• More
• Bull Sperm SWATH-MS-Based Proteomics Reveals Link between High Fertility and Energy Production, Motility Structures, and Sperm-Oocyte Interaction
  Gacem, Journal of proteome research 2023
  • “...and Limma Package accession number protein names gene names length AA mass (KDa) FC (log2) Q2KII5 histone H2B H2B 126 14 2.55 A0A4W2FGL7 family with sequence similarity 162 member A FAM162A 156 18 1.54 A0A4W2IDE6 UBC core domain-containing protein 147 17 1.48 A0A4W2CCN9 apolipoprotein A-I APOA1...”

A5A4L2 Histone H2B from Bubalus bubalis
75% identity, 41% coverage

• Proteomic changes in the milk of water buffaloes (Bubalus bubalis) with subclinical mastitis due to intramammary infection by Staphylococcus aureus and by non-aureus staphylococci
  Pisanu, Scientific reports 2019
  • “...protein 1 2.45 2.32 2.57 I Q2HJ60 Heterogeneous nuclear ribonucleoproteins A2/B1* 2.39 2.66 2.06 NM A5A4L2 Histone H2B* ,a 2.38 2.59 I P79136 F-actin-capping protein subunit beta 2.32 2.41 2.23 S P61157 Actin-related protein 3 2.31 2.27 2.35 S Q5KR47 Tropomyosin alpha-3 chain 2.31 2.37 2.24...”

H2B1N_HUMAN / Q99877 Histone H2B type 1-N; Histone H2B.d; H2B/d from Homo sapiens (Human) (see 6 papers)
NP_003511 histone H2B type 1-N from Homo sapiens
LOC101118999 histone H2B type 1-N from Ovis aries
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Hypomethylation signature of tumor-initiating cells predicts poor prognosis of ovarian cancer patients.
  Liao, Human molecular genetics 2014
  • GeneRIF: Hypomethylation of ATG4A and HIST1H2BN in ovarian tumor-initiating cells predicts a poor prognosis for ovarian cancer patients.
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...H2B1L Q99880 H2BC13 6p22.1 Replication dependent No H2B1M Q99879 H2BC14 6p22.1 Replication dependent No H2B1N Q99877 H2BC15 6p22.1 Replication dependent No H2B1O P23527 H2BC17 6p22.1 Replication dependent No H2B2F Q5QNW6 H2BC18 1q21.2 Replication dependent Yes H2B2E Q16778 H2BC21 1q21.2 Replication dependent No H2B3B Q8N257 H2BC26 1q42.13...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* Q99880 Histone H2B type 1-L 16807.41 * Q99879 Histone H2B type 1-M 16807.41 * Q99877 Histone H2B type 1-N 16807.41 * P23527 Histone H2B type 1-O 17593.68 * Q16778 Histone H2B type 2-E 17593.68 * A0A2R8Y619 Histone H2B type 2-E1 311.58 * Q5QNW6 Histone H2B...”
• Towards the Definition of the Molecular Hallmarks of Idiopathic Membranous Nephropathy in Serum Proteome: A DIA-PASEF Approach.
  Previtali, International journal of molecular sciences 2023
  • “...H2B1K_HUMAN; H2BFS_HUMAN; H2B1D_HUMAN; H2B1C_HUMAN; H2B2F_HUMAN; H2B1H_HUMAN; H2B1N_HUMAN; H2B1M_HUMAN; H2B1L_HUMAN O60814; P57053; P58876; P62807; Q5QNW6; Q93079; Q99877; Q99879; Q99880 H2BC12; H2BC12L; H2BC5; H2BC4; H2BC18; H2BC9; H2BC15; H2BC14; H2BC13 Histone H2B type 1-K; Histone H2B type F-S; Histone H2B type 1-D; Histone H2B type 1-C/E/F/G/I; Histone H2B type...”
• IgGFc-binding protein and MUC2 mucin produced by colonic goblet-like cells spatially interact non-covalently and regulate wound healing.
  Gorman, Frontiers in immunology 2023
  • “...analysis. Gene Name Protein name Uniprot ID Log2(KO to WT) HIST1H2BN Histone H2B type 1-N Q99877 -2.827358878 MUC2 Mucin-2 Q02817 -2.627092465 HIST1H1B Histone H1.5 P16401 -1.877685101 HSPB1 Heat shock protein beta-1 P04792 -1.830434114 RPL36A 60S ribosomal protein L36a-like;60S ribosomal protein L36a P83881 -1.31211515 YWHAE 14-3-3 protein...”
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...Histone H2B type 3-B HIST3H2BB 1.483903394 0.56939717 Q99879 Histone H2B type 1-M HIST1H2BM 1.483903394 0.56939717 Q99877 Histone H2B type 1-N HIST1H2BN 1.483903394 0.56939717 O60814 Histone H2B type 1-K HIST1H2BK 1.483903394 0.56939717 P58876 Histone H2B type 1-D HIST1H2BD 1.483903394 0.56939717 P99999 Cytochrome c CYCS 3.813895941 1.93126548 P62805...”
  • “...Histone H2B type 3-B HIST3H2BB 0.323611545 1.627665 Q99879 Histone H2B type 1-M HIST1H2BM 0.323611545 1.627665 Q99877 Histone H2B type 1-N HIST1H2BN 0.323611545 1.627665 O60814 Histone H2B type 1-K HIST1H2BK 0.323611545 1.627665 P58876 Histone H2B type 1-D HIST1H2BD 0.323611545 1.627665 Q5XKE5 Keratin, type II cytoskeletal 79 KRT79...”
• Caffeine causes cell cycle arrest at G0/G1 and increases of ubiquitinated proteins, ATP and mitochondrial membrane potential in renal cells.
  Kanlaya, Computational and structural biotechnology journal 2023
  • “...HMG-I/HMG-Y P17096 HMGA1 13.2 10.3 2/2 11.7 5.673.81 35.889.64 6.32 0.0101 Histone H2B type 1-N Q99877 HIST1H2BN 217.4 49.2 2/8 13.9 1155.00100.50 788.9495.01 0.68 0.0176 Histone H3.2 Q71DI3 HIST2H3A 11.0 44.1 1/6 15.4 2.450.83 0.400.20 0.16 0.0295 Importin subunit beta-1 P70168 Kpnb1 213.1 19.4 12/12 97.2...”
• Unraveling molecular characteristic of fluoride neurotoxicity on U87 glial-like cells: insights from transcriptomic and proteomic approach.
  Puty, Frontiers in cellular neuroscience 2023
  • “...type 1-L + 489.46 + 489.46 Q99879 Histone H2B type 1-M + 489.46 + 489.46 Q99877 Histone H2B type 1-N + 489.46 + 489.46 P23527 Histone H2B type 1-O + 489.46 + 489.46 Q16778 Histone H2B type 2-E + 489.46 + 489.46 Q5QNW6 Histone H2B type...”
• 6-Hydroxydopamine Induces Neurodegeneration in Terminally Differentiated SH-SY5Y Neuroblastoma Cells via Enrichment of the Nucleosomal Degradation Pathway: a Global Proteomics Approach
  Magalingam, Journal of molecular neuroscience : MN 2022
  • “...type 2-F HIST2H2BF 27,840 1.19E-02 0.094 Q93079 Histone H2B type 1-H HIST1H2BH 27,784 1.19E-02 0.094 Q99877 Histone H2B type 1-N HIST1H2BN 27,844 1.19E-02 0.094 Q99879 Histone H2B type 1-M HIST1H2BM 27,978 1.19E-02 0.094 P60709 Actin cytoplasmic 1 ACTB 83,474 4.58E-04 0.092 P63261 Actin cytoplasmic 2 ACTG1...”
• More
• Association analysis and functional annotation of imputed sequence data within genomic regions influencing resistance to gastro-intestinal parasites detected by an LDLA approach in a nucleus flock of Sarda dairy sheep
  Casu, Genetics, selection, evolution : GSE 2022
  • “...on OAR12, IL5RA on OAR19, IL17A , IL17F , TRIM26 , TRIM38 , TNFRSF21 , LOC101118999 , VEGFA , and TNF on OAR20. Conclusions This study performed on a large experimental population provides a list of candidate genes and polymorphisms which could be used in further...”
  • “...on OAR12, IL5RA on OAR19, IL17A , IL17F , TRIM26 , TRIM38 , TNFRSF21 , LOC101118999 , VEGFA , and TNF on OAR20. Discussion The heritability estimate of lnFec in this study was low to moderate and consistent with previous studies in adult ewes, which reported...”

Q32L48 Histone H2B type 1-N from Bos taurus
75% identity, 41% coverage

• Capillary zone electrophoresis-high field asymmetric ion mobility spectrometry-tandem mass spectrometry for top-down characterization of histone proteoforms
  Wang, Proteomics 2024 (secret)
• Snapshot imprinting as a tool for surface mapping and identification of novel biomarkers of senescent cells.
  Piletska, Nanoscale advances 2022
  • “...type 2-C 17.2 14 0.1 0.1 O60814; P06899; P23527; P33778; P58876; P62807; P62808; Q16778; Q2M2T1; Q32L48; Q5QNW6; Q93079; Q99877; Q99879; P57053; Q96A08; Q99880; Q8N257 Histone H2B type 1-B 19 15.2 1.7 1.1 The cell division cycle 7-related protein kinase (CDC7) is a serine/threonine kinase that phosphorylates...”
• Characterization of paucibacillary ileal lesions in sheep with subclinical active infection by Mycobacterium avium subsp. paratuberculosis
  Pisanu, Veterinary research 2018
  • “...of transcription 5A 2.04 1.66 b 2.33 Q3SWY9 RAB28 Ras-related protein Rab-28 1.73 b 2.42 Q32L48 HIST1H2BN Histone H2B type 1-N 1.55 b 2.25 1.01 b A7YWK3 KRT73 Keratin, type II cytoskeletal 73 1.49 b 2.24 1.08 b A2VDL6 ATP1A2 Sodium/potassium-transporting ATPase subunit alpha-2 1.44 b...”
• Proteomic analysis reveals selective impediment of neuronal remodeling upon Borna disease virus infection.
  Suberbielle, Journal of virology 2008 (no snippet)

F6GV41 Histone H2B from Vitis vinifera
76% identity, 35% coverage

• Grape ASR-Silencing Sways Nuclear Proteome, Histone Marks and Interplay of Intrinsically Disordered Proteins
  Atanassov, International journal of molecular sciences 2022
  • “...F6HUL8 (F6HUL8_VITVI) CBI34365.3 VIT_02s0025g00090.t01 RNA-binding protein C25G10.01 1.53 D7T3I0 (D7T3I0_VITVI) CBI25061.3 VIT_00s0179g00340.t01 Histone H2A.1 1.71 F6GV41 (F6GV41_VITVI) CBI16181.3 VIT_06s0004g04230.t01 Histone H2B 1.74 D7U2L4 (D7U2L4_VITVI) CBI36980.3 VIT_07s0005g01810.t01 Agenet domain-containing protein 1.87 D7TCM4 (D7TCM4_VIT CBI27882.3 VIT_11s0016g01890.t01 Single myb histone 1.33 D7TED8 (D7TED8_VITVI) CBI28861.3 VIT_12s0059g01310.t01 SUMO protein 1.43 D7TUZ2...”

LOC102549061 histone H2B type 1-N-like from Rattus norvegicus
75% identity, 41% coverage

• Transcriptome data analyses of prostatic hyperplasia in Esr2 knockout rats
  Khristi, Data in brief 2019
  • “...3.96 0.01 0.190 1.000 475 LOC100912707 3 16413080..16413632 2.25 1.40 2.64 0.05 0.490 1.000 476 LOC102549061 17 43627930..43628310 1.20 2.02 4.07 0.00 0.060 1.000 477 LOC102549115 1 88451958..88453578 0.65 8.61 389.63 0.00 0.050 1.000 478 LOC102550734 8 complement(104155401..104155775) 0.42 2.34 5.07 0.02 0.250 1.000 479 LOC102553099...”

Q5BJA5 Histone H2B 1/2 from Danio rerio
75% identity, 42% coverage

• Chronic wounds alter the proteome profile in skin mucus of farmed gilthead seabream
  Cordero, BMC genomics 2017
  • “...AAT45246 5.3/15.9 151/39 3/3 LLNLLSQAQTASGPMVEQASQDGR (0.0068) EYAETLQAKPEFQAFVK (0.025) VATALGEEASPLVDK (0.016) H3 Histone H2B Danio rerio Q5BJA5 10.4/13.6 28/7 1/1 LLLPGELAK (0.0016) H4 Cu/Zn Superoxide dismutase S. aurata CAI79044 5.4/7.0 66/44 2/2 HVGDLGNVTAGADNVAK (4) MLTLSGPLSIIGR (0.14) H5 Histone H2A D. rerio 10.6/13.5 49/7 1/1 AGLQFPVGR (0.00014) H6...”
• Phosphoproteomics-mediated identification of Fer kinase as a target of mutant Shp2 in Noonan and LEOPARD syndrome
  Paardekooper, PloS one 2014
  • “...Y241 2,95 1,77 a Mpzl1 E7F7T2 MEPVV(pY)ADIR Y258 Y263 2,24 1,63 b Histone 2B 1/2 Q5BJA5 ESYAIYV(pY)K Y43 Y43 1,50 0,47 c Irs1b * XP_001920152.3 * TGSD(pY)MNMSPISAR Y689 Y989 1,39 1,59 d zgc:171775 F1QHF2 HTETEM(pT)GYVVTR T181 T183 1,18 0,02 e zgc:171775 F1QHF2 HTETEMTG(pY)VVTR Y183 Y185 1,16...”
  • “...Y668 Y666 0,13 1,15 j Fynrk E7F1M5 LDNGGY(pY)LSTAR Y181 Y214 0,12 0,64 Histone 2B 1/2 Q5BJA5 ESYAI(pY)VYK Y39, Y41 Y41 0,04 0,21 Pard3 A2BEM7 TLSP(pS)PDDHER S705 S695 0,04 0,34 Mapk14a Q9DGE2 HTDDEMTG(pY)VATR Y183 Y182 0,00 0,06 Flo11 * XP_005172506.1 * TEEDHV(pY)SFPNK Y139 Y118 0,00 0,37 Hmga1...”

H2B5_CHICK / P0C1H4 Histone H2B 5; H2B V from Gallus gallus (Chicken) (see paper)
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Plasma Proteome Alterations of Laying Hens Subjected to Heat Stress and Fed a Diet Supplemented with Pequi Oil (<i>Caryocar brasiliense Camb.</i>): New Insights in the Identification of Heat Stress Biomarkers
  da, Biomolecules 2024
  • “...81.44 P0C1H3 Histone H2B 1/2/3/4/6 H2B-I , H2B-II , H2B-III , H2B-IV , H2B-VI 345.93 P0C1H4 Histone H2B 5 H2B-V 345.93 P0C1H5 Histone H2B 7 H2B-VII 86.92 Q9PSW9 Histone H2B 8 H2B-VIII 345.93 A0A8V0YNS6 Histone H2B HIST1H2B5 345.93 A0A8V0XA69 Immunoglobulin V-set domain-containing protein - 523.52 A0A8V0Z0S7...”

H2B1M_HUMAN / Q99879 Histone H2B type 1-M; Histone H2B.e; H2B/e from Homo sapiens (Human) (see 6 papers)
NP_003512 histone H2B type 1-M from Homo sapiens
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...H2B1K O60814 H2BC12 6p22.2 Replication dependent Yes H2B1L Q99880 H2BC13 6p22.1 Replication dependent No H2B1M Q99879 H2BC14 6p22.1 Replication dependent No H2B1N Q99877 H2BC15 6p22.1 Replication dependent No H2B1O P23527 H2BC17 6p22.1 Replication dependent No H2B2F Q5QNW6 H2BC18 1q21.2 Replication dependent Yes H2B2E Q16778 H2BC21 1q21.2...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* O60814 Histone H2B type 1-K 16807.41 * Q99880 Histone H2B type 1-L 16807.41 * Q99879 Histone H2B type 1-M 16807.41 * Q99877 Histone H2B type 1-N 16807.41 * P23527 Histone H2B type 1-O 17593.68 * Q16778 Histone H2B type 2-E 17593.68 * A0A2R8Y619 Histone H2B...”
• Unraveling molecular characteristic of fluoride neurotoxicity on U87 glial-like cells: insights from transcriptomic and proteomic approach.
  Puty, Frontiers in cellular neuroscience 2023
  • “...type 1-K + 489.46 + 489.46 Q99880 Histone H2B type 1-L + 489.46 + 489.46 Q99879 Histone H2B type 1-M + 489.46 + 489.46 Q99877 Histone H2B type 1-N + 489.46 + 489.46 P23527 Histone H2B type 1-O + 489.46 + 489.46 Q16778 Histone H2B type...”
• The SARS-CoV-2 spike S1 protein induces global proteomic changes in ATII-like rat L2 cells that are attenuated by hyaluronan.
  Mobley, American journal of physiology. Lung cellular and molecular physiology 2023
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...Histone H2B type 2-E HIST2H2BE 1.483903394 0.56939717 Q8N257 Histone H2B type 3-B HIST3H2BB 1.483903394 0.56939717 Q99879 Histone H2B type 1-M HIST1H2BM 1.483903394 0.56939717 Q99877 Histone H2B type 1-N HIST1H2BN 1.483903394 0.56939717 O60814 Histone H2B type 1-K HIST1H2BK 1.483903394 0.56939717 P58876 Histone H2B type 1-D HIST1H2BD 1.483903394...”
  • “...Histone H2B type 2-E HIST2H2BE 0.323611545 1.627665 Q8N257 Histone H2B type 3-B HIST3H2BB 0.323611545 1.627665 Q99879 Histone H2B type 1-M HIST1H2BM 0.323611545 1.627665 Q99877 Histone H2B type 1-N HIST1H2BN 0.323611545 1.627665 O60814 Histone H2B type 1-K HIST1H2BK 0.323611545 1.627665 P58876 Histone H2B type 1-D HIST1H2BD 0.323611545...”
• Towards the Definition of the Molecular Hallmarks of Idiopathic Membranous Nephropathy in Serum Proteome: A DIA-PASEF Approach.
  Previtali, International journal of molecular sciences 2023
  • “...H2BFS_HUMAN; H2B1D_HUMAN; H2B1C_HUMAN; H2B2F_HUMAN; H2B1H_HUMAN; H2B1N_HUMAN; H2B1M_HUMAN; H2B1L_HUMAN O60814; P57053; P58876; P62807; Q5QNW6; Q93079; Q99877; Q99879; Q99880 H2BC12; H2BC12L; H2BC5; H2BC4; H2BC18; H2BC9; H2BC15; H2BC14; H2BC13 Histone H2B type 1-K; Histone H2B type F-S; Histone H2B type 1-D; Histone H2B type 1-C/E/F/G/I; Histone H2B type 2-F;...”
• 6-Hydroxydopamine Induces Neurodegeneration in Terminally Differentiated SH-SY5Y Neuroblastoma Cells via Enrichment of the Nucleosomal Degradation Pathway: a Global Proteomics Approach
  Magalingam, Journal of molecular neuroscience : MN 2022
  • “...type 1-H HIST1H2BH 27,784 1.19E-02 0.094 Q99877 Histone H2B type 1-N HIST1H2BN 27,844 1.19E-02 0.094 Q99879 Histone H2B type 1-M HIST1H2BM 27,978 1.19E-02 0.094 P60709 Actin cytoplasmic 1 ACTB 83,474 4.58E-04 0.092 P63261 Actin cytoplasmic 2 ACTG1 83,586 1.59E-03 0.092 Q71U36 Tubulin alpha-1A chain TUBA1A 100,272...”
• Ellagic Acid Triggers the Necrosis of Differentiated Human Enterocytes Exposed to 3-Nitro-Tyrosine: An MS-Based Proteomic Study
  Díaz-Velasco, Antioxidants (Basel, Switzerland) 2022
  • “...related to nucleosome Q99880 Histone H2B type 1-M H2BC14 0.048 0.73 Histone related to nucleosome Q99879 Histone H2B type 1-N H2BC15 0.048 0.73 Histone related to nucleosome Q99877 Histone H2B type 2-F H2BC18 0.048 0.73 Histone related to nucleosome Q5QNW6 Histone H2B type 1-D H2BC5 0.048...”
• More
• Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
  Martins-de-Souza, Journal of proteome research 2012 (PubMed)
  • GeneRIF: A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.

U3KQK0 Histone H2B from Homo sapiens
75% identity, 31% coverage

• Radiotherapy resistance driven by Asparagine endopeptidase through ATR pathway modulation in breast cancer
  Morillo-Huesca, Journal of experimental & clinical cancer research : CR 2025 (no snippet)
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...Q71UI9 Histone H2A.V 8676.91 * P0C0S5 Histone H2A.Z 8676.91 * P16104 Histone H2AX 3273.08 * U3KQK0 Histone H2B 16807.41 * Q96A08 Histone H2B type 1-A 7130.46 * P33778 Histone H2B type 1-B 17593.68 * P62807 Histone H2B type 1-C/E/F/G/I 16807.41 * P58876 Histone H2B type 1-D...”
• Proteomic Analysis on Sequential Samples of Cystic Fluid Obtained from Human Brain Tumors
  Magrassi, Cancers 2023
  • “...dehydrogenase 36 8.46 CG Q96D09 GPRASP2 G-protein coupled receptor-associated sorting protein 2 93.7 5.01 CG U3KQK0 H2BC15 Histone H2B 18.8 10.54 CG P42695 NCAPD3 Condensin-2 complex subunit D3 168.8 7.5 CG Q86XR2 NIBAN3 Protein Niban 3 77.4 8.63 CG P32119 PRDX2 Peroxiredoxin-2 21.9 5.97 CG P29622...”
• Human Neutrophils Produce Antifungal Extracellular Vesicles against Aspergillus fumigatus
  Shopova, mBio 2020
  • “...no. Protein TMT ratio pksP EVs/afEVs afEVs/sEVs pksP EVs/sEVs A0A0U1RRH7 Histone H2A 1.32 14.08 18.55 U3KQK0 Histone H2B 1.12 6.27 7.04 P68431 Histone H3.1 0.82 16.84 13.79 P08246 Neutrophil elastase 0.62 4.64 2.86 P05164 Myeloperoxidase 1.19 2.16 2.57 P08311 Cathepsin G 0.73 3.07 2.24 P20160 Azurocidin...”
• Secret3D Workflow for Secretome Analysis.
  Matafora, STAR protocols 2020
  • “...sulfate proteoglycan 4 CSPG4 3.10E+00 67 4.17E+10 7.17E+10 P02787 serotransferrin TF 1.40E+01 22 7.38E+09 7.16E+10 U3KQK0 histone H2B HIST1H2BN 3.40E+01 17 3.16E+09 7.08E+10 A0A087WTA8 collagen -2(I) chain COL1A2 2.70E+01 9 7.01E+09 6.57E+10 P05067-11 amyloid A4 protein APP 1.60E+00 11 5.80E+10 6.44E+10 P11021 78kDa glucose-regulated protein HSPA5...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...gene: Hist1h2bn Hist1h2bn Q99877 [ 41 ] Canonical H2B gene: Hist1h2bn (putative spliced isoform) Hist1h2bn U3KQK0 [ 41 ] Canonical H2B gene: Hist1h2bo Hist1h2bo P23527 [ 41 ] Canonical H2B gene: Hist2h2be Hist2h2be Q16778 [ 41 ] Canonical H2B gene: Hist2h2bf (putative spliced isoform) Hist2h2bf Q5QNW6...”
• Multiplexed, Quantitative Workflow for Sensitive Biomarker Discovery in Plasma Yields Novel Candidates for Early Myocardial Injury.
  Keshishian, Molecular & cellular proteomics : MCP 2015

XP_691943 histone H2B 1/2-like from Danio rerio
75% identity, 42% coverage

• Exploration of anti-inflammatory mechanism of forsythiaside A and forsythiaside B in CuSO₄-induced inflammation in zebrafish by metabolomic and proteomic analyses
  Gong, Journal of neuroinflammation 2020
  • “...nucleotide exchange factor 1 isoform X1 ## ** 50 XP_685270 sgca Alpha-sarcoglycan # ** 51 XP_691943 si:dkey-23a13.8 Histone H2B 1/2-like ## ** 52 NP_001019612 psma2 Proteasome alpha 2 subunit # * 53 NP_001071216 scg2b Secretogranin-2 precursor ## ** 54 NP_001313480 si:dkey-251i10.2 si:dkey-251i10.2 precursor # * 55...”

LOC100928127 histone H2B type 1-B from Sarcophilus harrisii
75% identity, 41% coverage

• Heat shock proteins expressed in the marsupial Tasmanian devil are potential antigenic candidates in a vaccine against devil facial tumour disease
  Tovar, PloS one 2018
  • “...1,2 5 16.5 51 G3WXL4 HNRNPK Heterogeneous nuclear ribonucleoprotein K 14,15,16,17 3 27.8 13 G3VNV7 LOC100928127 Histone H2B 18 11 32.9 53 G3VGI4 PLIN3 Perilipin-3 17 3 21.4 22 G3VCM9 PRDX5 Peroxiredoxin-5, mitochondrial 7 5 34.9 28 G3WDY3 PCNA Proliferating cell nuclear antigen 3 8 17.3...”

LOC100498553 histone H2B 1.1 from Xenopus tropicalis
75% identity, 41% coverage

• The DNA-to-cytoplasm ratio broadly activates zygotic gene expression in Xenopus
  Jukam, Current biology : CB 2021
  • “...the X. tropicalis genes mRNA length ( LOC100485134, LOC100486150, LOC100486870, LOC100490072, LOC100495041, LOC100496181, LOC100497915, LOC100498329, LOC100498553, LOC101732029, LOC108648872, actb, bin1, cbx1, cenpo, h2bc12, hes5.8, sox17a, sox18, sox18_1, sox18_2, tspan36 ). The remaining 595 genes were used as the ZGA gene set in all subsequent analyses unless...”

I6L9F7 Histone H2B (Fragment) from Homo sapiens
75% identity, 38% coverage

• Identification of lysine acetylome in cervical cancer by label-free quantitative proteomics
  Zhang, Cancer cell international 2020
  • “...11 (KIF11), mRNA B2RAM6 MASQPNSSAKKKEEK(ac)GK Actin, alpha 2, smooth muscle, aorta D2JYH4 EITALAPSTMK(ac)IK Histone H2B I6L9F7 PEPVK(ac)SAPVPK Alternative protein GATAD2A L8ECH2 MMELK(ac)VNR Fibrinogen alpha chain P02671 SRIEVLK(ac)R Fructose-bisphosphate aldolase V9HWN7 ALSDHHIYLEGTLLK(ac)PNMVTPGHACTQK Galectin-10 Q05315 DISLTK(ac)FNVSYLK Uncharacterized protein DKFZp686H1812 Q5HYE3 VLEQGLEK(ac)CTQATR cDNA FLJ26541 fis, clone KDN09394 Q6ZP39 MQIK(ac)TTLRYHLTPVK(ac)MALIQK...”

XP_018096300 histone H2B 1.1-like from Xenopus laevis
75% identity, 41% coverage

• Effects of histone H2B ubiquitylation on the nucleosome structure and dynamics.
  Krajewski, Nucleic acids research 2018
  • GeneRIF: Data show that ubiquitylation of histone H2B K34, and to a lesser extent H2B K120, significantly enhances nucleosome dynamics.

Q943L2 Histone H2B.11 from Oryza sativa subsp. japonica
76% identity, 37% coverage

• Proteome-Wide Analyses Reveal the Diverse Functions of Lysine 2-Hydroxyisobutyrylation in Oryza sativa
  Xue, Rice (New York, N.Y.) 2020
  • “...Q9LGH8 145 HAVSEGTK(1)AVTK H2B.8 0.72084 Q9LGH8 72 IYIFK(1)VLK H2B.8 0.89643 Q9LGH8 23 KPAEEEPAAEK(1)AEK H2B.8 0.20801 Q943L2 18 KPVEEK(1)AEK H2B.11 0.032173 Q9LGH4 108 LAAEAAK(1)LAR H2B.6 1.7336 Q6F362 23 KPAEEEPAAEK(1)APAAGK H2B.9 0.78845 Q7XUC9 92 TVTAMDVVYALK(1)R H4 0.57386 The number in parenthesis indicates the localization probability of Khib modification...”

H2B8_CHICK / Q9PSW9 Histone H2B 8; H2B VIII from Gallus gallus (Chicken) (see paper)
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Plasma Proteome Alterations of Laying Hens Subjected to Heat Stress and Fed a Diet Supplemented with Pequi Oil (<i>Caryocar brasiliense Camb.</i>): New Insights in the Identification of Heat Stress Biomarkers
  da, Biomolecules 2024
  • “..., H2B-VI 345.93 P0C1H4 Histone H2B 5 H2B-V 345.93 P0C1H5 Histone H2B 7 H2B-VII 86.92 Q9PSW9 Histone H2B 8 H2B-VIII 345.93 A0A8V0YNS6 Histone H2B HIST1H2B5 345.93 A0A8V0XA69 Immunoglobulin V-set domain-containing protein - 523.52 A0A8V0Z0S7 phosphopyruvate hydratase ENO 81.44 A2N890 VH1 protein (Fragment) VH1 523.52 A0A8V0ZG90 Vitellogenin...”
• Comparative proteomics revealed duodenal metabolic function associated with feed efficiency in slow-growing chicken
  Kaewsatuan, Poultry science 2022
  • “...ISG12(2) protein ISG12(2) IF16 0.017 1.48 F1NK29 Na(+)/H(+) exchange regulatory cofactor NHE-RF1 SLC9A3R1 0.048 1.00 Q9PSW9 Histone H2B-I H2B-I 0.012 0.53 P80566 Superoxide dismutase [Cu-Zn] SOD1 0.032 0.45 Q0GFE9 Thymosin beta TMSB15B 0.015 0.64 P84175 40S ribosomal protein S12 RPS21 0.004 0.50 F1NYA2 RRM domain-containing protein...”
• Quantitative Proteomic Analysis Reveals Yeast Cell Wall Products Influence the Serum Proteome Composition of Broiler Chickens
  Conlon, International journal of molecular sciences 2022
  • “...protein 0.59 21 23.5 Day 7 A0A1D5PSJ4 Histone H2B 8 0.58 11 19 Day 7 Q9PSW9 Uncharacterized protein 0.53 3 36.4 Day 21 F1NC22 Chemerin 0.52 7 43.3 Day 35 A0A0K0PUH6 Uncharacterized protein 0.52 2 38.5 Day 21 F1NSC8 Matrilin-3 0.5 53 27.9 Day 7 O42401...”
• Histones from Avian Erythrocytes Exhibit Antibiofilm activity against methicillin-sensitive and methicillin-resistant Staphylococcus aureus.
  Rose-Martel, Scientific reports 2017
  • “...62 Band 5 Histone H2B 1/2/3/4/6Histone H2B 8Histone H2B 7 27 P0C1H3 191 75 26 Q9PSW9 75 25 P0C1H5 69 Band 6 Histone H2A (III, IV) 18 P35062, P02263 151 72 Histone H2A.V 6 P02272 54 Histone H2A (fragment) 3 F1P5G5 16 Band 7 Histone H4...”

Q5RCP8 Histone H2B type 2-E from Pongo abelii
75% identity, 41% coverage

• Characterizations of annexin A1-interacting proteins in apical membrane and cytosolic compartments of renal tubular epithelial cells.
  Peerapen, Computational and structural biotechnology journal 2023
  • “...85.12 4.93 Histone H1.3 P16402 H13 135 18.6 4/22 22.34 11.02 *Histone H2B type 2-E Q5RCP8 H2BC21 53 33.3 5/29 13.92 10.17 L -lactate dehydrogenase A chain P06151 LDHA 218 12.0 4/28 36.82 7.62 NAD(P)H dehydrogenase [quinone] 1 P05982 NQO1 132 3.6 1/5 30.98 8.42 Parathymosin...”

H2B7_ARATH / Q9LZT0 Histone H2B.7; HTB11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT3G46030 HTB11; DNA binding from Arabidopsis thaliana
Q1H5F9 Histone H2B from Arabidopsis thaliana
76% identity, 35% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Advances in biological functions and mechanisms of histone variants in plants
  Wu, Frontiers in genetics 2023
  • “...AT1G08170 Regulate seed development but not expressed in sperm cells H2B.9 AT3G45980 H2B.10 AT5G02570 H2B.11 AT3G46030 H3 H3.3 AT4G40030 HIRA Transcriptional activation Flowering time Zhao et al. (2021) ; Male Gametogenesis Ingouff et al. (2010) ; Cell proliferation and organogenesis Otero et al. (2016) AT4G40040 ATRX...”
• Histone variants and modifications during abiotic stress response
  Nunez-Vazquez, Frontiers in plant science 2022
  • “...H2B.10 Variant At5g02570, HTB10 Development of reproductive tissues ( Jiang etal., 2020a ) H2B.11 Variant At3g46030, HTB11 H3 H3.1 Canonical At5g65360, HTR1 CAF1 Transcriptional repression ( Stroud etal., 2012 ; Wollmann etal., 2012 ) At1g09200, HTR2 At3g27360, HTR3 At5g10400, HTR9 At5g10390, HTR13 H3.3 Variant At4g40030, HTR4...”
• New Insights into the Chloroplast Outer Membrane Proteome and Associated Targeting Pathways
  Fish, International journal of molecular sciences 2022
  • “...At3g16950 PDC E3 At3g19720 * ARC5 At3g25690 CHUP1 At3g25860 PDC E2 At3g26070 PAP/FBN3a At3g26740 CCL At3g46030 Histone H2B At3g46780 pTAC16 At3g49350 - At3g53560 TPR Protein At3g63520 * Carotenoid Cleaving Protein At4g00550 DGD2 At4g02482 Putative GTPase At4g02510 TOC159 At4g05050 UBQ11 At4g13550 * Putative Triglyceride Lipase At4g14430 Enoyl-CoA...”
• Comparative Analysis of Proteins Regulated during Cadmium Sulfide Quantum Dots Response in Arabidopsis thaliana Wild Type and Tolerant Mutants
  Gallo, Nanomaterials (Basel, Switzerland) 2021
  • “...treated wt and treated atnp 01: heat shock 70 kDa protein 3 (Hsp70-3), histone H2B.7 (At3g46030), L-ascorbate peroxidase 1 (Apx1), and filament-like plant protein 6 (Fpp6). Hsp70-3, in collaboration with other chaperone proteins, assists translocation of precursor proteins into organelles, facilitates folding of de novo synthesized...”
  • “...the degradation of damaged proteins undergoing stress conditions such as from Cd [ 46 ]; At3g46030 is a core component of the nucleosome [ 39 ]; Apx1 is a key component of the reactive oxygen species gene network, moreover, its synthesis can be induced by Cd...”
• Plant Histone HTB (H2B) Variants in Regulating Chromatin Structure and Function
  Khadka, Plants (Basel, Switzerland) 2020
  • “...classes. Class I contains HTB1(At1g07790), HTB2 (At5g22880), HTB3 (At2g28720), HTB4 (At5g59910), HTB9 (At3g45980), and HTB11 (At3g46030) and class II HTB5 (At2g37470), HTB6 (At3g53650), HTB7 (At3g09480), and HTB10 (At5g02570). Class I variants can be further divided into class I-A (H2B4, 9, and 11) and class I-B (HTB1,...”
• The evolution and functional divergence of the histone H2B family in plants
  Jiang, PLoS genetics 2020
  • “...S 314 HTB5 AT2G37470 S 83 HTB6 AT3G53650 S 223 HTB9 AT3G45980 S 110 HTB11 AT3G46030 S 75 Data from Cyclebase 3.0 (REF) To test the link between H2B.3 and the cell cycle further, we analysed the expression of the somatic H2Bs in a mutant background...”
• Emerging knowledge of the organelle outer membranes - research snapshots and an updated list of the chloroplast outer envelope proteins
  Inoue, Frontiers in plant science 2015
  • “...(x)(xi) At3g01280 VDAC1 (mito) (i) YES (x) At3g12580 Hsc70-4 (cytosol) (iv) At3g21865 PEX22 (peroxisome) (iv) At3g46030 histone H2B (nucleus) (iii) At3g63150 MIRO2 (mito) (iv) (x)(xi) At4g14430 enoyl-CoA isomerase (peroxisome) (iii) At4g16450 Complex I subunit (mito) (iii) At4g31780 MGD1 (IEM) (iii) YES At4g35000 APX3 (peroxisome) (iii)(iv) YES...”
• Defining the core proteome of the chloroplast envelope membranes
  Simm, Frontiers in plant science 2013
  • “...Organelles At1g27390 Tom20-2 Putative mitochondrial outer membrane translocase component 1 -Helical TM n.d./X 3 I At3g46030 HTB11 Putative H2B-type histone None X/n.d. 1 III At4g14430 ECHIb Putative enoyl-CoA hydratase/isomerase 1 -Helical TM X 1 III At4g35000 APX3 Putative peroxisomal ascorbate peroxidase 1 -Helical TM X 5...”
• More
• An iTRAQ-based proteomics approach to clarify the molecular physiology of somatic embryo development in Prince Rupprecht's larch (Larix principis-rupprechtii Mayr)
  Zhao, PloS one 2015
  • “...(Fragment) K7NMH3 1 0.359 7.194 2 Histone H4 A9NLQ1 1 1.110 2.457 4 Histone H2B Q1H5F9 1 0.541 11.364 2 Histone H4 Q6NR90 1 1 1.862 4 Histone H3 Q0WRA9 1 1.043 1.504 4 Histone H2A.6 Q9LD28 1 0.798 1 2 Other proteins d Ubiquitin-like protein...”

H2B1B_HUMAN / P33778 Histone H2B type 1-B; H2B-clustered histone 3; Histone H2B.1; Histone H2B.f; H2B/f from Homo sapiens (Human) (see 6 papers)
G1SSZ8 Histone H2B from Oryctolagus cuniculus
NP_066406 histone H2B type 1-B from Homo sapiens
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...H2BFM P0C1H6 H2BW2 Xq22.2 Replication independent Yes TSH2B Q96A08 H2BC1 6p22.2 Replication dependent No H2B1B P33778 H2BC3 6p22.2 Replication dependent No H2B1D P58876 H2BC5 6p22.2 Replication dependent No H2B1H Q93079 H2BC9 6p22.2 Replication dependent No H2B1J P06899 H2BC11 6p22.2 Replication dependent H2B1K O60814 H2BC12 6p22.2 Replication...”
• Proteomic profile of extracellular vesicles from plasma and CSF of multiple sclerosis patients reveals disease activity-associated EAAT2
  D'Ambrosio, Journal of neuroinflammation 2024
  • “...protein G(o) subunit 33 P19367 HK1 Hexokinase-1 34 P04908 H2AC4 Histone H2A type 1-B/E 35 P33778 H2BC3 Histone H2B type 1-B 36 P01762 IGHV3-11 Immunoglobulin heavy variable 311 37 P01614 IGKV2D-40 Immunoglobulin kappa variable 2D-40 38 Q14643 ITPR1 Inositol 1,4,5-trisphosphate receptor type 1 39 P29622 SERPINA4,...”
• A proteomic atlas of glypican-3 interacting partners: Identification of alpha-fetoprotein and other extracellular proteins as potential immunotherapy targets in liver cancer.
  Zhang, Proteoglycan research 2024
  • “...Nuclear factor 1 A-type 7 0 1 16.1 Q16695 H34 Histone H3.1t 7 7 0 P33778 H2BC3 Histone H2B type 1-B 6 0 Q9Y230 RUVBL2 RuvB-like 2 6 0 0 352.6 U P16403 H12 Histone H1.2 6 6 0 B4DY08 HNRNPC Heterogeneous nuclear ribonucleoproteins C1/C2 20...”
• The Modulation of Septic Shock: A Proteomic Approach.
  Alves, International journal of molecular sciences 2024
  • “...3.436 + DLC1 Q96QB1 Rho GTPase-activating protein 7 10.11 3.05 10 6 3.452 + HIST1H2BB P33778 Histone H2B type 1-B 75.93 6.93 10 6 3.540 + MLH3 Q9UHC1 DNA mismatch repair protein Mlh3 36.53 4.81 10 7 3.599 + ZNF133 P52736 Zinc finger protein 133 7.84...”
• Inhibition of complement C3 prevents osteoarthritis progression in guinea pigs by blocking STAT1 activation.
  Xu, Communications biology 2024
  • “...stimulation a Name UniProt IL-1 control Histone H4 P62805 3 4 Histone H2B type 1-B P33778 3 1 Interferon-induced GTP-binding protein Mx2 P20592 3 0 Interferon-induced GTP-binding protein Mx1 P20591 3 0 Signal transducer and activator of transcription 1-alpha/beta (STAT1) P42224 2 0 Histone H1.1 Q02539...”
  • “...H4 P62805 3 4 Eukaryotic initiation factor 4A-II Q14240 1 0 Histone H2B type 1-B P33778 3 2 a Unique peptides present. To verify our findings, we used fludarabine, which has shown to be a specific STAT1 inhibitor in previous studies 30 , 31 . It...”
• Structural mechanisms of SLF1 interactions with Histone H4 and RAD18 at the stalled replication fork.
  Ryder, Nucleic acids research 2024
  • “...nucleosome was generated using the sequences of histone H2A2A (UniProt ID: Q6FI13), H2B1B (UniProt ID: P33778), H3.3C (UniProt ID: Q6NXT2), H4 (UniProt ID: P62805), SLF1 (UniProt ID: Q9BQI6),and the 147 bp 601 Widom DNA sequence ( 50 ). Electrostatic potential and all structure figures were generated...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...H2AX 3273.08 * U3KQK0 Histone H2B 16807.41 * Q96A08 Histone H2B type 1-A 7130.46 * P33778 Histone H2B type 1-B 17593.68 * P62807 Histone H2B type 1-C/E/F/G/I 16807.41 * P58876 Histone H2B type 1-D 16807.41 * Q93079 Histone H2B type 1-H 16807.41 * P06899 Histone H2B...”
• BRCA1-BARD1 combines multiple chromatin recognition modules to bridge nascent nucleosomes
  Burdett, Nucleic acids research 2023
  • “...). Briefly, the protein sequences of cat BARD1 ARD-BRCTs (UniProt: C9IYG1), human histones (UniProt: P0C0S8, P33778, P68431 and P62805 for H2A.1, H2B, H3.1 and H4 respectively) and ubiquitin (UniProt: P0CG48; aa 176) were used as inputs together with the final refined map (3.40 ). To build...”
• More
• A fine-tuned β-catenin regulation during proliferation of corneal endothelial cells revealed using proteomics analysis.
  Maurizi, Scientific reports 2020
  • “...regulation Homeodomain-interacting protein kinase 1 HIPK1 G1SKE7 <0.005 Histone component Histone H2B type 1-B HIST1H2BB G1SSZ8 <0.005 Chaperone Heat shock-related 70kDa protein 2 HSPA2 G1T1V9 <0.005 Inflammation T-cell immunomodulatory protein ITFG1 G1TA79 <0.005 Cell-ECM interaction Integrin beta-5 ITGB5 G1T7R4 <0.005 RNA processing (neuronal) KH domain, RNA-binding,...”
• HIST1H2BB and MAGI2 Methylation and Somatic Mutations as Precision Medicine Biomarkers for Diagnosis and Prognosis of High-grade Serous Ovarian Cancer.
  Valle, Cancer prevention research (Philadelphia, Pa.) 2020
  • GeneRIF: HIST1H2BB and MAGI2 Methylation and Somatic Mutations as Precision Medicine Biomarkers for Diagnosis and Prognosis of High-grade Serous Ovarian Cancer.
• Functional crosstalk between histone H2B ubiquitylation and H2A modifications and variants.
  Wojcik, Nature communications 2018
  • GeneRIF: Functional crosstalk between histone H2B ubiquitylation and H2A modifications and variants has been uncovered.
• RNF20 Links Histone H2B Ubiquitylation with Inflammation and Inflammation-Associated Cancer.
  Tarcic, Cell reports 2016
  • GeneRIF: RNF20 and H2Bub1 promotes chronic colonic inflammation and inflammation-associated colorectal cancer in mice and humans, partly by augmenting NF-kappaB activity and attenuating the antitumoral T cell response.
• Monoubiquitination of Histone H2B Blocks Eviction of Histone Variant H2A.Z from Inducible Enhancers.
  Segala, Molecular cell 2016 (PubMed)
  • GeneRIF: Monoubiquitination of histone H2B blocks eviction of histone variant H2A.Z from inducible enhancers.
• Regulation of homologous recombination by RNF20-dependent H2B ubiquitination.
  Nakamura, Molecular cell 2011 (PubMed)
  • GeneRIF: RNF20-mediated H2B ubiquitination at DSBs plays a critical role in HRR through chromatin remodeling

Q92130 Histone H2B from Xenopus laevis
75% identity, 41% coverage

• Structure of a single-chain H2A/H2B dimer
  Warren, Acta crystallographica. Section F, Structural biology communications 2020
  • “...consisting of H2B residues 36126 followed by H2A residues 1498 (numbering according to UniProt entries Q92130 and P06897; the N-terminal cloning artifact glycine and H2B residues 34 and 35 along with H2A C-terminal residues 99105 were not observed, presumably owing to disorder), 43 waters of solvation...”

Q4PM63 Histone H2B from Ixodes scapularis
73% identity, 42% coverage

• Tissue-specific signatures in tick cell line MS profiles
  Loginov, Parasites & vectors 2019
  • “...MT 13775 A0A0K8RB64 Putative histone h2b I. ricinus 13810 IRE11; IRE/CTVM19; IRE/CTVM20 SG, Ov, MT Q4PM63 Histone 2B I. scapularis ISE6; ISE18 15364 A0A0K8R3K9 Putative histones h3 and h4 I. ricinus 15318 IRE/CTVM19 a Accession number refers to the sequence retrieved from the UniProt protein database...”

H2B1A_RAT / Q00729 Histone H2B type 1-A; Histone H2B, testis; Testis-specific histone H2B from Rattus norvegicus (Rat) (see 3 papers)
75% identity, 41% coverage

• function: Variant histone specifically required to direct the transformation of dissociating nucleosomes to protamine in male germ cells. Entirely replaces classical histone H2B prior nucleosome to protamine transition and probably acts as a nucleosome dissociating factor that creates a more dynamic chromatin, facilitating the large- scale exchange of histones. Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers.
• Neuronal Hemoglobin Expression and Its Relevance to Multiple Sclerosis Neuropathology
  Brown, Journal of molecular neuroscience : MN 2016
  • “...11027 778.9102 1555.8058 1555.8029 100.14 3.50E10 VPTPNVSVVDLTCR 12207 910.4582 1818.9018 1818.8968 59.72 5.70E06 IVSNASCTTNCLAPLAK 10 Q00729 Mass, 14216 Score, 482 Matches, 39(39) Sequences, 5(5) emPAI, 5.92 Histone H2B type 1-A Rattus norvegicus GN=Hist1h2ba Query Observed Mr(expt) Mr(calc) Score Expect Peptide 4797 664.3625 663.3552 663.3551 18.43 0.045...”
• Myelin-mediated inhibition of oligodendrocyte precursor differentiation can be overcome by pharmacological modulation of Fyn-RhoA and protein kinase C signalling.
  Baer, Brain : a journal of neurology 2009
  • “...H2B type 1 Q00715 gi|399856 13990 0 123 3 21 8 Histone H2B type 1-A Q00729 gi|399855 14225 0 109 2 26 9 Histone H3.1 Q6LED0 gi|81863898 15404 0 49 1 8 13 Histone H4 P62804 gi|51317315 11367 0 102 3 34 10 La-related protein 7...”
• High-throughput identification of IMCD proteins using LC-MS/MS.
  Pisitkun, Physiological genomics 2006

Q5DDU9 Histone H2B from Schistosoma japonicum
Smp_108390 histone H2B, putative from Schistosoma mansoni
75% identity, 43% coverage

• Comparative proteomics analysis of Schistosoma japonicum developed in different Oncomelania snails as intermediate hosts
  Liu, Frontiers in cellular and infection microbiology 2022
  • “...female S.japonicum . Protein (FM) Description OS=Schistosoma japonicum T_FM-vs-CK_FM (Ratio) Regulated-Stage Chromatin structure and dynamics Q5DDU9 Histone H2B 1.2806 Up C1LVH1 Histone H3 0.7715 Down Q5DET3 Histone H4 0.7581 Down Energy production and conversion C1L5E9 Acyl carrier protein 0.5345 Down Amino acid transport and metabolism Q86EI1...”
• A comparative proteomics analysis of the egg secretions of three major schistosome species
  Carson, Molecular and biochemical parasitology 2020
  • “...Histone H3 12 64.5 A C1LFC4 Aminopeptidase 10 18.2 A C1L9B2 Calreticulin 8 19.8 Y Q5DDU9 Histone H2B 7 38.0 N C1LEJ4 Histone H2A 7 46.4 A Q86EU4 Cytochrome c proximal 7 50.8 A C1LQJ9 Uncharacterized protein 6 23.3 A C1LQT3 Thioredoxin 6 53.5 A Q5D8W0...”
  • “...G4VJT9 Fructose-bisphosphate aldolase Q5DFZ8 Fructose-bisphosphate aldolase A0A095AKM1 Fructose-bisphosphate aldolase 96 97 98 G4V6E9 Histone H2B Q5DDU9 Histone H2B A0A095B4U1 Histone H2B 95 100 95 G4VT44 Putative calmodulin Q5DA21 Calmodulin 3b A0A094ZPX2 Calmodulin 90 97 98 G4M131 Fatty acid binding protein O45035 Fatty acid-binding protein A5A6F5 14...”
• Human growth factor-mediated signalling through lipid rafts regulates stem cell proliferation, development and survival of Schistosoma mansoni
  Maharjan, Open biology 2024
  • “...chain 1 (Smp_045220), thioredoxin (Smp_008070) and synaptotagmin (Smp_175900). Surprisingly, linker histone H1 (Smp_162370), histone H2B (Smp_108390) and histone H3 (Smp_074610) were also present (electronic supplementary material, table S1). 2.4 . Disruption of lipid rafts modulates multiple signalling pathways in S. mansoni somules The cholesterol-rich lipid rafts...”
• Single-cell atlas of the first intra-mammalian developmental stage of the human parasite Schistosoma mansoni
  Diaz, Nature communications 2020
  • “...d Double FISH of cam (Smp_032950) and a previously validated schistosome stem cell marker h2b (Smp_108390), MIP. e WISH of cam (Smp_032950) in adult parasites shows enriched expression in the gonads including testis, ovary, and vitellarium, as well as in the mid-animal body region. f Double...”
  • “...cells) that expressed the canonical cell cycle markers histone h2a (Smp_086860) 16 and histone h2b (Smp_108390) 7 (Fig. 5b and Supplementary Fig. 3d ). In addition, this cluster also had a significant enrichment of translational components (Supplementary Fig. 2 ). We confirmed that histone h2a (Smp_086860)...”
• Stem cell progeny contribute to the schistosome host-parasite interface
  Collins, eLife 2016
  • “...a new supplemental table ( Supplementary file 3 ). In this dataset the h2b mRNA (Smp_108390) is down regulated > 15 fold, verifying that our knockdown was successful. Why is h2b not significantly down regulated in our other datasets? We attribute this observation to basal levels...”
• Functional genomic characterization of neoblast-like stem cells in larval Schistosoma mansoni
  Wang, eLife 2013
  • “...165470) 6.8/7.0 12.1/10.0 1.8/1.4 CHD (Smp_158050) 39.6 68.6 1.7 tudor-like (Smp_081570) 222.8 367.8 1.7 H2B (Smp_108390) 124.6 206.5 1.7 ef-tu (Smp_073500) 151.6 243.6 1.6 HSP60 (Smp_008545) 2051.5 3224.7 1.6 fhl (Smp_048560) 2.0 3.1 1.5 eed (Smp_165220) 32.7 46.3 1.4 junl (Smp_067520) 5.5 7.7 1.4 Expression of...”

H2B1_CHICK / P0C1H3 Histone H2B 1/2/3/4/6; H2B I; H2B II; H2B III; H2B IV; H2B VI from Gallus gallus (Chicken) (see 2 papers)
NP_001073188 histone H2B 7 from Gallus gallus
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
  function: Has broad-spectrum antibacterial activity. May be important in the antimicrobial defenses of chick reproductive system during follicle development in the ovary and egg formation in the oviduct.
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Histone crosstalk directed by H2B ubiquitination is required for chromatin boundary integrity.
  Ma, PLoS genetics 2011
  • GeneRIF: Data show that HS4 insulator element recruits the E3 ligase RNF20/BRE1A to mediate H2B mono-ubiquitination (H2Bub1) at this insulator.
• Plasma Proteome Alterations of Laying Hens Subjected to Heat Stress and Fed a Diet Supplemented with Pequi Oil (<i>Caryocar brasiliense Camb.</i>): New Insights in the Identification of Heat Stress Biomarkers
  da, Biomolecules 2024
  • “...PO ST group. Accession Description Gene Score P51913 Alpha-enolase ENO1 81.44 O57391 Gamma-enolase ENO2 81.44 P0C1H3 Histone H2B 1/2/3/4/6 H2B-I , H2B-II , H2B-III , H2B-IV , H2B-VI 345.93 P0C1H4 Histone H2B 5 H2B-V 345.93 P0C1H5 Histone H2B 7 H2B-VII 86.92 Q9PSW9 Histone H2B 8 H2B-VIII...”
• Histones from Avian Erythrocytes Exhibit Antibiofilm activity against methicillin-sensitive and methicillin-resistant Staphylococcus aureus.
  Rose-Martel, Scientific reports 2017
  • “...H3.2 19 P84229 241 62 Band 5 Histone H2B 1/2/3/4/6Histone H2B 8Histone H2B 7 27 P0C1H3 191 75 26 Q9PSW9 75 25 P0C1H5 69 Band 6 Histone H2A (III, IV) 18 P35062, P02263 151 72 Histone H2A.V 6 P02272 54 Histone H2A (fragment) 3 F1P5G5 16...”

LOC100495041 histone H2B 1.1 from Xenopus tropicalis
75% identity, 41% coverage

• The DNA-to-cytoplasm ratio broadly activates zygotic gene expression in Xenopus
  Jukam, Current biology : CB 2021
  • “...greater than 30% of the X. tropicalis genes mRNA length ( LOC100485134, LOC100486150, LOC100486870, LOC100490072, LOC100495041, LOC100496181, LOC100497915, LOC100498329, LOC100498553, LOC101732029, LOC108648872, actb, bin1, cbx1, cenpo, h2bc12, hes5.8, sox17a, sox18, sox18_1, sox18_2, tspan36 ). The remaining 595 genes were used as the ZGA gene set in...”

NP_072169 histone H2B type 1-A from Rattus norvegicus
75% identity, 41% coverage

• TH2BS11ph histone mark is enriched in the unsynapsed axes of the XY body and predominantly associates with H3K4me3-containing genomic regions in mammalian spermatocytes.
  Mahadevan, Epigenetics & chromatin 2019
  • GeneRIF: TH2BS11ph is predominantly associated with H3K4me3 positive genomic regions like gene promoters, etc. TH2BS11ph modification could act alone or in concert with other histone modifications to recruit the appropriate transcription or XY body recombination protein machinery at specific genomic loci.
• Mapping post-translational modifications of mammalian testicular specific histone variant TH2B in tetraploid and haploid germ cells and their implications on the dynamics of nucleosome structure.
  Pentakota, Journal of proteome research 2014 (PubMed)
  • GeneRIF: Testis specific histone TH2B undergoes multiple post translational amino acid modification, suggesting the possibility of chromatin regulation.
• Mass spectrometry analysis of dynamic post-translational modifications of TH2B during spermatogenesis.
  Lu, Molecular human reproduction 2009 (PubMed)
  • GeneRIF: Acetylated TH2B was most abundant in spermatogonia (28.9%) when compared with the spermatocytes (8.3%) and round spermatids (11.2%). Several new PTMs of TH2B were identified

H2B1K_HUMAN / O60814 Histone H2B type 1-K; H2B K; HIRA-interacting protein 1 from Homo sapiens (Human) (see 6 papers)
J9P6S8 Histone H2B from Canis lupus familiaris
NP_542160 histone H2B type 1-K from Homo sapiens
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  function: Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Exosome proteomes reveal glycolysis-related enzyme enrichment in primary canine mammary gland tumor compared to metastases.
  Kim, Proteome science 2024
  • “...939250 F1Q4C5 1710900 1228900 1389500 1072300 3600200 3132300 F2Z4Q5 1710400 1349000 1614900 2201500 7621400 6461600 J9P6S8 1691400 1351300 1364900 1383700 5360200 4717100 F1PX67 1687300 912710 633070 114950 118500 92605 E2R5S3 1646900 1234700 1215400 468120 553950 462520 F1PP89 1592800 1265500 1342600 1579100 3075000 2951200 F1Q3V2 1592400 1804100...”
• Mass spectrometry-based proteomic analysis reveals the interacting partners of lipin1.
  Wang, IUBMB life 2018 (PubMed)
  • GeneRIF: The physical interaction between lipin1 and eEF1A1 was further affirmed in 293T cells transfected with 6-His tagged lipin1 and hepatocyte SMMC7721 cells by protein immunoprecipitation and immunofluorescence microscopy. Lipin1 also interacted with HIST1H2BK, which was confirmed in SMMC7721 cells by protein immunoprecipitation.
• Antimicrobial polypeptides of the human colonic epithelium.
  Howell, Peptides 2003 (PubMed)
  • GeneRIF: Histone H2B antimicrobial peptides exhibit antibacterial activity and contribute to the formation of the antimicrobial barrier of the colonic epithelium
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...No H2B1H Q93079 H2BC9 6p22.2 Replication dependent No H2B1J P06899 H2BC11 6p22.2 Replication dependent H2B1K O60814 H2BC12 6p22.2 Replication dependent Yes H2B1L Q99880 H2BC13 6p22.1 Replication dependent No H2B1M Q99879 H2BC14 6p22.1 Replication dependent No H2B1N Q99877 H2BC15 6p22.1 Replication dependent No H2B1O P23527 H2BC17 6p22.1...”
• Exercise-Dependent Modulation of Immunological Response Pathways in Endurance Athletes With and Without Atrial Fibrillation.
  Dorian, Journal of the American Heart Association 2024
  • “...variant P01242 2.9 4.20E05 Histone H2B type 2E Q16778 2.6 5.40E06 Histone H2B type 1K O60814 2.5 4.90E06 Histone H2B type 2E Q16778 2.4 4.00E06 Histone H2A type 1A Q96QV6 2.3 7.40E06 Histone H2A type 1 P0C0S8 2.1 4.90E06 IGFbinding protein 1 P08833 2.1 4.10E04 Histone...”
• Cell cycle-dependent gene networks for cell proliferation activated by nuclear CK2α complexes.
  Homma, Life science alliance 2024
  • “...Histone H1.4 3269.68 31737.32 P16402 Histone H1.3 31633.01 Q16777 Histone H2A type 2-C 20478.93 19368.15 O60814 Histone H2B type 1-K 11338 15504.75 P06899 Histone H2B type 1-J 10945.56 15461.91 P0C0S5 Histone H2A.Z 7256.44 10520.64 Q8IUE6 Histone H2A type 2-B 7402.83 9127.07 P07305 Histone H1.0 648.05 Q71DI3...”
• Microsporidian EnP1 alters host cell H2B monoubiquitination and prevents ferroptosis facilitating microsporidia survival.
  Guan, Proceedings of the National Academy of Sciences of the United States of America 2024
• First-in-Class Dual EZH2-HSP90 Inhibitor Eliciting Striking Antiglioblastoma Activity In Vitro and In Vivo.
  Sharma, Journal of medicinal chemistry 2024
  • “...H12 552.01 0.334 P51991 HNRNPA3 121.56 0.377 P08758 ANXA5 30.37 0.406 Q9ULV4 CORO1C 53.84 0.410 O60814 H2BC12 211.06 0.419 P06899 H2BC11 220.59 0.423 P21589 NT5E 71.63 0.446 P61981 YWHAG 112.04 0.447 O00148 DDX39A 156.38 0.515 P62805 H4C1 598.09 0.556 P68371 TUBB4B 763.06 0.564 O43169 CYB5B 36.86...”
• The Modulation of Septic Shock: A Proteomic Approach.
  Alves, International journal of molecular sciences 2024
  • “...15.67 0.0001 3.284 + NNMT P40261 Nicotinamide N-methyltransferase 13.64 1.56 10 5 3.286 + HIST1H2BK O60814 Histone H2B type 1-K 68.54 5.53 10 5 3.356 + RNASE3 P12724 Eosinophil cationic protein 35.48 0.0002 3.359 + ATP6V1B1 C9JL73 V-type proton ATPase subunit B, kidney isoform 45.81 2.28...”
• A proteomic perspective and involvement of cytokines in SARS-CoV-2 infection
  Banu, PloS one 2023
  • “...GN = ANXA1 PE = 1 SV = 2 - [ANXA1_HUMAN] 38.93 27.75 3.2 11 O60814 HIST1H2BK Histone H2B type 1-K OS = Homo sapiens OX = 9606 GN = HIST1H2BK PE = 1 SV = 3 - [H2B1K_HUMAN] 2.96 8.73 3.1 12 P17516 AKR1C4 Aldo-keto...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* Q93079 Histone H2B type 1-H 16807.41 * P06899 Histone H2B type 1-J 17593.68 * O60814 Histone H2B type 1-K 16807.41 * Q99880 Histone H2B type 1-L 16807.41 * Q99879 Histone H2B type 1-M 16807.41 * Q99877 Histone H2B type 1-N 16807.41 * P23527 Histone H2B...”
• More

H2B_ZHASC / Q75VN4 Histone H2B from Zhangixalus schlegelii (Japanese gliding frog) (Rhacophorus schlegelii) (see paper)
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
  function: Has antibacterial activity against the Gram-negative bacteria E.coli and the Gram-positive bacteria S.aureus.
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• From inside to outside: exploring extracellular antimicrobial histone-derived peptides as multi-talented molecules.
  Muñoz-Camargo, The Journal of antibiotics 2024
  • “...Endotoxin activity binding LPS [ 12 ] H2B Rhacophorus schlegelii Skin H2B 126bp +18.75 MPEPAKSAPAAKKGSKKAVSKVQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK Q75VN4 Antibacterial activity E. coli [ 42 ] H2B Litopenaeus vannamei hemocytes H2B 116bp +15.75 TSGKAAKKAGKAQKSITKGDKKKRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK P83863 Antibacterial activity M. luteus 3 M [ 3 ] Human H3.1 Full length H3...”

H2B11_XENLA / P02281 Histone H2B 1.1; H2B1.1 from Xenopus laevis (African clawed frog) (see 4 papers)
NP_001086753 histone H2B 1.1 from Xenopus laevis
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA.
• Glutamylation of Npm2 and Nap1 acidic disordered regions increases DNA mimicry and histone chaperone efficiency
  Lorton, iScience 2024
  • “...sequence Uniprot Consortium 58 Uniprot P06897 Xenopus laevis H2B protein sequence Uniprot Consortium 58 Uniprot P02281 Resource availability Lead contact Further information and requests for resources and reagents should be directed to and will be fulfilled by the Lead Contact, David Shechter ( david.shechter@einsteinmed.edu ). Materials...”
• Self-assembling viral histones are evolutionary intermediates between archaeal and eukaryotic nucleosomes
  Irwin, Nature microbiology 2024
  • “...after being codon optimized and synthesized by Synbio Technologies. Xenopus laevis histones ( P06897 , P02281 , P02302 , P62799 ) were either expressed polycistronically with each open reading frame separated by a ribosome binding site, or were joined with three linkers from histone quadruplet HQA1...”
• The exquisite specificity of human protein arginine methyltransferase 7 (PRMT7) toward Arg-X-Arg sites
  Bondoc, PloS one 2023
  • “...1404.4 97.0% a Obtained from UNIPROT accession number P62807. b Obtained from UNIPROT accession number P02281. c Theoretical molecular weight using Expasy Compute pI/Mw tool. d Theoretical/experimental molecular weight determined by GenScript. e Experimentally determined HPLC purity reported on GenScript peptide analysis certificate. In vitro methylation...”
  • “...sapiens histone H2B (UniProt accession Q93079 ) and X . laevis histone H2B (UniProt accession P02281 ) were aligned using Clustal Omega. Highlighted is the region spanning amino acids 2337 which contains the target sequence 29-RKRSR-33 present in human histone H2B that is methylated by PRMT7....”
• Glutamylation of Npm2 and Nap1 acidic disordered regions increases DNA charge mimicry to enhance chaperone efficiency.
  Lorton, bioRxiv : the preprint server for biology 2023
  • “...for proteins used in this study: Xenoupus laevis Nap1 (Q4U0Y42), Npm2 (A0A1L8GRP4), H2A (P06897), H2B (P02281), and human TTLL4 5611199aa (Q14679). Assigned chemical shifts for the Xenopus laevis H2A and H2B will be deposited in the Biological Magnetic Resonance Data Bank (BMRB) under accession ( pending...”
• The H2A-H2B dimeric kinetic intermediate is stabilized by widespread hydrophobic burial with few fully native interactions.
  Guyett, Journal of molecular biology 2012
  • GeneRIF: These findings suggest a dimerize-then-rearrange model for H2A-H2B dimers.
• Structure-activity analysis of semisynthetic nucleosomes: mechanistic insights into the stimulation of Dot1L by ubiquitylated histone H2B.
  McGinty, ACS chemical biology 2009
  • GeneRIF: titration of the level of ubiquitylated histone H2B within the nucleosome revealed a 1:1 stoichiometry of Dot1L activation.

LOC100486150 histone H2B 1.1 from Xenopus tropicalis
LOC100496181 histone H2B 1.1 from Xenopus tropicalis
LOC100485134 histone H2B 1.1-like from Xenopus tropicalis
LOC100486870 histone H2B 1.1-like from Xenopus tropicalis
75% identity, 41% coverage

• The DNA-to-cytoplasm ratio broadly activates zygotic gene expression in Xenopus
  Jukam, Current biology : CB 2021
  • “...nucleotides that was greater than 30% of the X. tropicalis genes mRNA length ( LOC100485134, LOC100486150, LOC100486870, LOC100490072, LOC100495041, LOC100496181, LOC100497915, LOC100498329, LOC100498553, LOC101732029, LOC108648872, actb, bin1, cbx1, cenpo, h2bc12, hes5.8, sox17a, sox18, sox18_1, sox18_2, tspan36 ). The remaining 595 genes were used as the ZGA...”
• The DNA-to-cytoplasm ratio broadly activates zygotic gene expression in Xenopus
  Jukam, Current biology : CB 2021
  • “...than 30% of the X. tropicalis genes mRNA length ( LOC100485134, LOC100486150, LOC100486870, LOC100490072, LOC100495041, LOC100496181, LOC100497915, LOC100498329, LOC100498553, LOC101732029, LOC108648872, actb, bin1, cbx1, cenpo, h2bc12, hes5.8, sox17a, sox18, sox18_1, sox18_2, tspan36 ). The remaining 595 genes were used as the ZGA gene set in all...”
• The DNA-to-cytoplasm ratio broadly activates zygotic gene expression in Xenopus
  Jukam, Current biology : CB 2021
  • “...100 nucleotides that was greater than 30% of the X. tropicalis genes mRNA length ( LOC100485134, LOC100486150, LOC100486870, LOC100490072, LOC100495041, LOC100496181, LOC100497915, LOC100498329, LOC100498553, LOC101732029, LOC108648872, actb, bin1, cbx1, cenpo, h2bc12, hes5.8, sox17a, sox18, sox18_1, sox18_2, tspan36 ). The remaining 595 genes were used as the...”
• The DNA-to-cytoplasm ratio broadly activates zygotic gene expression in Xenopus
  Jukam, Current biology : CB 2021
  • “...that was greater than 30% of the X. tropicalis genes mRNA length ( LOC100485134, LOC100486150, LOC100486870, LOC100490072, LOC100495041, LOC100496181, LOC100497915, LOC100498329, LOC100498553, LOC101732029, LOC108648872, actb, bin1, cbx1, cenpo, h2bc12, hes5.8, sox17a, sox18, sox18_1, sox18_2, tspan36 ). The remaining 595 genes were used as the ZGA gene...”

W5QA24 Histone H2B from Ovis aries
75% identity, 37% coverage

• Post translational modifications of milk proteins in geographically diverse goat breeds
  Rout, Scientific reports 2021
  • “...Alpha-lactalbumin Ovis aries LALBA M518; C502 W5QFN4 Succinyl-CoA:3-ketoacid-coenzyme A transferase Ovis aries OXCT1 M60; M63 W5QA24 Histone H2B Ovis aries HIST2H2BE M84 W5Q6L8 IF rod domain-containing protein Ovis aries VIM M479 A0A088DBX4 Haemagglutinin protein Peste-des-petits-ruminants virus H Functional prediction and protein interaction analysis and bioactive peptides...”

LOC100498329 histone H2B 1.1 from Xenopus tropicalis
LOC100497915 histone H2B 1.1 from Xenopus tropicalis
75% identity, 41% coverage

• The DNA-to-cytoplasm ratio broadly activates zygotic gene expression in Xenopus
  Jukam, Current biology : CB 2021
  • “...of the X. tropicalis genes mRNA length ( LOC100485134, LOC100486150, LOC100486870, LOC100490072, LOC100495041, LOC100496181, LOC100497915, LOC100498329, LOC100498553, LOC101732029, LOC108648872, actb, bin1, cbx1, cenpo, h2bc12, hes5.8, sox17a, sox18, sox18_1, sox18_2, tspan36 ). The remaining 595 genes were used as the ZGA gene set in all subsequent analyses...”
• The DNA-to-cytoplasm ratio broadly activates zygotic gene expression in Xenopus
  Jukam, Current biology : CB 2021
  • “...30% of the X. tropicalis genes mRNA length ( LOC100485134, LOC100486150, LOC100486870, LOC100490072, LOC100495041, LOC100496181, LOC100497915, LOC100498329, LOC100498553, LOC101732029, LOC108648872, actb, bin1, cbx1, cenpo, h2bc12, hes5.8, sox17a, sox18, sox18_1, sox18_2, tspan36 ). The remaining 595 genes were used as the ZGA gene set in all subsequent...”

Q2M2T1 Histone H2B type 1-K from Bos taurus
75% identity, 41% coverage

• Characterizations of annexin A1-interacting proteins in apical membrane and cytosolic compartments of renal tubular epithelial cells.
  Peerapen, Computational and structural biotechnology journal 2023
  • “...4.97 Histone H1.3 P16402 H13 135 18.6 4/22 22.34 11.02 # Histone H2B type 1-K Q2M2T1 H2BC12 66 31.7 5/57 13.87 10.29 # Inosine-5-monophosphate dehydrogenase 2 Q3SWY3 IMPDH2 66 2.3 1/21 56.13 6.87 L -lactate dehydrogenase A chain P06151 LDHA 218 12.0 4/28 36.82 7.62 NAD(P)H...”
• Snapshot imprinting as a tool for surface mapping and identification of novel biomarkers of senescent cells.
  Piletska, Nanoscale advances 2022
  • “...H2A type 2-C 17.2 14 0.1 0.1 O60814; P06899; P23527; P33778; P58876; P62807; P62808; Q16778; Q2M2T1; Q32L48; Q5QNW6; Q93079; Q99877; Q99879; P57053; Q96A08; Q99880; Q8N257 Histone H2B type 1-B 19 15.2 1.7 1.1 The cell division cycle 7-related protein kinase (CDC7) is a serine/threonine kinase that...”
• Characterization of paucibacillary ileal lesions in sheep with subclinical active infection by Mycobacterium avium subsp. paratuberculosis
  Pisanu, Veterinary research 2018
  • “...1.65 b 2.05 P31836 NCAM1 Neural cell adhesion molecule 1 1.49 b 1.10 b 2.02 Q2M2T1 HIST1H2BK Histone H2B type 1-K 1.24 a 3.55 1.20 a Q3T052 ITIH4 Inter-alpha-trypsin inhibitor heavy chain H4 0.83 a 2.63 1.82 b P61823 RNASE1 Ribonuclease, pancreatic 1.11 a 2.60 1.66...”

H2B12_XENLA / P06900 Histone H2B 1.2; H2B1.2 from Xenopus laevis (African clawed frog) (see paper)
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Molecular basis of RanGTP-activated release of Histones H2A-H2B from Importin-9.
  Shaffer, Structure (London, England : 1993) 2023
  • “...was cleaved off before the HiTrap SP column. Frog H2A (Uniprot P06897) and H2B (Uniprot P06900) were obtained from The Histone Source (Colorado State University) and refolded as previously. 1 Hydrogen-Deuterium Exchange Mass Spectrometry Exchange samples were prepared from 25 M stocks of Imp9, H2A-H2B, RanGTP,...”

W5A7K6 Histone H2B from Triticum aestivum
76% identity, 33% coverage

• De novo reconstitution of chromatin using wheat germ cell-free protein synthesis
  Endo, FEBS open bio 2021
  • “...30 ]. Wheat Triticumaestivum histone sequences were also retrieved from UniProt, including TaH2A (A03AB6IP09), TaH2B (W5A7K6), TaH3 (W5GCP8) and TaH4 (A0A3B6U3I5). Pairwise sequence alignment ( https://www.ebi.ac.uk/Tools/psa/emboss_needle/ ) was performed for each histone from two species. Results and Discussion Synthesis of histones, chromatin assembly factors and histone...”

H2B1J_HUMAN / P06899 Histone H2B type 1-J; Histone H2B.1; Histone H2B.r; H2B/r from Homo sapiens (Human) (see 9 papers)
LOC110261670 histone H2B type 1-J from Sus scrofa
NP_066402 histone H2B type 1-J from Homo sapiens
75% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  function: Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Heterodimer H2BC11 and H2AZ1 interacts with VPS72 (via N-terminal domain) (PubMed:26974126).
• Transcriptomic Data Analyses Reveal That Sow Fertility-Related lincRNA NORFA Is Essential for the Normal States and Functions of Granulosa Cells
  Du, Frontiers in cell and developmental biology 2021
  • “...5.01E35 Down gene12983 LOC100158121 7 5.198 6.31E23 Down Sus scrofa_newgene_206428 1 5.176 3.98E26 Up gene13051 LOC110261670 7 5.223 3.16E27 Up gene8084 MCL1 4 5.276 2.51E28 Up Sus scrofa_newgene_194856 5 5.367 2.00E29 Up Sus scrofa_newgene_192505 5 5.773 1.58E30 Up gene21112 P2RY1 13 6.213 1.26E23 Up gene14415 LOC100152619...”
• Viral histones: pickpocket's prize or primordial progenitor?
  Talbert, Epigenetics & chromatin 2022
  • “...with an in silico fusion of human H2B and H2A (H2BH2A, with an separating H2B NP_066402 from H2A NP_066390.1; Additional file 2 : Fig. S4), while HH proteins are 2737% identical with H2BH2A. The H domain of marseillevirus T19 has been predicted to contain helices corresponding...”
• No associations found between the genes situated at 6p22.1, HIST1H2BJ, PRSS16, and PGBD1 in Japanese patients diagnosed with schizophrenia.
  Kitazawa, American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2012 (PubMed)
  • GeneRIF: The genes HIST1H2BJ, PRSS16, and PGBD1 were not associated with Japanese patients with schizophrenia.
• Histone variants and their post-translational modifications in primary human fat cells
  Jufvas, PloS one 2011
  • “...6+ 77/1.7e-05 LLLPGELAKHAVSEGTKAVTKYTS(ph)-S(ph)K(ac/me3)K(ac/me3)R 101128 543.8 6+ 40/0.09 HIST1H2BJ, protein name: H2B type 1-J, GI:20336754, Acc: NP_066402, Coverage: 38% QVHPDTGISSK 4858 584.7 2+ 58/0.011 AMGIMNSFVNDIFER 5973 872.5 2+ 109/4e-007 582.2 3+ 68/0.0059 IAGEASR 7480 352.2 2+ 52/0.037 LAHYNK 8186 373.2 2+ 31/10 STITSREIQTAVR 88100 732.0 2+ 77/4.4e-06...”
• Common variants on chromosome 6p22.1 are associated with schizophrenia.
  Shi, Nature 2009
  • GeneRIF: Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
• Endotoxin-neutralizing antimicrobial proteins of the human placenta.
  Kim, Journal of immunology (Baltimore, Md. : 1950) 2002 (PubMed)
  • GeneRIF: Histone H2A and H2B antimicrobial peptides exhibit antibacterial activity and endotoxin-neutralizing activity in the placenta.
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...H2B1D P58876 H2BC5 6p22.2 Replication dependent No H2B1H Q93079 H2BC9 6p22.2 Replication dependent No H2B1J P06899 H2BC11 6p22.2 Replication dependent H2B1K O60814 H2BC12 6p22.2 Replication dependent Yes H2B1L Q99880 H2BC13 6p22.1 Replication dependent No H2B1M Q99879 H2BC14 6p22.1 Replication dependent No H2B1N Q99877 H2BC15 6p22.1 Replication...”
• Don't die like me: Which proteins are responsible for the selective neuronal vulnerability within the substantia nigra?
  Steinbach, PloS one 2024
  • “...These proteins were: Myelin basic protein (P02676), Myelin P2 protein (P02689), Histone H2B type 1-J (P06899), Type II cytoskeletal 4 keratin (P19013), Microtubule-associated protein 4 (P27816), Ectonucleotide pyrophosphatase / phosphodiesterase family member 6 (Q6UWR7) and Hyaluronan and proteoglycan link protein 2 (Q9GZV7). Two proteins were higher...”
  • “...1.08 Dorsal Protein kinase C beta type P05771 2.59E-03 0.65 Ventral Histone H2B type 1-J P06899 3.26E-02 0.64 Dorsal Keratin, type II cytoskeletal 4 P19013 2.59E-03 1.00 Dorsal Microtubule-associated protein 4 P27816 3.38E-03 0.65 Dorsal Calmodulin P62158 5.77E-04 0.96 Ventral Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 Q6UWR7...”
• Cell cycle-dependent gene networks for cell proliferation activated by nuclear CK2α complexes.
  Homma, Life science alliance 2024
  • “...31633.01 Q16777 Histone H2A type 2-C 20478.93 19368.15 O60814 Histone H2B type 1-K 11338 15504.75 P06899 Histone H2B type 1-J 10945.56 15461.91 P0C0S5 Histone H2A.Z 7256.44 10520.64 Q8IUE6 Histone H2A type 2-B 7402.83 9127.07 P07305 Histone H1.0 648.05 Q71DI3 Histone H3.2 414.05 P62805 Histone H4 19401.4...”
• First-in-Class Dual EZH2-HSP90 Inhibitor Eliciting Striking Antiglioblastoma Activity In Vitro and In Vivo.
  Sharma, Journal of medicinal chemistry 2024
  • “...HNRNPA3 121.56 0.377 P08758 ANXA5 30.37 0.406 Q9ULV4 CORO1C 53.84 0.410 O60814 H2BC12 211.06 0.419 P06899 H2BC11 220.59 0.423 P21589 NT5E 71.63 0.446 P61981 YWHAG 112.04 0.447 O00148 DDX39A 156.38 0.515 P62805 H4C1 598.09 0.556 P68371 TUBB4B 763.06 0.564 O43169 CYB5B 36.86 0.568 O15347 HMGB3 22.25...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* P58876 Histone H2B type 1-D 16807.41 * Q93079 Histone H2B type 1-H 16807.41 * P06899 Histone H2B type 1-J 17593.68 * O60814 Histone H2B type 1-K 16807.41 * Q99880 Histone H2B type 1-L 16807.41 * Q99879 Histone H2B type 1-M 16807.41 * Q99877 Histone H2B...”
• Identification of Potential Protein Targets in Extracellular Vesicles Isolated from Chemotherapy-Treated Ovarian Cancer Cells
  Chan, Current issues in molecular biology 2023
  • “...P06733 ENO1 ENO1 P07195 LDHB LDHB P60709 ACTB ACTB P68032 ACTC1 ACTC1 P04083 ANXA1 ANXA1 P06899 H2BC11 H2BC11 O60814 H2BC12 H2BC12 Q86YZ3 HRNR HRNR P11279 LAMP1 LAMP1 P02788 LTF LTF P08758 ANXA5 ANXA5 P60033 CD81 CD81 Q92820 GGH GGH P51148 RAB5C RAB5C O00560 SDCBP SDCBP P25311...”
• Unraveling molecular characteristic of fluoride neurotoxicity on U87 glial-like cells: insights from transcriptomic and proteomic approach.
  Puty, Frontiers in cellular neuroscience 2023
  • “...type 1-D + 489.46 + 489.46 Q93079 Histone H2B type 1-H + 489.46 + 489.46 P06899 Histone H2B type 1-J + 489.46 + 489.46 O60814 Histone H2B type 1-K + 489.46 + 489.46 Q99880 Histone H2B type 1-L + 489.46 + 489.46 Q99879 Histone H2B type...”
• Phospholipase A2 regulates autophagy in gouty arthritis: proteomic and metabolomic studies.
  Fu, Journal of translational medicine 2023
  • “...P06576 ATP synthase subunit beta, mitochondrial ATP5F1B P06702 Protein S100-A9 S100A9 P06744 Glucose-6-phosphate isomerase GPI P06899 Histone H2B type 1-J H2BC11 P07339 Cathepsin D CTSD P07858 Cathepsin B CTSB P07910 Heterogeneous nuclear ribonucleoproteins C1/C2 HNRNPC P08311 Cathepsin G CTSG P08670 Vimentin VIM P09603 Macrophage colony-stimulating factor...”
• More

AT2G37470 histone H2B, putative from Arabidopsis thaliana
78% identity, 36% coverage

• Revealing cis- and trans-regulatory elements underlying nuclear distribution and function of the Arabidopsis histone H2B.8 variant
  Khadka, BMC plant biology 2024
  • “...from Arabidopsis thaliana (Ler ecotype) and used as a template for PCR amplification of H2B.5 (At2g37470), H2B.8 (At1g08170) and H2B.9 (At3g45980) coding sequences using primers (supplemental Table 1 ) flanked with Bam HI and Sma I sites at the 5 and 3 ends, respectively. Parental plasmid...”
• Advances in biological functions and mechanisms of histone variants in plants
  Wu, Frontiers in genetics 2023
  • “...AT3G54560 INO80 H2B H2B.1 AT1G07790 NAP1 NRP1 FACT H2B.2 AT5G22880 H2B.3 AT2G28720 H2B.4 AT5G59910 H2B.5 AT2G37470 H2B.6 AT3G53650 H2B.7 AT3G09480 H2B.8 AT1G08170 Regulate seed development but not expressed in sperm cells H2B.9 AT3G45980 H2B.10 AT5G02570 H2B.11 AT3G46030 H3 H3.3 AT4G40030 HIRA Transcriptional activation Flowering time Zhao...”
• Construction and analysis of protein-protein interaction networks based on nuclear proteomics data of the desiccation-tolerant Xerophyta schlechteri leaves subjected to dehydration stress
  Shoko, Communicative & integrative biology 2023
  • “...Histone H2B [Source:UniProtKB/TrEMBL;Acc:Q1H5F7] 26 HTA13 Probable histone H2A.2 [Source:UniProtKB/Swiss-Prot;Acc:Q9LHQ5] 24 HTA7 Histone H2A [Source:UniProtKB/TrEMBL;Acc:A0A178UFF2] 23 AT2G37470 Histone H2B.4 [Source:UniProtKB/Swiss-Prot;Acc:Q9ZUS0] 21 Table 2. Significantly enriched GO biological process terms from the key proteins in the up-regulated proteins and their predicted associates. GO id Description q-value GO:0045814 negative...”
• Histone variants and modifications during abiotic stress response
  Nunez-Vazquez, Frontiers in plant science 2022
  • “...) H2B.2 Variant At5g22880, HTB2 H2B.3 Variant At2g28720, HTB3 H2B.4 Variant At5g59910, HTB4 H2B.5 Variant At2g37470, HTB5 H2B.6 Variant At3g53650, HTB6 H2B.7 Variant At3g09480, HTB7 Development of reproductive tissues ( Jiang etal., 2020a ) H2B.8/H2B.S Variant At1g08170, HTB8 Regulation of seed formation ( Jiang etal., 2020a...”
• Plant Histone HTB (H2B) Variants in Regulating Chromatin Structure and Function
  Khadka, Plants (Basel, Switzerland) 2020
  • “...HTB2 (At5g22880), HTB3 (At2g28720), HTB4 (At5g59910), HTB9 (At3g45980), and HTB11 (At3g46030) and class II HTB5 (At2g37470), HTB6 (At3g53650), HTB7 (At3g09480), and HTB10 (At5g02570). Class I variants can be further divided into class I-A (H2B4, 9, and 11) and class I-B (HTB1, 2, and 3) and class...”
• The evolution and functional divergence of the histone H2B family in plants
  Jiang, PLoS genetics 2020
  • “...non-periodic 411 HTB2 AT5G22880 S 291 HTB3 AT2G28720 non-periodic 3805 HTB4 AT5G59910 S 314 HTB5 AT2G37470 S 83 HTB6 AT3G53650 S 223 HTB9 AT3G45980 S 110 HTB11 AT3G46030 S 75 Data from Cyclebase 3.0 (REF) To test the link between H2B.3 and the cell cycle further,...”
• Ectopic RING zinc finger gene from hot pepper induces totally different genes in lettuce and tobacco
  Kesawat, Molecular breeding : new strategies in plant improvement 2018
  • “...At5g63870 Serine/threonine-protein phosphatase (pp7) 2.16 At5g56460 Protein kinase 2.86 At5g60460 Sec61-beta subunit family protein 2.78 At2g37470 Histone h2b 3.19 At4g27960 Ubiquitin-conjugating enzyme 9 (ubc9) 2.35 At3g01400 Armadillo/beta-catenin repeat family protein 2.89 At5g66040 Protein with thiosulfate sulfurtransferase/rhodanese activity (STR16) 1.91 At3g09440 Heat shock protein 70 (hsp70) 1.83...”
• Different stress responsive strategies to drought and heat in two durum wheat cultivars with contrasting water use efficiency
  Aprile, BMC genomics 2013
  • “...Histone 1.2 At2g30620 Ta.23485.1.S1_at 1 Histone 2A At4g27230 Ta.644.1.S1_at 1 At1g54690 Ta.6538.2.S1_at 4 Histone 2B At2g37470 Ta.7378.28.S1_x_at 4 Histone 3 At5g10400 Ta.27101.7_S1_at 40 At5g10400 Ta.27101.7_S1__xat 40 HDAC At3g44680 TaAffx.93321.1.S1_at 1 At5g61060 Ta.1597.1.S1_at 1 HAT At5g64610 Ta.5414.1.S1_at 1 Ta.5414.2.S1_a_at 8 RCC1 At3g02300 Ta.15822.1.S1_at 1 At5g48330 TaAffx.53414.1.S1_at 8...”
  • “...histone 1.2 ( At2g30620 [Ta.23485.1.S1_at]), histone 2A ( At4g27230 [Ta.644.1.S1_at], At1g54690 [Ta.6538.2.S1_at]), histone 2B ( At2g37470 [Ta.7378.28.S1_x_at]), histone 3 ( At5g10400 [Ta.27101.7.S1_at, Ta.27101.7.S1_x_at]), two histone deacetylases ( At3g44680 [TaAffx.93321.1.S1_at], At5g61060 [Ta.1597.1.S1_at]) and a histone acetyltransferase ( At5g64610 [Ta.5414.1.S1_at, Ta.5414.2.S1_a_at]), whose expression behaviors were associated mainly to...”
• More

7xx7R Crystal structure of nucleosome-h1x linker histone assembly (sticky- 169a DNA fragment)
75% identity, 42% coverage

• Ligand: dna (7xx7R)

A2XF66 Histone H2B.1 from Oryza sativa subsp. indica
78% identity, 33% coverage

• BRHIS1 suppresses rice innate immunity through binding to monoubiquitinated H2A and H2B variants
  Li, EMBO reports 2015 (secret)

P30755 Histone H2B.1 from Zea mays
76% identity, 34% coverage

• Protein Profiling Reveals Novel Proteins in Pollen and Pistil of W22 (ga1; Ga1) in Maize
  Yu, Proteomes 2014
  • “...17.6 48.74 O24594 3-hydroxy-3-methylglutaryl-coenzyme A reductase 28 60,892 2 6.77 6 3.07 Nucleic acid binding P30755 Histone H2B.1 32 16,410 10 5 39.1 16.68 P40280 Histone H2A 65 16,417 10.59 2 28.3 70.53 Q8S4P5 Histone-lysine N-methyltransferase EZ2 24 99,916 8.47 7 11 9.82 Q8S4P6 Histone-lysine N-methyltransferase...”

7ux9D / O23629 Arabidopsis ddm1 bound to nucleosome (h2a.W, h2b, h3.3, h4, with 147 bp DNA) (see paper)
78% identity, 52% coverage

• Ligand: dna (7ux9D)

AT3G53650 histone H2B, putative from Arabidopsis thaliana
76% identity, 37% coverage

• Advances in biological functions and mechanisms of histone variants in plants
  Wu, Frontiers in genetics 2023
  • “...H2B H2B.1 AT1G07790 NAP1 NRP1 FACT H2B.2 AT5G22880 H2B.3 AT2G28720 H2B.4 AT5G59910 H2B.5 AT2G37470 H2B.6 AT3G53650 H2B.7 AT3G09480 H2B.8 AT1G08170 Regulate seed development but not expressed in sperm cells H2B.9 AT3G45980 H2B.10 AT5G02570 H2B.11 AT3G46030 H3 H3.3 AT4G40030 HIRA Transcriptional activation Flowering time Zhao et al....”
• Histone variants and modifications during abiotic stress response
  Nunez-Vazquez, Frontiers in plant science 2022
  • “...HTB2 H2B.3 Variant At2g28720, HTB3 H2B.4 Variant At5g59910, HTB4 H2B.5 Variant At2g37470, HTB5 H2B.6 Variant At3g53650, HTB6 H2B.7 Variant At3g09480, HTB7 Development of reproductive tissues ( Jiang etal., 2020a ) H2B.8/H2B.S Variant At1g08170, HTB8 Regulation of seed formation ( Jiang etal., 2020a ) H2B.9 Variant At3g45980,...”
• Plant Histone HTB (H2B) Variants in Regulating Chromatin Structure and Function
  Khadka, Plants (Basel, Switzerland) 2020
  • “...HTB3 (At2g28720), HTB4 (At5g59910), HTB9 (At3g45980), and HTB11 (At3g46030) and class II HTB5 (At2g37470), HTB6 (At3g53650), HTB7 (At3g09480), and HTB10 (At5g02570). Class I variants can be further divided into class I-A (H2B4, 9, and 11) and class I-B (HTB1, 2, and 3) and class II into...”
• The evolution and functional divergence of the histone H2B family in plants
  Jiang, PLoS genetics 2020
  • “...S 291 HTB3 AT2G28720 non-periodic 3805 HTB4 AT5G59910 S 314 HTB5 AT2G37470 S 83 HTB6 AT3G53650 S 223 HTB9 AT3G45980 S 110 HTB11 AT3G46030 S 75 Data from Cyclebase 3.0 (REF) To test the link between H2B.3 and the cell cycle further, we analysed the expression...”
  • “...or short day (8 h light/16 h dark) conditions at 22C. Phylogenetic analyses Arabidopsis thaliana (AT3G53650), Marchantia polymorpha (Mapoly0053s0016) and Klebsormidium nitens (kfl00099_g20_v1.1) H2B protein sequences were used in BLAST searches of Phytozome ( https://phytozome.jgi.doe.gov/pz/portal.html ), Fernbase ( https://www.fernbase.org/ ), Orcae ( https://bioinformatics.psb.ugent.be/orcae/overview/Chbra ), waterlilyPond (...”
• Coupling of H3K27me3 recognition with transcriptional repression through the BAH-PHD-CPL2 complex in Arabidopsis
  Zhang, Nature communications 2020
  • “...in Supplementary Fig. 10bd , nuclear run-on assay showed that AT2G43570 , AT3G59480 , and AT3G53650 genes were transcriptionally upregulated compared to wild type, indicating that these three genes are subjected to BPC complex-mediated transcriptional repression. Interestingly, ChIP-qPCR results indicated that H3K27me3 levels were not obviously...”
  • “..., SUC5 , and FT (Fig. 4g ). While H3K27me3 deposition showed significant reduction at AT3G53650 , implying that BPC dysfunction has substantial impacts on H3K27me3 deposition at this gene. Combined with these data, we speculate that, for most target genes, the BPC complex may serve...”
• Transcriptomic Analysis of Soil-Grown Arabidopsis thaliana Roots and Shoots in Response to a Drought Stress
  Rasheed, Frontiers in plant science 2016
  • “...0.99 1.18 0.78 0.40 At3G45980 Histone superfamily/H2B 0.85 0.72 0.49 0.23 1.07 0.89 0.67 0.20 At3g53650 Histone superfamily/H2B 1.01 0.89 0.59 0.31 0.86 0.58 0.44 0.68 At5g12910 Histone superfamily/H3.3 1.05 0.95 0.50 0.13 0.85 0.55 0.39 0.09 At5g10390 Histone superfamily/H3 1.07 1.14 0.58 0.14 0.83 0.56...”
• Dual binding of chromomethylase domains to H3K9me2-containing nucleosomes directs DNA methylation in plants
  Du, Cell 2012
  • “...At5g02570 59 13 32.6 3675 50.8 At3g09480 H2B At2g37470 62 15 46.4 3610 49.9 H2B At3g53650 32 8 30.4 1863 25.7 At5g59910 At1g07790 H2B 1 At5g22880 79.6 16.6 42.2 4327 59.8 At3g45980 At3g46030 At5g10400 At1g09200 H3 1 At5g10390 63 21 52.9 3674 50.7 At5g65360 At3g27360 HTR12...”
• A unified phylogeny-based nomenclature for histone variants
  Talbert, Epigenetics & chromatin 2012
  • “...HTB2 H2B.2 " At2g28720 HTB3 H2B.3 " At5g59910 HTB4 H2B.4 " At2g37470 HTB5 H2B.5 " At3g53650 HTB6 H2B.6 " At3g09480 HTB7 H2B.7 " At1g08170 HTB8 H2B.8 " At3g45980 HTB9 H2B.9 " At5g02570 HTB10 H2B.10 " At3g46030 HTB11 H2B.11 " H3 Gene Protein Former name At5g65360 HTR1...”
• More

Q921L4 Histone H2B from Mus musculus
75% identity, 38% coverage

• Brown adipose tissue-derived exosomes mitigate the metabolic syndrome in high fat diet mice.
  Zhou, Theranostics 2020
  • “...Q9D2G2 Dlst 9 11415.36246 4.50E-06 P13707 Gpd1 24 5015.498011 1.28E-05 Q91ZJ5 Ugp2 22 3758.13794 0.018092505 Q921L4 LOC665622 7 3713.0007 0.008470212 P17563 Selenbp1 22 3241.106903 1.52E-06 P49817 Cav1 8 3226.903646 0.000525067 Q3UAG2 Pgd 22 2947.502253 1.23E-05 Q9EQ20 Aldh6a1 21 2720.734984 6.52E-05 Q8BWT1 Acaa2 20 1933.65099 5.11E-06 Q99LC5...”

P05621 Histone H2B.2 from Triticum aestivum
76% identity, 34% coverage

• Plant disease resistance is augmented in uzu barley lines modified in the brassinosteroid receptor BRI1
  Ali, BMC plant biology 2014
  • “...GO:0003824 AAF89745.3 Phosphatidic acid phosphatase beta 2.00E-15 Vigna unguiculata Contig1179 3.15308 7.72E-04 3.69557 6.89E-04 GO:0005634 P05621 Histone H2B.2 5.00E-44 Triticum aestivum Contig13350 8.37292 2.88E-08 38.39412 8.05E-12 GO:0005975 AAD28734.1 -1,3-glucanase precursor 7.00E-65 Triticum aestivum HV_CEb0022J21r2 4.86722 4.44E-04 10.55195 5.40E-05 GO:0006857 AAG46153.1 Putative peptide transporter 2.00E-32 Oryza sativa...”

H2B1A_HUMAN / Q96A08 Histone H2B type 1-A; Histone H2B, testis; TSH2B.1; hTSH2B; Testis-specific histone H2B from Homo sapiens (Human) (see 6 papers)
NP_733759 histone H2B type 1-A from Homo sapiens
75% identity, 41% coverage

• function: Variant histone specifically required to direct the transformation of dissociating nucleosomes to protamine in male germ cells (By similarity). Entirely replaces classical histone H2B prior nucleosome to protamine transition and probably acts as a nucleosome dissociating factor that creates a more dynamic chromatin, facilitating the large-scale exchange of histones (By similarity). Core component of nucleosome (By similarity). Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template (By similarity). Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability (By similarity). DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling (By similarity). Also found in fat cells, its function and the presence of post-translational modifications specific to such cells are still unclear (PubMed:21249133).
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers.
• Histone variants: The bricks that fit differently.
  Hegazy, The Journal of biological chemistry 2025
  • “...H2BFWT Q7Z2G1 H2BW1 Xq22.2 Replication independent Yes H2BFM P0C1H6 H2BW2 Xq22.2 Replication independent Yes TSH2B Q96A08 H2BC1 6p22.2 Replication dependent No H2B1B P33778 H2BC3 6p22.2 Replication dependent No H2B1D P58876 H2BC5 6p22.2 Replication dependent No H2B1H Q93079 H2BC9 6p22.2 Replication dependent No H2B1J P06899 H2BC11 6p22.2...”
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...P0C0S5 Histone H2A.Z 8676.91 * P16104 Histone H2AX 3273.08 * U3KQK0 Histone H2B 16807.41 * Q96A08 Histone H2B type 1-A 7130.46 * P33778 Histone H2B type 1-B 17593.68 * P62807 Histone H2B type 1-C/E/F/G/I 16807.41 * P58876 Histone H2B type 1-D 16807.41 * Q93079 Histone H2B...”
• Unraveling molecular characteristic of fluoride neurotoxicity on U87 glial-like cells: insights from transcriptomic and proteomic approach.
  Puty, Frontiers in cellular neuroscience 2023
  • “...+ 209.23 + 209.23 P14625 Endoplasmin + 53.44 + 53.44 P04406 Glyceraldehyde-3-phosphate dehydrogenase + 143.63 Q96A08 Histone H2B type 1-A + 398.54 + 398.54 P33778 Histone H2B type 1-B + 489.46 + 489.46 P62807 Histone H2B type 1-C/E/F/G/I + 489.46 + 489.46 P58876 Histone H2B type...”
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...Histone H2B type 1-H HIST1H2BH 1.483903394 0.56939717 P33778 Histone H2B type 1-B HIST1H2BB 1.483903394 0.56939717 Q96A08 Histone H2B type 1-A HIST1H2BA 1.483903394 0.56939717 P62807 Histone H2B type 1-C/E/F/G/I HIST1H2BC 1.483903394 0.56939717 Q99880 Histone H2B type 1-L HIST1H2BL 1.483903394 0.56939717 Q16778 Histone H2B type 2-E HIST2H2BE 1.483903394...”
  • “...Histone H2B type 1-H HIST1H2BH 0.323611545 1.627665 P33778 Histone H2B type 1-B HIST1H2BB 0.323611545 1.627665 Q96A08 Histone H2B type 1-A HIST1H2BA 0.323611545 1.627665 P62807 Histone H2B type 1-C/E/F/G/I HIST1H2BC 0.323611545 1.627665 Q99880 Histone H2B type 1-L HIST1H2BL 0.323611545 1.627665 Q16778 Histone H2B type 2-E HIST2H2BE 0.323611545...”
• TMT-Based Proteomic Analysis of Human Spermatozoa from Unexplained Recurrent Miscarriage Patients before and after Oral Antioxidant Treatment
  Fernandez-Encinas, Biomedicines 2022
  • “...0.020 Glyceraldehyde-3-phosphate dehydrogenase, testis-specific G3PT_HUMAN O14556 1.92 0.015 1.98 0.010 Histone H2B type 1-A H2B1A_HUMAN Q96A08 2.17 0.002 2.33 <0.001 Heat shock protein beta-1 HSPB1_HUMAN P04792 2.30 0.012 2.67 0.003 LIM domain only protein 7 LMO7_HUMAN Q8WWI1 1.63 0.026 1.12 0.632 * Matrix metalloproteinase-28 MMP28_HUMAN Q9H239...”
• Snapshot imprinting as a tool for surface mapping and identification of novel biomarkers of senescent cells.
  Piletska, Nanoscale advances 2022
  • “...O60814; P06899; P23527; P33778; P58876; P62807; P62808; Q16778; Q2M2T1; Q32L48; Q5QNW6; Q93079; Q99877; Q99879; P57053; Q96A08; Q99880; Q8N257 Histone H2B type 1-B 19 15.2 1.7 1.1 The cell division cycle 7-related protein kinase (CDC7) is a serine/threonine kinase that phosphorylates minichromosome maintenance protein 2 (MCM2) of...”
• Depletion of Mdig Changes Proteomic Profiling in Triple Negative Breast Cancer Cells.
  Thakur, Biomedicines 2022
  • “...secretory protein E1 8.845 RACK1 P63244 Receptor of activated protein C kinase 1 8.820 HIST1H2BA Q96A08 Histone H2B type 1-A 8.673 IQGAP1 P46940 Ras GTPase-activating-like protein IQGAP1 8.603 HUWE1 Q7Z6Z7 E3 ubiquitin-protein ligase HUWE1 8.473 Mdig (RIOX2) Q8IUF8 Mineral dust-induced gene 8.521 KRI1 Q8N9T8 Protein KRI1...”
• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...name Previous symbol HGNC ID UniProt ID H2B H2BC1 H2B clustered histone 1 HIST1H2BA HGNC:18730 Q96A08 NA H2BC2P H2B clustered histone 2, pseudogene HIST1H2BPS1 HGNC:18719 NA H2B H2BC3 H2B clustered histone 3 HIST1H2BB HGNC:4751 P33778 H2B H2BC4 H2B clustered histone 4 HIST1H2BC HGNC:4757 P62807 H2B H2BC5...”
• More
• The inhibition of lactate dehydrogenase A hinders the transcription of histone 2B gene independently from the block of aerobic glycolysis.
  Brighenti, Biochemical and biophysical research communications 2017 (PubMed)
  • GeneRIF: Data indicate that lactate dehydrogenase A (LDHA) is involved in the transcription of histone 2B gene.
• Hypoacetylation, hypomethylation, and dephosphorylation of H2B histones and excessive histone deacetylase activity in DU-145 prostate cancer cells.
  Cang, Journal of hematology & oncology 2016
  • GeneRIF: Data show that histone H2B of prostate cancer cell line DU-145 have hypoacetylation, hypomethylation, and dephosphorylation, suggesting there was an excessive histone deacetylase activity in the cells.
• Nick Your DNA, Mark Your Chromatin.
  Nardozza, Molecular cell 2016 (PubMed)
  • GeneRIF: In a process of single-strand DNA repair, PARP3 mono-ADP-ribosylates nucleosomal histone H2B.
• Characterization of nucleosomes consisting of the human testis/sperm-specific histone H2B variant (hTSH2B).
  Li, Biochemistry 2005 (PubMed)
  • GeneRIF: Reconstituted TSH2B containing octamers are able to form nucleosome core particles which are structurally and dynamically indistinguishable from those reconstituted with octamers consisting of only native histones.

Q8CBB6 Histone H2B from Mus musculus
75% identity, 38% coverage

• A standardized nomenclature for mammalian histone genes.
  Seal, Epigenetics & chromatin 2022
  • “...H2B clustered histone 22 Hist1h2bp MGI:2448409 Q8CGP2 H2B H2bc23 H2B clustered histone 23 Hist1h2bq MGI:3702051 Q8CBB6 H2B H2bc24 H2B clustered histone 24 Hist1h2br MGI:3710645 Q8CBB6 NA H2bc26-ps H2B clustered histone 26, pseudogene Hist3h2bb-ps MGI:1922442 NA H2B H2bc27 H2B clustered histone 27 Hist3h2ba MGI:1925553 Q9D2U9 SubH2Bv/H2B.L** H2bl1...”
• Annexin A2 depletion exacerbates the intracerebral microhemorrhage induced by acute rickettsia and Ebola virus infections.
  Su, PLoS neglected tropical diseases 2020
  • “...Systemic lupus erythematosus H2B1K histone cluster 1, H2bk(Hist1h2bk) 4.67 Alcoholism, Viral carcinogenesis, Systemic lupus erythematosus Q8CBB6 histone cluster 1, H2bq(Hist1h2bq) 4.67 Alcoholism, Viral carcinogenesis, Systemic lupus erythematosus MDHM malate dehydrogenase 2, NAD (mitochondrial)(Mdh2) 11.75 Citrate cycle (TCA cycle), Cysteine and methionine metabolism, Pyruvate metabolism, Glyoxylate and...”
• MS_HistoneDB, a manually curated resource for proteomic analysis of human and mouse histones.
  El, Epigenetics & chromatin 2017
  • “...] Hist1h2br P10853 [ 41 ] Canonical H2B genes: Hist1h2bq, Hist1h2br (putative spliced isoform) Hist1h2bq Q8CBB6 * Hist1h2br Q8CBB6 * Canonical H2B gene: Hist1h2bh Hist1h2bh Q64478 [ 41 ] Canonical H2B gene: Hist1h2bk Hist1h2bk Q8CGP1 [ 41 ] Canonical H2B gene: Hist1h2bm Hist1h2bm P10854 [ 41...”

PITG_03550 histone H2B from Phytophthora infestans T30-4
78% identity, 43% coverage

• Switchable Nitroproteome States of Phytophthora infestans Biology and Pathobiology
  Izbiańska, Frontiers in microbiology 2019
  • “...86 PITG_05737 Signal transduction S32 Heat shock 70 kDa protein Histone H2B 205 114 PITG_11244 PITG_03550 Cell redox homeostasis / response to stress Nucleobase-containing compound metabolism S33 Putative uncharacterized protein 74 PITG_16013 Unclassified S34 PREDICTED: NAD-specific glutamate dehydrogenase 71 PITG_08802 Nitrogen metabolism / protein metabolism S35...”

H2B4_WHEAT / Q43215 Histone H2B.4; H2B153 from Triticum aestivum (Wheat) (see paper)
78% identity, 37% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Quantitative proteomics analysis reveals the tolerance of wheat to salt stress in response to Enterobacter cloacae SBP-8
  Singh, PloS one 2017
  • “...0.748 Q41593 Serpin Z1A S58 0 1.993 1.822 Q43206 Catalase 1 S59 0.677 1.568 0 Q43215 Histone H2B 4 S60 0.179 0 0.733 Q43217 Histone H2B 3 S61 0.453 0 0.733 Q43691 Trypsin alpha amylase inhibitor CMX2 S62 0.246 1.733 1.803 Q41558 Transcription factor HBP 1b...”

H2B10_ARATH / Q9FFC0 Histone H2B.10; HTB2 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT5G22880 HTB2; DNA binding from Arabidopsis thaliana
NP_197679 histone B2 from Arabidopsis thaliana
76% identity, 35% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Interacts with ORTH2.
• Exaptation of ancestral cell-identity networks enables C₄ photosynthesis
  Swift, Nature 2024
  • “...was obtained from a previous report 44 . The coding sequence of Arabidopsis thaliana H2B (At5g22880) was used as an N-terminal signal for targeting mTurquoise2 to the nucleus. All sequences were domesticated for Golden Gate cloning 45 , 46 . Level 1 and Level 2 constructs...”
• Integrative transcriptomics and proteomics profiling of <i>Arabidopsis thaliana</i> elucidates novel mechanisms underlying spaceflight adaptation
  Olanrewaju, Frontiers in plant science 2023
  • “...oxidoreductase family protein 0.3 0.009 0.53 0.01 AT4G34110 Polyadenylate-binding protein 2 0.24 0.022 0.41 0.04 AT5G22880 Histone H2B.10 0.27 0.017 0.25 0.04 AT5G46580 Pentatricopeptide repeat-containing protein At5g46580 0.68 0.004 0.56 0.02 AT5G48030 Chaperone protein dnaJ GFA2 0.55 0.013 0.96 0.03 AT5G48810 Cytochrome B5 isoform D 0.32...”
• Advances in biological functions and mechanisms of histone variants in plants
  Wu, Frontiers in genetics 2023
  • “...Tong et al. (2020) AT1G52740 MBD9 AT3G54560 INO80 H2B H2B.1 AT1G07790 NAP1 NRP1 FACT H2B.2 AT5G22880 H2B.3 AT2G28720 H2B.4 AT5G59910 H2B.5 AT2G37470 H2B.6 AT3G53650 H2B.7 AT3G09480 H2B.8 AT1G08170 Regulate seed development but not expressed in sperm cells H2B.9 AT3G45980 H2B.10 AT5G02570 H2B.11 AT3G46030 H3 H3.3 AT4G40030...”
• Distinct guard cell-specific remodeling of chromatin accessibility during abscisic acid- and CO₂-dependent stomatal regulation
  Seller, Proceedings of the National Academy of Sciences of the United States of America 2023
  • “...using multisite gateway technology (Invitrogen). The Open Reading Frame (ORF) encoding the histone H2B ( AT5G22880 ) was cloned in a pDONR221 entry vector. The cell typespecific promotors RBCp and GC1p, from the Rubisco small subunit 2B gene ( AT5G38420) and the GASA9 ( AT1G22690 )...”
• Rice DSP controls stigma, panicle and tiller primordium initiation
  Yu, Plant biotechnology journal 2023
  • “...frame of DSP and the enhanced green fluorescent protein (eGFP), and ORF of AtH2B ( AT5G22880 ) and blue fluorescent protein (BFP) were inserted into pCAMBIA1300 vector after the cauliflower mosaic virus 35S promoter, respectively. The two constructs were transformed into Agrobacterium tumefaciens strain GV3101 by...”
• Different combinations of laccase paralogs nonredundantly control the amount and composition of lignin in specific cell types and cell wall layers in Arabidopsis
  Blaschek, The Plant cell 2023
  • “...viability was measured using inducible pluripotent cell lines stably transformed with a constitutively expressed HISTONE2B-2-RFP (AT5G22880) fusion combined with live staining with fluorescein diacetate (FDA) as described by Mnard et al. (2017) . Imaging were performed using Axiovert 200M microscope (Zeiss) equipped with Colibri5 LED illumination...”
• Construction and analysis of protein-protein interaction networks based on nuclear proteomics data of the desiccation-tolerant Xerophyta schlechteri leaves subjected to dehydration stress
  Shoko, Communicative & integrative biology 2023
  • “...their node degree distribution. Gene ID description Degree HSP812 Heat shock protein 812 [Source:UniProtKB/TrEMBL;Acc:F4K6B6] 29 AT5G22880 Histone H2B [Source:UniProtKB/TrEMBL;Acc:Q1H5F7] 26 HTA13 Probable histone H2A.2 [Source:UniProtKB/Swiss-Prot;Acc:Q9LHQ5] 24 HTA7 Histone H2A [Source:UniProtKB/TrEMBL;Acc:A0A178UFF2] 23 AT2G37470 Histone H2B.4 [Source:UniProtKB/Swiss-Prot;Acc:Q9ZUS0] 21 Table 2. Significantly enriched GO biological process terms from the...”
• Single nuclei sequencing reveals C₄photosynthesis is based on rewiring of ancestral cell identity networks
  Swift, 2023
• More
• Function of histone H2B monoubiquitination in transcriptional regulation of auxin biosynthesis in Arabidopsis.
  Zhang, Communications biology 2021
  • GeneRIF: Function of histone H2B monoubiquitination in transcriptional regulation of auxin biosynthesis in Arabidopsis.
• DET1-mediated degradation of a SAGA-like deubiquitination module controls H2Bub homeostasis.
  Nassrallah, eLife 2018
  • GeneRIF: DET1-DDB1-Associated-1 (DDA1) protein interacts with SGF11 in vivo, linking the DET1 complex to light-dependent ubiquitin-mediated proteolytic degradation of the deubiquitination module.
• Histone H2B monoubiquitination is involved in regulating the dynamics of microtubules during the defense response to Verticillium dahliae toxins in Arabidopsis.
  Hu, Plant physiology 2014
  • GeneRIF: These findings provide direct evidence for H2B monoubiquitination as an important modification with regulatory roles in the defense against Verticillium dahliae toxins.
• Monoubiquitination of histone 2B at the disease resistance gene locus regulates its expression and impacts immune responses in Arabidopsis.
  Zou, Plant physiology 2014
  • GeneRIF: H2B monoubiquitination at the R gene locus regulates its expression.
• Histone H2B deubiquitination is required for transcriptional activation of FLOWERING LOCUS C and for proper control of flowering in Arabidopsis.
  Schmitz, Plant physiology 2009
  • GeneRIF: Role of histone H2B deubiquitination in the activation of gene expression and the perturbation of histone H2B deubiquitination in the timing of the floral transition in Arabidopsis.
• Exogenous Auxin Elicits Changes in the Arabidopsis thaliana Root Proteome in a Time-Dependent Manner
  Slade, Proteomes 2017
  • “...secreted 0.224 n.s. AT4G28400 0.609 Q93YW5 Protein phosphatase 2C 58 (AtPP2C58) n.s. 2.361 AT5G22880 0.618 Q9FFC0 Histone H2B.10 (HTB2) n.s. 3.504 AT5G24165 0.537 Q8LDQ8 At5g24165 (uncharacterized protein) n.s. 0.244 AT5G48030 0.533 Q8GWW8 Chaperone protein dnaJ GFA2, mitochondrial 1.703 n.s. 1 Transcript fold change for seven-day old...”

P48557 Histone H2B from Holothuria tubulosa
71% identity, 42% coverage

• Quantitative proteomics identifies 38 proteins that are differentially expressed in cucumber in response to cucumber green mottle mosaic virus infection.
  Liu, Virology journal 2015
  • “...MF 5 P49296 Isocitrate lyase GO:0009060, GO:0043436 GO:0044262 BP 1.1 GO:0005777 CC GO:0016833 MF 6 P48557 Histone H2B GO:0034728 BP 1 GO:0000785, GO:0044444 GO:0043189 CC GO:0003676 MF 7 Q4VZI6 Cytochrome b6 GO:0051234, GO:0022900 BP 0.8 GO:0031224, GO:0009534 CC GO:0003824, GO:0009055 GO:0005506 MF 8 B8XX45 Actin isoform...”
  • “...of yield [ 2 ]. Two of the most significantly down-regulated proteins were histones (P62776, P48557). Histone acetylation is important in the activation of genes at the posttranslational level, and a previous study [ 67 ] has shown that histone acetyltransferase (AtHAC1) can regulate flowering time...”

A8JCT1 Histone H2B from Chlamydomonas reinhardtii
XP_001700194 uncharacterized protein from Chlamydomonas reinhardtii
75% identity, 42% coverage

• Quantitative proteomics of a B₁₂ -dependent alga grown in coculture with bacteria reveals metabolic tradeoffs required for mutualism
  Helliwell, The New phytologist 2018
  • “...phosphorylase 1.30 A8IZS5 Glycinerich RNAbinding protein 1.23 A8I0F5 ORC1 Origin recognition complex subunit 1 1.21 A8JCT1 HBV1 Histone H2B 1.77 A8HWY2 HTR14 Histone H3 (Fragment) 1.88 A8HVA3 HFO4 Histone H4 1.91 A8JIN9 HFO43 Histone H4 1.92 A8HRZ9 H2A Histone H2A 1.95 Transporters A8JGB0 Arsenite translocating ATPaselike...”
• An integrative analysis of post-translational histone modifications in the marine diatom Phaeodactylum tricornutum
  Veluchamy, Genome biology 2015
  • “...[H2B: Phaeodactylum tricornutum (XP_002179210), Thalassiosira pseudonana (XP_002290856), Saccharomyces cerevisiae (CAA81268), Arabidopsis thaliana (NP_180440), Chlamydomonas reinhardtii (XP_001700194), Drosophila melanogaster (NP_724342), Caenorhabditis elegans (NP_505464), Homo sapiens (NP_003510), Giardia intestinalis (ESU39253), Paramecium tetraurelia (XP_001428087), Leishmania infantum (XP_001470056), Dictyostelium discoideum (XP_628972)]; [H1: Drosophila melanogaster (NP_724341), Homo sapiens (NP_722575), Chlamydomonas reinhardtii...”

W5HA06 Histone H2B from Triticum aestivum
76% identity, 37% coverage

• Comprehensive profiling of lysine ubiquitome reveals diverse functions of lysine ubiquitination in common wheat
  Zhang, Scientific reports 2017
  • “...- auxin-responsive SAUR family member W5DZG1 Histone H2A W5E096 Rho guanine nucleotide exchange factor 6 W5HA06 Histone H2B.3 W5FB99 Phosphatase 2A isoform 2 (PP2Ac-2) W4ZWK0 Histone H2A K4MQ41 Calcium-dependent kinase W5A444 Histone H2B.2-like isoform 1 A0A0C4BJH4 14-3-3 GF14-D-like A0A096UKH0 Histone H2A.1 L0GDQ5 14-3-3 B W5GES9 Histone...”

XP_002290856 histone H2B from Thalassiosira pseudonana CCMP1335
78% identity, 42% coverage

• An integrative analysis of post-translational histone modifications in the marine diatom Phaeodactylum tricornutum
  Veluchamy, Genome biology 2015
  • “...Leishmania infantum (CAD11891), Dictyostelium discoideum (XP_636327), Giardia intestinalis (ESU37209)]; [H2B: Phaeodactylum tricornutum (XP_002179210), Thalassiosira pseudonana (XP_002290856), Saccharomyces cerevisiae (CAA81268), Arabidopsis thaliana (NP_180440), Chlamydomonas reinhardtii (XP_001700194), Drosophila melanogaster (NP_724342), Caenorhabditis elegans (NP_505464), Homo sapiens (NP_003510), Giardia intestinalis (ESU39253), Paramecium tetraurelia (XP_001428087), Leishmania infantum (XP_001470056), Dictyostelium discoideum (XP_628972)];...”

Q43217 Histone H2B.3 from Triticum aestivum
78% identity, 36% coverage

• Quantitative proteomics analysis reveals the tolerance of wheat to salt stress in response to Enterobacter cloacae SBP-8
  Singh, PloS one 2017
  • “...Q43206 Catalase 1 S59 0.677 1.568 0 Q43215 Histone H2B 4 S60 0.179 0 0.733 Q43217 Histone H2B 3 S61 0.453 0 0.733 Q43691 Trypsin alpha amylase inhibitor CMX2 S62 0.246 1.733 1.803 Q41558 Transcription factor HBP 1b c1 Fragment S63 2.095 0 0.600 Q5I7K9 60S...”

LOC100512420 LOW QUALITY PROTEIN: histone H2B type 1-K from Sus scrofa
76% identity, 40% coverage

• microRNA-4331 Promotes Transmissible Gastroenteritis Virus (TGEV)-induced Mitochondrial Damage Via Targeting RB1, Upregulating Interleukin-1 Receptor Accessory Protein (IL1RAP), and Activating p38 MAPK Pathway In Vitro
  Zhao, Molecular & cellular proteomics : MCP 2018
  • “...1.382 0.014635659 42 MAGED2 0.817 0.015630659 8 HELLS 1.322 0.009530397 43 PTPN12 0.817 0.00278265 9 LOC100512420 1.3185 0.029473603 44 PDLIM5 0.817 0.009683894 10 LOC100516293 1.3175 0.011026956 45 DDX54 0.813 0.022637134 11 SLC7A2 1.312 0.005947393 46 SNX5 0.812 0.001798921 12 HMGCS1 1.311 0.000560657 47 AHNAK 0.805 2.69598E-10...”

Q43261 Histone H2B.3 from Zea mays
75% identity, 33% coverage

• Peptidome and Transcriptome Analysis of Plant Peptides Involved in Bipolaris maydis Infection of Maize
  Sheng, Plants (Basel, Switzerland) 2023
  • “...B6SSH9 Extracellular ribonuclease LE (131142) 1964.053 0.65 AYPTSDVVIETHKEEEL P27787 Ferredoxin-1, chloroplastic (131147) 2418.28 1.32 LVLPGELAKHAVSEGTKAVTKFTSS Q43261 Histone H2B.3 * (214238) 3487.071 1.44 LVLFEHFGGDPSKISF A0A1D6JWI7 Beta-galactosidase, EC 3.2.1.23 (767782) 2251.253 1.42 LVLLEEFGGDLPGVKLVTRTA B6T0D0 Beta-galactosidase, EC 3.2.1.23 (703723) 2685.596 1.40 LVLLEEFGGDLPGVKLVT B6T0D0 Beta-galactosidase, EC 3.2.1.23 (703720) 2357.41 2.05...”

LOC100156127 LOW QUALITY PROTEIN: histone H2B type 1-M from Sus scrofa
73% identity, 41% coverage

• Transcriptomic Analysis of Porcine Endometrium during Implantation after In Vitro Stimulation by Adiponectin
  Smolinska, International journal of molecular sciences 2019
  • “...IFNGR2 , CHUK , IFNAR1 , SLA-8 , TRAF3 Viral carcinogenesis 14 1.90 10 2 LOC100156127 , KAT2B , UBE3A , STAT5A , NFKBIA , PMAIP1 , SLA-8 , CDKN1A , HNRNPK , EP300 , PIK3R5 , JAK3 , LOC100621389 , TRAF3 Insulin signalling pathway 13...”
  • “..., DGKH , INPP4A , PIP4K2A , INPP5B Systemic lupus erythematosus 7 9.80 10 2 LOC100156127 , LOC100157763 , LOC100158121 , ELANE , LOC100154071 , LOC100153329 , LOC100621389 Pertussis 6 7.50 10 2 AMCF-II , LY96 , IRF1 , CXCL8 , NOS2 , CASP1 NOD-like receptor...”

Q7GBK0 Histone H2B.7 from Oryza sativa subsp. japonica
78% identity, 33% coverage

• Global analysis of lysine acetylation suggests the involvement of protein acetylation in diverse biological processes in rice (Oryza sativa)
  Nallamilli, PloS one 2014
  • “...[Oryza sativa Japonica Group] CKLGSLG K(ac) PNEPSR k220 Q6AV27 Hypothetical protein QTGQQ K(ac) GGASRKAR k51 Q7GBK0 Histone H2B.7 LPAG K(ac) GE K(ac) GSGEGK k43, k46 Q94JJ4 Core histone H2A/H2B/H3/H4 domain containing LPAG K(ac) AE K(ac) GSGEGK k43, k46 Q0JQP0 Core histone H2A/H2B/H3/H4 domain containing KPAA K(ac)...”

Q94JJ4 Histone H2B.4 from Oryza sativa subsp. japonica
78% identity, 33% coverage

• Global analysis of lysine acetylation suggests the involvement of protein acetylation in diverse biological processes in rice (Oryza sativa)
  Nallamilli, PloS one 2014
  • “...protein QTGQQ K(ac) GGASRKAR k51 Q7GBK0 Histone H2B.7 LPAG K(ac) GE K(ac) GSGEGK k43, k46 Q94JJ4 Core histone H2A/H2B/H3/H4 domain containing LPAG K(ac) AE K(ac) GSGEGK k43, k46 Q0JQP0 Core histone H2A/H2B/H3/H4 domain containing KPAA K(ac) KPAEEEPAAEKAE K(ac) APAG K(ac) KPK k12, k26, k31 B8AV15 Hypothetical...”
  • “...In addition to these core histones, we found that three core histone H2A/H2B/H3/H4-domain containing proteins (Q94JJ4 (Histone H2B.4), Q6F362 (Histone H2B.9) and Q0JQP0 (Os01g0149400 protein)) were also acetylated. Transcription factors such as BHLH transcription factor, GATA zinc finger family protein, and basic helix-loop-helix DNA-binding protein are...”

A2WKS3 Histone H2B.10 from Oryza sativa subsp. indica
78% identity, 33% coverage

• BRHIS1 suppresses rice innate immunity through binding to monoubiquitinated H2A and H2B variants
  Li, EMBO reports 2015 (secret)

D3ZNH4 Histone H2B from Rattus norvegicus
75% identity, 29% coverage

• Oxidative Biochemistry Disbalance and Changes on Proteomic Profile in Salivary Glands of Rats Induced by Chronic Exposure to Methylmercury
  Bittencourt, Oxidative medicine and cellular longevity 2017
  • “...2 188.54 1.8 O88752 Epsilon 1 globin 2060.91 0.3 P11517 Hemoglobin subunit beta-2 2099.64 0.3 D3ZNH4 Histone H2B 3909.79 0.7 F1LQ08 Protein Car6 439.43 1.4 F1M6C2 Protein LOC103691939 193.93 1.7 E9PTY1 Protein Prol1 325.88 2.0 P08462 Submandibular gland secretory Glx-rich protein CB 944.25 1.3 D4A5P1 Uncharacterized...”

B4DR52 Histone H2B from Homo sapiens
75% identity, 31% coverage

• Quantitative proteomics by iTRAQ-PRM based reveals the new characterization for gout
  Chen, Proteome science 2021
  • “...-value AG/AHU P -value A0A0U1RRH7 Histone H2A 4.132 0.005 1.553 0.030 1.437 0.003 0.348 0.009 B4DR52 Histone H2B 4.206 <0.001 1.951 0.025 1.913 0.022 0.455 0.004 The Table 1 shows the fold-change and its P -value of histone H2A and histone H2B in four comparison groups....”
• Protective Effects of Cannabidiol on the Membrane Proteome of UVB-Irradiated Keratinocytes
  Atalay, Antioxidants (Basel, Switzerland) 2021
  • “...This also applied to DNA/RNA binding proteins such as RNA-binding motif protein (P381590), histone H2B (B4DR52), and histone H2A.Z (P0C0S5). According to the box plots ( Figure 5 ), the intra-group variations in protein expression from the CTR and CBD(48 h) groups were small (for protein...”
• Quantitative Acetylomics Revealed Acetylation-Mediated Molecular Pathway Network Changes in Human Nonfunctional Pituitary Neuroendocrine Tumors
  Wen, Frontiers in endocrinology 2021
  • “...Table1 ). Of them, histone H2A type 1 (P04908), histone H2A (A0A0U1RRH7), and histone H2B (B4DR52) were histone to constitute nucleosome, whose main molecular functions were DNA binding and protein heterodimerization. histone H2A type 1 (P04908) and histone H2A (A0A0U1RRH7) maintained the structure of chromatin and...”
  • “...PRL Prolactin AVEIEEQTK*R 152 1 103715667 Q5I0G2 PRL Growth hormone A1 AVEIEEQTK*R 153 1 5210000 B4DR52 Histone H2B HAVSEGTK*AVTK 117 1 B4DR52 Histone H2B HAVSEGTK*AVTK 117 1 47000000 B2RDW1 RPS30A Epididymis luminal protein 112 IQDK*EGIPPDQQR 33 1 B2RDW1 RPS30A Epididymis luminal protein 112 IQDK*EGIPPDQQR 33 1...”
• Counteracting the Ramifications of UVB Irradiation and Photoaging with Swietenia macrophylla King Seed
  Mahendra, Molecules (Basel, Switzerland) 2021
  • “...2-B (Q8IUE6) 1.00:2.75 () N/S 1.00:1.66 () N/S 1.00:0.56 () 41 Histone H2B (A8K9J7 or B4DR52) 1.00:2.86 () N/S N/S N/S 1.00:0.40 () 42 Histone H1.2 (P16403) N/S N/S 1.00:1.69 () 1.00:1.41 () 1.00:0.62 () 43 Histone H1.5 (P16401) N/S N/S 1.00:2.01 () N/S N/S 44...”
• Insulin-Like Growth Factor Binding Protein-3 Binds to Histone 3.
  Bhardwaj, International journal of molecular sciences 2021
  • “...wt.: 13.96 kDa, UniProtKB ID: P0C0S8), histone 2B (H2B; mol. wt.: 13.78 kDa, UniProtKB ID: B4DR52), histone 3 (H3; mol. wt.: 15 kDa, UniProtKB ID: P68431) and histone 4 (H4; mol. wt.: 11 kDa, UniProtKB ID: P62805) are known [ 34 , 35 ]. Of the...”
• Identification of lysine acetylome in cervical cancer by label-free quantitative proteomics
  Zhang, Cancer cell international 2020
  • “...1, H2bd A8K9J7 SAPAPK(ac)KGSKKAVTK LLLPGELAK(ac)HAVSEGTK Histone H2B type 1-B P33778 SAPAPK(ac)KGSKKAITK Histone cluster 2, H2bf B4DR52 SAPAPK(ac)KGSKKAVTK Histone H2B type 1-L Q99880 SAPAPK(ac)KGSKKAVTK Dihydropyrimidine dehydrogenase [NADP(+)] Q12882 EEK(ac)CEFLPFLSPR 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (Hydroxymethylglutaricaciduria), isoform CRA_b B1AK13 DGLQNEK(ac)NIVSTPVK cDNA FLJ58863, highly similar to Protein NipSnap3A B4DW81 SYYLKPSK(ac)MNEFLENFEK Annexin...”
• Quantitative Analysis of Ubiquitinated Proteins in Human Pituitary and Pituitary Adenoma Tissues
  Qian, Frontiers in endocrinology 2019
  • “...cDNA FLJ54371, highly similar to Serum albumin K*LVAASQAALGL 12 607 1 K*QTALVELVK 10 558 1 B4DR52 Histone H2B HAVSEGTK*AVTK 12 117 1 4.70E+07 B4E1J8 cDNA FLJ56285, highly similar to ADP-ribosylation factor-like protein 8B DLPNALDEK*QLIEK 14 193 1 B9EGU6 RC3H1 Ring finger and CCCH-type zinc finger domains...”
• Quantitative proteomic study of mitoxantrone-resistant NCI-H460 cell-xenograft tumors.
  Su, International journal of clinical and experimental pathology 2018
• More

AT5G02570 histone H2B, putative from Arabidopsis thaliana
75% identity, 39% coverage

• Advances in biological functions and mechanisms of histone variants in plants
  Wu, Frontiers in genetics 2023
  • “...AT3G09480 H2B.8 AT1G08170 Regulate seed development but not expressed in sperm cells H2B.9 AT3G45980 H2B.10 AT5G02570 H2B.11 AT3G46030 H3 H3.3 AT4G40030 HIRA Transcriptional activation Flowering time Zhao et al. (2021) ; Male Gametogenesis Ingouff et al. (2010) ; Cell proliferation and organogenesis Otero et al. (2016)...”
• Histone variants and modifications during abiotic stress response
  Nunez-Vazquez, Frontiers in plant science 2022
  • “...Regulation of seed formation ( Jiang etal., 2020a ) H2B.9 Variant At3g45980, HTB9 H2B.10 Variant At5g02570, HTB10 Development of reproductive tissues ( Jiang etal., 2020a ) H2B.11 Variant At3g46030, HTB11 H3 H3.1 Canonical At5g65360, HTR1 CAF1 Transcriptional repression ( Stroud etal., 2012 ; Wollmann etal., 2012...”
• Plant Histone HTB (H2B) Variants in Regulating Chromatin Structure and Function
  Khadka, Plants (Basel, Switzerland) 2020
  • “...(At3g45980), and HTB11 (At3g46030) and class II HTB5 (At2g37470), HTB6 (At3g53650), HTB7 (At3g09480), and HTB10 (At5g02570). Class I variants can be further divided into class I-A (H2B4, 9, and 11) and class I-B (HTB1, 2, and 3) and class II into class II-A (HTB7 and 10)...”
• De novo transcriptome assembly reveals high transcriptional complexity in Pisum sativum axillary buds and shows rapid changes in expression of diurnally regulated genes
  Kerr, BMC genomics 2017
  • “...carboxylesterase 15 comp34724_c0 AT4G30110 Cadmium/zinc-transporting ATPase HMA2 comp34931_c0 AT1G15760 Sterile alpha motif domain-containing protein comp35134_c1 AT5G02570 Histone h2b comp35188_c0 AT2G43460 60s ribosomal protein l38 comp35195_c0 AT3G62980 Protein TRANSPORT INHIBITOR RESPONSE 1 comp35285_c0 AT1G14450 NADH dehydrogenase comp35297_c0 AT4G26470 Calcium-binding protein CML21 comp35867_c0 AT2G16365 F-box protein comp36828_c0 AT3G48770...”
• Transcriptomic Analysis of Soil-Grown Arabidopsis thaliana Roots and Shoots in Response to a Drought Stress
  Rasheed, Frontiers in plant science 2016
  • “...32.84 0.96 0.93 5.70 85.41 At1g19890 HTR10/H3.10 1.15 1.12 0.94 1.02 1.02 1.41 2.03 2.69 At5g02570 HTB10/H2B.10 1.25 1.20 1.69 2.11 1.07 1.04 1.81 2.65 At1g51060 Histone H2A 10 1.08 0.89 0.51 0.26 1.00 0.82 0.51 0.31 At5g65350 Histone 3 11 0.45 0.50 0.40 0.45 0.57...”
• Rootstock-regulated gene expression patterns associated with fire blight resistance in apple
  Jensen, BMC genomics 2012
  • “...X X At5g17420 cellulose synthase, catalytic subunit (IRX3) identical to gi:5230423 5E-08 APPLE00R00017800 X X At5g02570 histone H2B, putative similar to histone H2B-2 Lycopersicon esculentum 2E-24 APPLE0F000016970 X At3g01090 Snf1-related protein kinase (KIN10) (SKIN10) 2E-14 APPLE0F000020273* X At5g56000 heat shock protein 81-4 (HSP81-4) APPLE0FR00077763 X No...”
• Dual binding of chromomethylase domains to H3K9me2-containing nucleosomes directs DNA methylation in plants
  Du, Cell 2012
  • “...At5g02560 5 2 7.8 262 3.6 HTA8 At2g38810 15 4 32.4 251 3.5 H2B 1 At5g02570 59 13 32.6 3675 50.8 At3g09480 H2B At2g37470 62 15 46.4 3610 49.9 H2B At3g53650 32 8 30.4 1863 25.7 At5g59910 At1g07790 H2B 1 At5g22880 79.6 16.6 42.2 4327 59.8...”
• A unified phylogeny-based nomenclature for histone variants
  Talbert, Epigenetics & chromatin 2012
  • “...HTB6 H2B.6 " At3g09480 HTB7 H2B.7 " At1g08170 HTB8 H2B.8 " At3g45980 HTB9 H2B.9 " At5g02570 HTB10 H2B.10 " At3g46030 HTB11 H2B.11 " H3 Gene Protein Former name At5g65360 HTR1 H3.1 H3.1 At1g09200 HTR2 " " At3g27360 HTR3 " " At5g10400 HTR9 " " At5g10390 HTR13...”
• More

Q2XPW1 Histone H2B from Solanum tuberosum
75% identity, 35% coverage

• Enhanced stress resilience in potato by deletion of Parakletos
  Zahid, Nature communications 2024
  • “...6.2 M1BDT7 NAD_Gly3P_dh_N 4.6 M0ZR27 Mitogen-activated protein kinase 2.5 M1B1N5 Chlorophyll a-b binding protein 2.4 Q2XPW1 Histone H2B 2.3 M1CN16 Transcription factor RF2b 2.2 M1D4R5 Hexose transporter 2.1 M1C8J8 3-oxoacyl-CoA synthase 2 M1BS09 Poly(RC)-binding protein 2 M0ZNA1 Pre-mRNA-splicing factor cwc23 1.9 Functional test of candidate proteins...”

4nftD / P0C0S5,Q16778 Crystal structure of human lnkh2b-h2a.Z-anp32e (see paper)
75% identity, 29% coverage

• Ligand: peptide (4nftD)

LOC112166341 histone H2B from Rosa chinensis
75% identity, 35% coverage

• Loss of Rose Fragrance under Chilling Stress Is Associated with Changes in DNA Methylation and Volatile Biosynthesis
  Xie, Genes 2023
  • “...chilling stress via RT-qPCR ( Figure 6 AC). However, the histone H2B gene (gene ID: LOC112166341) and aquaporin PIP2-7 gene (gene ID: LOC112173307) were significantly downregulated during the chilling response ( Figure 6 D,E). We next evaluated the expression of genes encoding enzymes associated with the...”

8uq9a / P04908,P61077,Q16778,Q8IYW5 Crystal structure of rnf168 (ring)-ubch5c fused to h2a-h2b via a 4- residue linker (see paper)
75% identity, 12% coverage

• Ligand: zinc ion (8uq9a)

LOC107775690 histone H2B-like from Nicotiana tabacum
75% identity, 35% coverage

• Identification of Host Factors Interacting with Movement Proteins of the 30K Family in <i>Nicotiana tabacum</i>
  Villar-Álvarez, International journal of molecular sciences 2024
  • “...and the potential biological significance of the interaction. The selected proteins were histone 2B (H2B, LOC107775690), actin (Act, LOC107831313), 14-3-3A (LOC107765116), eukaryotic initiation factor 4A (eIF4A, LOC107764101), and peroxidase (POX, LOC107808758). Bimolecular fluorescence complementation (BiFC) experiments were conducted between the AMV MP and the five candidate...”
  • “...MPs from AMV (AAA46295.1); TMV (NP_597748); CPMV (CAA25315.1); CMV (BAA01396.1); CaMV (CAA23456.1); N. tabacum H2B-like (LOC107775690, hereinafter referred to as H2B only); actin (LOC107831313); peroxidase (LOC107808758); eIF4A (LOC107764101); and 14-3-3A (LOC107765116) were fused with the pSK plasmids described above to obtain the 4 possible combinations. The...”

AT3G09480 histone H2B, putative from Arabidopsis thaliana
75% identity, 40% coverage

• Advances in biological functions and mechanisms of histone variants in plants
  Wu, Frontiers in genetics 2023
  • “...AT1G07790 NAP1 NRP1 FACT H2B.2 AT5G22880 H2B.3 AT2G28720 H2B.4 AT5G59910 H2B.5 AT2G37470 H2B.6 AT3G53650 H2B.7 AT3G09480 H2B.8 AT1G08170 Regulate seed development but not expressed in sperm cells H2B.9 AT3G45980 H2B.10 AT5G02570 H2B.11 AT3G46030 H3 H3.3 AT4G40030 HIRA Transcriptional activation Flowering time Zhao et al. (2021) ;...”
• Histone variants and modifications during abiotic stress response
  Nunez-Vazquez, Frontiers in plant science 2022
  • “...HTB3 H2B.4 Variant At5g59910, HTB4 H2B.5 Variant At2g37470, HTB5 H2B.6 Variant At3g53650, HTB6 H2B.7 Variant At3g09480, HTB7 Development of reproductive tissues ( Jiang etal., 2020a ) H2B.8/H2B.S Variant At1g08170, HTB8 Regulation of seed formation ( Jiang etal., 2020a ) H2B.9 Variant At3g45980, HTB9 H2B.10 Variant At5g02570,...”
• Plant Histone HTB (H2B) Variants in Regulating Chromatin Structure and Function
  Khadka, Plants (Basel, Switzerland) 2020
  • “...HTB4 (At5g59910), HTB9 (At3g45980), and HTB11 (At3g46030) and class II HTB5 (At2g37470), HTB6 (At3g53650), HTB7 (At3g09480), and HTB10 (At5g02570). Class I variants can be further divided into class I-A (H2B4, 9, and 11) and class I-B (HTB1, 2, and 3) and class II into class II-A...”
• PLATINUM SENSITIVE 2 LIKE impacts growth, root morphology, seed set, and stress responses
  Kataya, PloS one 2017
  • “...Mitochondrial substrate carrier family protein -4.05 -5.61 Nucleus AT1G13370 AT1G13370 Putative histone H3 17.65 4.89 AT3G09480 AT3G09480 Putative histone H2B 9.80 4.01 AT3G53730 AT3G53730 Histone superfamily protein with H4-site 7.14 3.26 AT3G45930 AT3G45930 Histone superfamily protein with H4-site 4.64 3.04 AT5G10980 HTR8 Histone H3.3, HTR8 4.43...”
  • “...by hormones. Most striking was a group of 8 histones, all up-regulated (At1g13370, At2g28720, At2g28740, At3g09480, At3g45930, At3g46320, At3g53730, At5g10980). Most were highly up-regulated, e.g. 417 times ( Table 2 ). The physiological significance of this up-regulation is not clear, but changes in histone composition are...”
• Proteome distribution between nucleoplasm and nucleolus and its relation to ribosome biogenesis in Arabidopsis thaliana
  Palm, RNA biology 2016
  • “...AT5G22880 AT5G03740 AT2G27840 AT3G44750 AT1G01370 AT5G59870 AT5G27670 AT5G56740 AT3G09480 AT1G21970 AT5G22650 AT1G09200 Modification CYT NUC NOC X X X X X X X X...”
• The Potato Nucleotide-binding Leucine-rich Repeat (NLR) Immune Receptor Rx1 Is a Pathogen-dependent DNA-deforming Protein
  Fenyk, The Journal of biological chemistry 2015
  • “...A PCR product corresponding to amino acids 1126 of histone H2B of Arabidopsis thaliana (locus AT3G09480) was subcloned into the Gateway entry vector pDONR207 via BP recombinant reaction and transferred via LR reaction into the plant binary vector pK7WGF2 (pK7WGF2-H2B) to fuse the open reading frame...”
• Dual binding of chromomethylase domains to H3K9me2-containing nucleosomes directs DNA methylation in plants
  Du, Cell 2012
  • “...HTA8 At2g38810 15 4 32.4 251 3.5 H2B 1 At5g02570 59 13 32.6 3675 50.8 At3g09480 H2B At2g37470 62 15 46.4 3610 49.9 H2B At3g53650 32 8 30.4 1863 25.7 At5g59910 At1g07790 H2B 1 At5g22880 79.6 16.6 42.2 4327 59.8 At3g45980 At3g46030 At5g10400 At1g09200 H3 1...”
• A unified phylogeny-based nomenclature for histone variants
  Talbert, Epigenetics & chromatin 2012
  • “...HTB3 H2B.3 " At5g59910 HTB4 H2B.4 " At2g37470 HTB5 H2B.5 " At3g53650 HTB6 H2B.6 " At3g09480 HTB7 H2B.7 " At1g08170 HTB8 H2B.8 " At3g45980 HTB9 H2B.9 " At5g02570 HTB10 H2B.10 " At3g46030 HTB11 H2B.11 " H3 Gene Protein Former name At5g65360 HTR1 H3.1 H3.1 At1g09200 HTR2...”
• More

TP04_0404, TpMuguga_04g00404 Histone H2B.1 from Theileria parva strain Muguga
76% identity, 46% coverage

• Immunopeptidomic Analysis of BoLA-I and BoLA-DR Presented Peptides from Theileria parva Infected Cells
  Connelley, Vaccines 2022
  • “...7.44 TpMuguga_04g00227 hypothetical protein 1403 1411 ND VKKRVHKGKKKARSETYSTYIF 28.5 22 1011TP 1 3:00201 KARSETYSTYIF 96.88 TpMuguga_04g00404 histone H2B-III, putative 2 23 ND ENKLVEEALK 34.4 10 641TP 2 6:01301 ENKLVEEAL 50.94 TpMuguga_04g00505 hypothetical protein 99 108 ND KLLYVLKPFI 22.1 10 641TP 2 6:01301 KLLYVLKPFI 4.10 TpMuguga_04g00611 hypothetical...”
  • “...ribosomal protein S19, putative 121 129 Positive NSFVTDTFEKL 43.5 11 1011TP 1 3:00201 NSFVTDTFEKL 1.68 TpMuguga_04g00404 histone H2B-III, putative 44 54 Positive SETYSTYIFKVLK 47.8 13 1011TP 2 2:01201 SETYSTYIFKVLK 3.65 TpMuguga_04g00404 histone H2B-III, putative 15 27 Positive RLFNFATKRI 37.6 10 641TP 1 6:01301 RLFNFATKRI 2.32 TpMuguga_04g00503...”
• Comparative Transcriptomics of the Bovine Apicomplexan Parasite Theileria parva Developmental Stages Reveals Massive Gene Expression Variation and Potential Vaccine Antigens
  Atchou, Frontiers in veterinary science 2020
  • “...SP. The five most highly expressed genes occurred in the schizont stage, namely TP04_0321, TP04_0322, TP04_0404, TP04_0675, and TP04_0677, all of which encode histone proteins. However, most of the 20 most highly expressed genes were preferentially expressed in the piroplasm stage rather than in the schizont....”
  • “...XM_758863.1 TP04_0321 69,380 145 Histone H3 (-) XM_758864.1 TP04_0322 55,504 1,307 Histone H2A (-) XM_758946.1 TP04_0404 51,621 1,830 Histone H2B-III (-) XM_759218.1 TP04_0675 48,611 831 Histone H4 (-) XM_759220.1 TP04_0677 48,611 831 Histone H4 (-) XM_760801.1 TP01_0367 13 39,381 Hypothetical protein SP, GPI XM_758723.1 TP04_0181 255...”
• Characterization of the Theileria parva sporozoite proteome
  Nyagwange, International journal for parasitology 2018
  • “...antigens are in bold face. ORF locus tag a Annotation b Mass (Da) emPAI c TpMuguga_04g00404 Histone H2B.1 12,040 7228.34 TpMuguga_04g00071 Histone H2B 13,682 900.39 TpMuguga_04g00675 Histone H4 11,362 457.35 TpMuguga_04g00690 Phosphoglycerate mutase 1 family 29,221 105.17 TpMuguga_04g00050 Ribosomal protein S19 17,150 99.38 TpMuguga_03g00655 Hypothetical protein...”

Q1SU99 Probable histone H2B.3 from Medicago truncatula
75% identity, 37% coverage

• An iTRAQ-based proteomics approach to clarify the molecular physiology of somatic embryo development in Prince Rupprecht's larch (Larix principis-rupprechtii Mayr)
  Zhao, PloS one 2015
  • “...0.805 3 Nucleosome assembly Histone H2B (Fragments) Q99285 1 0.575 10.349 2 Probable histone H2B.3 Q1SU99 1 0.788 10.605 2 Histone H4 variant TH011 P62785 1 1.089 1.873 4 Histone H3 A9NMA0 1 1.255 2.463 4 Histone H2A (Fragment) K7NMH3 1 0.359 7.194 2 Histone H4...”

H2BFS_HUMAN / P57053 Histone H2B type F-S; H2B-clustered histone 12 like; H2B.S histone 1; Histone H2B.s; H2B/s from Homo sapiens (Human) (see 6 papers)
NP_059141 histone H2B type F-S from Homo sapiens
73% identity, 41% coverage

• function: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
  function: Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid
  subunit: The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA
• Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
  Warnatz, Nucleic acids research 2010
  • GeneRIF: The H2BFS promoter is activated by serum depletion according to promoter reporter assays in HEK 293 cells.
• Proteomic analysis reveals changes in the proteome of human THP-1 macrophages infected with <i>Paracoccidioides brasiliensis</i>
  de, Frontiers in cellular and infection microbiology 2023
  • “...* Q5QNW6 Histone H2B type 2-F 16807.41 * Q8N257 Histone H2B type 3-B 17593.68 * P57053 Histone H2B type F-S 16800.03 * Q6NXT2 Histone H3.3C 3853.37 * P62805 Histone H4 7844.59 * P05107 Integrin beta-2 2518.87 * P33241 Lymphocyte-specific protein 1 820.58 * P14174 Macrophage migration...”
• β-Lapachone Exerts Anticancer Effects by Downregulating p53, Lys-Acetylated Proteins, TrkA, p38 MAPK, SOD1, Caspase-2, CD44 and NPM in Oxaliplatin-Resistant HCT116 Colorectal Cancer Cells.
  Jung, International journal of molecular sciences 2023
  • “...SOD1 Superoxide dismutase [Cu-Zn] 4.460 P00441 H2BS1 Histone H2B (Acetyl-Lys15) Histone H2B type F-S 3.147 P57053 CALR Calreticulin Calreticulin 3.017 P27797 MAPK11 MAPK 11 Mitogen-activated protein kinase 11 2.925 Q15759 CASP2 CASP2 (p18, Cleaved-Thr325) Caspase-2 2.518 P42575 CDH9 CDH9 Cadherin-9 2.434 Q9ULB4 MMP23B MMP23 (Cleaved-Tyr79) Matrix...”
• Secretome profiling of Artemisia absinthium extract-loaded polymeric nanoparticle-treated MCF-7 and MDA-MB-231 revealed perturbation in microtubule assembly and cell migration.
  Kauser, Frontiers in oncology 2023
  • “...factor 1-alpha 1 EEF1A1 0.669922678 0.5779335 Q5VTE0 Putative elongation factor 1-alpha-like 3 EEF1A1P5 0.669922678 0.5779335 P57053 Histone H2B type F-S H2BFS 1.483903394 0.56939717 P23527 Histone H2B type 1-O HIST1H2BO 1.483903394 0.56939717 P06899 Histone H2B type 1-J HIST1H2BJ 1.483903394 0.56939717 Q5QNW6 Histone H2B type 2-F HIST2H2BF 1.483903394...”
  • “...P07437 Tubulin beta chain TUBB 0.26677046 1.9063292 Q9UK55 Protein Z-dependent protease inhibitor SERPINA10 0.297543726 1.7488264 P57053 Histone H2B type F-S H2BFS 0.323611545 1.627665 P23527 Histone H2B type 1-O HIST1H2BO 0.323611545 1.627665 P06899 Histone H2B type 1-J HIST1H2BJ 0.323611545 1.627665 Q5QNW6 Histone H2B type 2-F HIST2H2BF 0.323611545...”
• Towards the Definition of the Molecular Hallmarks of Idiopathic Membranous Nephropathy in Serum Proteome: A DIA-PASEF Approach.
  Previtali, International journal of molecular sciences 2023
  • “...type 1-J; Histone H2A.J 0.3 H2B1K_HUMAN; H2BFS_HUMAN; H2B1D_HUMAN; H2B1C_HUMAN; H2B2F_HUMAN; H2B1H_HUMAN; H2B1N_HUMAN; H2B1M_HUMAN; H2B1L_HUMAN O60814; P57053; P58876; P62807; Q5QNW6; Q93079; Q99877; Q99879; Q99880 H2BC12; H2BC12L; H2BC5; H2BC4; H2BC18; H2BC9; H2BC15; H2BC14; H2BC13 Histone H2B type 1-K; Histone H2B type F-S; Histone H2B type 1-D; Histone H2B...”
• Unraveling molecular characteristic of fluoride neurotoxicity on U87 glial-like cells: insights from transcriptomic and proteomic approach.
  Puty, Frontiers in cellular neuroscience 2023
  • “...type 2-F + 489.46 + 489.46 Q8N257 Histone H2B type 3-B + 458,83 + 458.83 P57053 Histone H2B type F-S + 489.46 + 489.46 P00338 L-lactate dehydrogenase A chain + 412.77 + 412.77 P41219 Peripherin + 15.8 + 15.8 P00558 Phosphoglycerate kinase 1 + 122.95 +...”
• 6-Hydroxydopamine Induces Neurodegeneration in Terminally Differentiated SH-SY5Y Neuroblastoma Cells via Enrichment of the Nucleosomal Degradation Pathway: a Global Proteomics Approach
  Magalingam, Journal of molecular neuroscience : MN 2022
  • “...P27797 Calreticulin CALR 96,284 4.01E-03 0.099 O60814 Histone H2B type 1-K HIST1H2BK 27,780 1.19E-02 0.094 P57053 Histone H2B type F-S H2BFS 27,888 1.19E-02 0.094 P58876 Histone H2B type 1-D HIST1H2BD 27,872 1.19E-02 0.094 P62807 Histone H2B type 1-C/E/F/G/I HIST1H2BC 27,812 1.19E-02 0.094 Q5QNW6 Histone H2B type...”
• Unravelling the neuroprotective mechanisms of carotenes in differentiated human neural cells: Biochemical and proteomic approaches
  Magalingam, Food chemistry. Molecular sciences 2022
  • “...A5 ANXA5 71,874 6.85E-03 1.252 P25705 ATP synthase subunit alpha mitochondrial ATP5F1A 119,502 5.29E-03 1.240 P57053 Histone H2B type F-S H2BFS 27,888 7.78E-03 1.233 P14625 Endoplasmin HSP90B1 184,938 4.45E-02 1.228 P0DP25 Calmodulin-3 CALM3 33,676 5.93E-03 1.208 Q16555 Dihydropyrimidinase-related protein 2 DPYSL2 124,588 2.02E-02 1.198 P06899 Histone...”
• Snapshot imprinting as a tool for surface mapping and identification of novel biomarkers of senescent cells.
  Piletska, Nanoscale advances 2022
  • “...0.1 O60814; P06899; P23527; P33778; P58876; P62807; P62808; Q16778; Q2M2T1; Q32L48; Q5QNW6; Q93079; Q99877; Q99879; P57053; Q96A08; Q99880; Q8N257 Histone H2B type 1-B 19 15.2 1.7 1.1 The cell division cycle 7-related protein kinase (CDC7) is a serine/threonine kinase that phosphorylates minichromosome maintenance protein 2 (MCM2)...”
• More

M1AG69 Histone H2B from Solanum tuberosum
75% identity, 35% coverage

• Comparative proteomics of three Chinese potato cultivars to improve understanding of potato molecular response to late blight disease
  Xiao, BMC genomics 2020
  • “...0.00 1.77 0.00 M1LA62 Kunitz-type protease inhibitor D (Fragment) 0.74 0.00 1.95 0.00 1.21 0.00 M1AG69 Histone H2B 0.78 0.00 1.30 0.00 1.27 0.00 Q8H1X5 Allene oxide cyclase 0.83 0.00 0.79 0.00 1.20 0.00 M1D768 Uncharacterized protein 0.64 0.00 0.68 0.00 1.34 0.00 M1D478 Uncharacterized protein...”
  • “...inhibitor (P01052), Kunitz-type protease inhibitor KTI (M1LA62), abscisic stress/wound-induced protein DS2 (Q8H0L9), and Histone H2B (M1AG69), were up-regulated in MA-Phy but repressed in FA-Phy. At the same time, chymotrypsin inhibitor, and DS2 protein were down-regulated in E14-Phy. Here, our result showed that the abundance of protease...”

A2WKT1 Histone H2B.6 from Oryza sativa subsp. indica
75% identity, 33% coverage

• BRHIS1 suppresses rice innate immunity through binding to monoubiquitinated H2A and H2B variants
  Li, EMBO reports 2015 (secret)

Q9LGH8 Histone H2B.8 from Oryza sativa subsp. japonica
75% identity, 33% coverage

• Proteome-Wide Analyses Reveal the Diverse Functions of Lysine 2-Hydroxyisobutyrylation in Oryza sativa
  Xue, Rice (New York, N.Y.) 2020
  • “...variant 2 2.6074 Q8S857 13 GLLAAK(1)TTAAK H2A variant 2 1.4744 Q84NJ4 14 AIGSSAAK(1)K H2A.3 0.70687 Q9LGH8 67 SVETYK(1)IYIFK H2B.8 1.4873 Q9LGH8 75 VLK(1)QVHPDIGISSK H2B.8 0.13234 Q9LGH8 61 K(1)SVETYK H2B.8 0.61662 Q9LGH8 108 LAGESAK(1)LAR H2B.8 0.77039 Q9LGH8 26 AEK(1)APAGK H2B.8 0.76614 Q9LGH8 137 LVLPGELAK(1)HAVSEGTK H2B.8 0.78709 Q9LGH8...”
• BRHIS1 suppresses rice innate immunity through binding to monoubiquitinated H2A and H2B variants
  Li, EMBO reports 2015 (secret)

X1WDH8 Histone H2B from Danio rerio
75% identity, 42% coverage

• Tracking genome-editing and associated molecular perturbations by SWATH mass spectrometry
  Lin, Scientific reports 2019
  • “...most highly under-expressed proteins in the mvp sq33/sq33 mutant (aside from MVP itself) was Histone2b (X1WDH8; Fig. 2C ), a component of the nucleosome and not known to have any interaction with MVP. Upon further investigation, we determined that this mutant harboured a missense single-nucleotide polymorphism...”
  • “...with cut-off criteria of fold change >1.5 and fold change confidence >0.7. The Histone H2b (X1WDH8) protein showed the largest extent of under-expression in the mvp sq33/sq33 mutant. ( d ) Representative extracted ion chromatograms (XICs) of canonical H2b peptide (IAGEASCLAHY) in wild type and mvp...”

TGME49_051870, TGME49_251870 histone H2Bb from Toxoplasma gondii ME49
76% identity, 43% coverage

• Canonical histone H2Ba and H2A.X dimerize in an opposite genomic localization to H2A.Z/H2B.Z dimers in Toxoplasma gondii
  Bogado, Molecular and biochemical parasitology 2014
  • “...anti-rH2Ba antibody is highly specific for rH2Ba ( Fig 1B ). Since, H2Ba and H2Bb (TGME49_251870) share a 99% of identity at amino acid level, it is highly probable that the anti-rH2Ba antibody recognizes both histones, being an anti-canonical H2B antibody. However, only h2ba could be...”
• The histone code of Toxoplasma gondii comprises conserved and unique posttranslational modifications
  Nardelli, mBio 2013
  • “..., TGME49_061250; P.falciparum , PFF0860c; H.sapiens , AAN59974.1), and H2B ( T.gondii , TGME49_105160 and TGME49_051870; P.falciparum , PF11_0062; H.sapiens , CAA41051.1; and S.cerevisiae , CAA81268.1). S.cerevisiae does not have a canonical H3 or H2A. Instead S. cerevisiae H3 (ScH3) and ScH2A more closely resemble H3.3...”
• Extensive lysine acetylation occurs in evolutionarily conserved metabolic pathways and parasite-specific functions during Plasmodium falciparum intraerythrocytic development
  Miao, Molecular microbiology 2013
  • “...H2A variant, putative (H2A.Z) TGME49_100200 histone H2A PF07_0054 histone H2B variant, putative (H2Bv) TGME49_009910; TGME49_105160; TGME49_051870 histone H2B variant 1; histone H2B, putative; histone H2B, putative PFF0510w histone H3 (H3) TGME49_061240 histone H3 PFF0865w histone H3 variant, putative (H3.3) TGME49_018260 histone H3.3 variant PF11_0061 histone H4...”
• Chromatin modifications, epigenetics, and how protozoan parasites regulate their lives
  Croken, Trends in parasitology 2012
  • “...not found H2B-A CAA41051.1 CAA81268.1 Tb927.10.10460 TGME49_105160 PF11_0062 H2B-B NA d NA d NA d TGME49_051870 NA d H2Bv parasite specific parasite specific Tb11.02.5250 TGME49_009910 PF07_0054 H3V parasite specific parasite specific Tb927.10.15350 not found not found a Only one copy of each of the canonical histones...”

A8K9J7 Histone H2B from Homo sapiens
73% identity, 41% coverage

• iTRAQ and PRM-Based Proteomic Analysis Provides New Insights into Mechanisms of Response to Triple Therapy in Patients with Rheumatoid Arthritis
  Chen, Journal of inflammation research 2021
  • “...Q02985 CFHR3 teinComplement factor H-related pro3 0.640014 0.034661 P00558 PGK1 Phosphoglycerate kinase 1 0.646196 0.038779 A8K9J7 N/A Histone H2B 0.649774 0.041328 B2MUD5 ELA2 Neutrophil elastase (Fragment) 0.652207 0.043133 [ 28 ] P07737 PFN1 Profilin-1 0.657025 0.046881 Notes : a Fold change (14 week /0 weeks.). *13...”
• Counteracting the Ramifications of UVB Irradiation and Photoaging with Swietenia macrophylla King Seed
  Mahendra, Molecules (Basel, Switzerland) 2021
  • “...H2A type 2-B (Q8IUE6) 1.00:2.75 () N/S 1.00:1.66 () N/S 1.00:0.56 () 41 Histone H2B (A8K9J7 or B4DR52) 1.00:2.86 () N/S N/S N/S 1.00:0.40 () 42 Histone H1.2 (P16403) N/S N/S 1.00:1.69 () 1.00:1.41 () 1.00:0.62 () 43 Histone H1.5 (P16401) N/S N/S 1.00:2.01 () N/S...”
• Identification of lysine acetylome in cervical cancer by label-free quantitative proteomics
  Zhang, Cancer cell international 2020
  • “...FLJ55438, highly similar to Splicing factor 3 subunit 1 B4E091 TDIFGVEETAIGK(ac)K Histone cluster 1, H2bd A8K9J7 SAPAPK(ac)KGSKKAVTK LLLPGELAK(ac)HAVSEGTK Histone H2B type 1-B P33778 SAPAPK(ac)KGSKKAITK Histone cluster 2, H2bf B4DR52 SAPAPK(ac)KGSKKAVTK Histone H2B type 1-L Q99880 SAPAPK(ac)KGSKKAVTK Dihydropyrimidine dehydrogenase [NADP(+)] Q12882 EEK(ac)CEFLPFLSPR 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (Hydroxymethylglutaricaciduria), isoform...”
• Identification of Candidate Biomarkers in Malignant Ascites from Patients with Hepatocellular Carcinoma by iTRAQ-Based Quantitative Proteomic Analysis.
  Zhang, BioMed research international 2018
  • “...Q6MZU6 DKFZp686C15213 2.21 3984 A2MYE1 VACWR153(A30 protein) 1.55 493 A2J1N3 Rheumatoid factor RF-IP20 2.72 332 A8K9J7 H2B(Histone H2B) 1.97 121 H6VRF8 KRT1(Keratin-1) 1.88 110 B0AZL7 cDNAFLJ79457(highly similar to Insulin-like growth factor-binding protein) 1.66 62 A0N8J1 V(k)3 sequence of NG9 gene from fetal liver DNA 1.52 57...”
• Proteome and peptidome of human acquired enamel pellicle on deciduous teeth
  Zimmerman, International journal of molecular sciences 2013
  • “...f , h , l E5RG22 Hemofiltrate peptide HF7665 (Fragment) b , h , m A8K9J7 Histone H2B g , k , m H0Y3I2 Lactoperoxidase a , b , c , e , i , n , q P05164 Myeloperoxidase a , b , c ,...”

P35067 Histone H2B from Acropora formosa
71% identity, 42% coverage

• Proteomic analysis of bleached and unbleached Acropora palmata, a threatened coral species of the Caribbean
  Ricaurte, Marine pollution bulletin 2016
  • “...9. 06 67. 57 2 6 8 0.3 2 0.46 2.43 4 RecName: Full=Histone H2B P35067. 1 Choline dehydro genase activity. 10 .4 3 13. 8 8 7 1 0.1 5 0.21 2.40 5 Activin 1 protein [Acropora digitifera] BAQ190 91.1 Transfer ase activity, oxidative stress....”
• Biomineralization toolkit: the importance of sample cleaning prior to the characterization of biomineral proteomes
  Ramos-Silva, Proceedings of the National Academy of Sciences of the United States of America 2013

Q0D2M2 HIST1H2BC protein from Homo sapiens
73% identity, 41% coverage

• Collagen type V a2 (COL5A2) is decreased in steroid-induced necrosis of the femoral head
  Yang, American journal of translational research 2018 (secret)

LOC110024163 histone H2B.1-like from Phalaenopsis equestris
73% identity, 28% coverage