PaperBLAST – Find papers about a protein or its homologs

 

PaperBLAST Hits for VIMSS3615187 (387 a.a., MSHDLSQLRK...)

Found 250 similar proteins in the literature:

PA1991 probable iron-containing alcohol dehydrogenase (NCBI) from Pseudomonas aeruginosa PAO1 (90% identity, 100% coverage)

PP2682 alcohol dehydrogenase, iron-containing (NCBI ptt file) from Pseudomonas putida KT2440 (90% identity, 100% coverage)

DVU2545 alcohol dehydrogenase, iron-containing (TIGR) from Desulfovibrio vulgaris Hildenborough (52% identity, 98% coverage)

MSMEG_6239 1,3-propanediol dehydrogenase (NCBI) from Mycobacterium smegmatis str. MC2 155 (43% identity, 96% coverage)

Pcar_0257 alcohol dehydrogenase, class IV (NCBI) from Pelobacter carbinolicus str. DSM 2380 (41% identity, 98% coverage)

Csac_0407 Alcohol dehydrogenase (RefSeq) from Caldicellulosiruptor saccharolyticus DSM 8903 (40% identity, 99% coverage)

Pcar_2847 alcohol dehydrogenase, class IV (NCBI) from Pelobacter carbinolicus str. DSM 2380 (41% identity, 98% coverage)

SO1490 alcohol dehydrogenase II (NCBI ptt file) from Shewanella oneidensis MR-1 (41% identity, 98% coverage)

AOLE_06670 putative alcohol dehydrogenase (NCBI) from Acinetobacter sp. DR1 (39% identity, 98% coverage)

CV_2728 alcohol dehydrogenase from Chromobacterium violaceum ATCC 12472 (41% identity, 97% coverage)

VV2_0019 alcohol dehydrogenase (NCBI) from Vibrio vulnificus CMCP6 (38% identity, 97% coverage)

Pcar_1594 alcohol dehydrogenase, class IV (NCBI) from Pelobacter carbinolicus str. DSM 2380 (41% identity, 97% coverage)

Pcar_0251 alcohol dehydrogenase, class IV (NCBI) from Pelobacter carbinolicus str. DSM 2380 (40% identity, 97% coverage)

RPA1205 putative alcohol dehydrogenase (NCBI) from Rhodopseudomonas palustris CGA009 (39% identity, 97% coverage)

Pcar_0255 alcohol dehydrogenase, class IV (NCBI) from Pelobacter carbinolicus str. DSM 2380 (40% identity, 97% coverage)

NT01EI_0882 1,3-propanediol dehydrogenase (RefSeq) from Edwardsiella ictaluri 93-146 (40% identity, 97% coverage)

Dde_3523 alcohol dehydrogenase (NCBI) from Desulfovibrio desulfuricans G20 (39% identity, 96% coverage)

HMPREF0535_1267, WP_011953356 1,3-propanediol dehydrogenase from Lactobacillus reuteri MM2-3 (39% identity, 96% coverage)

DVU2405, ORF02977 alcohol dehydrogenase, iron-containing (TIGR) from Desulfovibrio vulgaris Hildenborough (40% identity, 97% coverage)

YP_005228921 1,3-propanediol oxidoreductase from Klebsiella pneumoniae subsp. pneumoniae HS11286 (36% identity, 98% coverage)

ETAE_0770 putative alcohol dehydrogenase (RefSeq) from Edwardsiella tarda EIB202 (40% identity, 97% coverage)

PBPRA2519 putative alcohol dehydrogenase (NCBI) from Photobacterium profundum SS9 (37% identity, 97% coverage)

VPA0566 alcohol dehydrogenase (NCBI ptt file) from Vibrio parahaemolyticus RIMD 2210633 (37% identity, 97% coverage)

ZMO1596 putative alcohol dehydrogenase (VIMSS) from Zymomonas mobilis subsp. mobilis ZM4 (ORNL) (39% identity, 90% coverage)

SOV_1c02190 alcohol dehydrogenase from Sporomusa ovata DSM 2662 (37% identity, 97% coverage)

Pcar_2510 1,3-propanediol dehydrogenase (NCBI) from Pelobacter carbinolicus str. DSM 2380 (39% identity, 98% coverage)

Asuc_0403 iron-containing alcohol dehydrogenase (RefSeq) from Actinobacillus succinogenes 130Z (38% identity, 97% coverage)

L910_2070 alcohol dehydrogenase from Vibrio fluvialis PG41 (37% identity, 97% coverage)

SF5M90T_3856 L-threonine dehydrogenase from Shigella flexneri 5a str. M90T (38% identity, 97% coverage)

E2348C_3839 predicted Fe-containing alcohol dehydrogenase (RefSeq) from Escherichia coli O127:H6 str. E2348/69 (38% identity, 97% coverage)

Z5010 putative oxidoreductase (NCBI ptt file) from Escherichia coli O157:H7 EDL933 (38% identity, 97% coverage)

b3589 / YiaY L-threonine dehydrogenase from Escherichia coli K-12 (38% identity, 97% coverage) (see 4 papers)
b3589 predicted Fe-containing alcohol dehydrogenase (NCBI) from Escherichia coli str. K-12 substr. MG1655

Q09669 Alcohol dehydrogenase 4; EC 1.1.1.1; Alcohol dehydrogenase IV from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (40% identity, 88% coverage) (see paper)
SPAC5H10.06c alcohol dehydrogenase Adh4 (RefSeq) from Schizosaccharomyces pombe

Halsa_0672 iron-containing alcohol dehydrogenase (NCBI) from Halanaerobium hydrogeniformans (38% identity, 98% coverage)

A1S_2098 putative alcohol dehydrogenase (RefSeq) from Acinetobacter baumannii ATCC 17978 (39% identity, 90% coverage)

P31005 NAD-dependent methanol dehydrogenase; MDH; MEDH; EC 1.1.1.244; Type 3 alcohol dehydrogenase from Bacillus methanolicus (36% identity, 97% coverage)

L911_1325 alcohol dehydrogenase from Vibrio fluvialis I21563 (36% identity, 97% coverage)

CBY_0500 1,3-propanediol dehydrogenase (RefSeq) from Clostridium butyricum 5521 (37% identity, 98% coverage)

WP_003593433 1,3-propanediol dehydrogenase from Lactobacillus casei UCD174 (36% identity, 96% coverage)

YGL256W Adh4p (RefSeq) from Saccharomyces cerevisiae (36% identity, 82% coverage)

P10127 Alcohol dehydrogenase 4; EC 1.1.1.1; Alcohol dehydrogenase IV; ADHIV from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (37% identity, 97% coverage) (see paper)

Dde_3534 alcohol dehydrogenase (Chris Hemme) from Desulfovibrio desulfuricans G20 (39% identity, 97% coverage)

Pcar_2848 alcohol dehydrogenase, class IV (NCBI) from Pelobacter carbinolicus str. DSM 2380 (36% identity, 98% coverage)

lp_3051 1,3-propanediol dehydrogenase (NCBI ptt file) from Lactobacillus plantarum WCFS1 (36% identity, 96% coverage)

Z4116 L-1,2-propanediol oxidoreductase (NCBI ptt file) from Escherichia coli O157:H7 EDL933 (36% identity, 97% coverage)
ECs3659 L-1,2-propanediol oxidoreductase (NCBI ptt file) from Escherichia coli O157:H7 str. Sakai

b2799 / FucO L-1,2-propanediol oxidoreductase from Escherichia coli K-12 (36% identity, 97% coverage) (see 14 papers)
P0A9S1 Lactaldehyde reductase; EC 1.1.1.77; Propanediol oxidoreductase from Escherichia coli (strain K12) (see paper)
b2799 L-1,2-propanediol oxidoreductase (NCBI) from Escherichia coli str. K-12 substr. MG1655
NP_417279 L-1,2-propanediol oxidoreductase from Escherichia coli str. K-12 substr. MG1655

CD3006 probable alcohol dehydrogenase (RefSeq) from Clostridium difficile 630 (37% identity, 93% coverage)

P71017 Alcohol dehydrogenase; EC 1.1.1.1 from Bacillus subtilis (strain 168) (36% identity, 94% coverage) (see paper)

Halsa_2285 iron-containing alcohol dehydrogenase (NCBI) from Halanaerobium hydrogeniformans (37% identity, 82% coverage)

Pcar_2506 alcohol dehydrogenase, class IV (NCBI) from Pelobacter carbinolicus str. DSM 2380 (39% identity, 79% coverage)

Geoth_1572 alcohol dehydrogenase (NCBI) from Geobacillus thermoglucosidasius C56-YS93 (36% identity, 96% coverage)

STM4044 putative iron-containing alcohol dehydrogenase (NCBI ptt file) from Salmonella typhimurium LT2 (36% identity, 97% coverage)

PP_2803 1,3-propanediol dehydrogenase (NCBI ptt file) from Pseudomonas putida KT2440 (35% identity, 92% coverage)

Dhaf_2180 iron-containing alcohol dehydrogenase (RefSeq) from Desulfitobacterium hafniense DCB-2 (33% identity, 91% coverage)

Spaf_1781 lactaldehyde reductase from Streptococcus parasanguinis FW213 (34% identity, 97% coverage)

T260_06755 alcohol dehydrogenase EutG from Geobacillus sp. MAS1 (38% identity, 81% coverage)

BL1673 possible lactaldehyde reductase (NCBI) from Bifidobacterium longum NCC2705 (33% identity, 95% coverage)

BBMN68_1706 dhat (NCBI) from Bifidobacterium longum subsp. longum BBMN68 (33% identity, 95% coverage)

SPD_1985 alcohol dehydrogenase, iron-containing (NCBI) from Streptococcus pneumoniae D39 (33% identity, 97% coverage)
spr1963 Probable alcohol dehydrogenase. (NCBI ptt file) from Streptococcus pneumoniae R6

Ethha_0051 iron-containing alcohol dehydrogenase (NCBI) from Ethanoligenens harbinense YUAN-3 (33% identity, 98% coverage)

Gura_3568 iron-containing alcohol dehydrogenase (RefSeq) from Geobacter uraniumreducens Rf4 (33% identity, 93% coverage)

AOLE_03630 alcohol dehydrogenase, class IV (NCBI) from Acinetobacter sp. DR1 (31% identity, 95% coverage)

SOV_3c00580 alcohol dehydrogenase from Sporomusa ovata DSM 2662 (34% identity, 97% coverage)

CBY_3751 NADPH-dependent butanol dehydrogenase (RefSeq) from Clostridium butyricum 5521 (32% identity, 97% coverage)

PMI2717 propanediol utilization protein (alcohol dehydrogenase) (RefSeq) from Proteus mirabilis HI4320 (31% identity, 97% coverage)

pRL100135 putative 1,3-propanediol dehydrogenase (NCBI) from Rhizobium leguminosarum bv. viciae 3841 (35% identity, 97% coverage)

Dtox_4270 iron-containing alcohol dehydrogenase (RefSeq) from Desulfotomaculum acetoxidans DSM 771 (32% identity, 95% coverage)

NP_396070 gamma hydroxybutyrate dehydrogenase from Agrobacterium fabrum str. C58 (34% identity, 97% coverage)

CLJU_c24880 putative NADPH-dependent butanol dehydrogenase (NCBI) from Clostridium ljungdahlii DSM 13528 (31% identity, 96% coverage)
CAETHG_0555 NADPH-dependent butanol dehydrogenase from Clostridium autoethanogenum DSM 10061

Teth39_0206 bifunctional acetaldehyde-CoA/alcohol dehydrogenase (RefSeq) from Thermoanaerobacter ethanolicus ATCC 33223 (32% identity, 43% coverage)

CBY_3747 NADPH-dependent butanol dehydrogenase (RefSeq) from Clostridium butyricum 5521 (33% identity, 88% coverage)

Cbei_2181 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium beijerincki NCIMB 8052 (31% identity, 97% coverage)

Cbei_1722 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium beijerincki NCIMB 8052 (32% identity, 91% coverage)

CLJU_c39950 putative NADPH-dependent butanol dehydrogenase (NCBI) from Clostridium ljungdahlii DSM 13528 (31% identity, 94% coverage)

CD1907 putative ethanolamine/propanediol utilization propanol dehydrogenase (RefSeq) from Clostridium difficile 630 (32% identity, 95% coverage)

A4IP64 Long-chain-alcohol dehydrogenase 1; EC 1.1.1.192; Alcohol dehydrogenase 1; ADH1; Fatty alcohol oxidoreductase 1; Glycerol dehydrogenase; EC 1.1.1.6 from Geobacillus thermodenitrificans (strain NG80-2) (33% identity, 93% coverage) (see paper)
GTNG_1754 Alcohol dehydrogenase (RefSeq) from Geobacillus thermodenitrificans NG80-2

Cbei_0305 bifunctional acetaldehyde-CoA/alcohol dehydrogenase (RefSeq) from Clostridium beijerincki NCIMB 8052 (33% identity, 40% coverage)

SMB_P058 alcohol dehydrogenase (NCBI) from Clostridium acetobutylicum DSM 1731 (29% identity, 92% coverage)

CEA_P0058 alcohol dehydrogenase from Clostridium acetobutylicum EA 2018 (29% identity, 94% coverage)

cgd8_1720 acetaldehyde reductase plus alcohol dehydrogenase (AdhE) of possible bacterial origin from Cryptosporidium parvum Iowa II (30% identity, 43% coverage)

CA_P0059 alcohol dehydrogenase from Clostridium acetobutylicum ATCC 824 (29% identity, 92% coverage)
CAP0059 Alcohol dehydrogenase (NCBI ptt file) from Clostridium acetobutylicum ATCC 824

CEA_P0034 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium acetobutylicum EA 2018 (30% identity, 43% coverage)
CAP0035, CA_P0035 Aldehyde-alcohol dehydrogenase, ADHE1 (NCBI ptt file) from Clostridium acetobutylicum ATCC 824

Z3709 ethanolamine utilization; homolog of Salmonella enzyme, similar to iron-containing alcohol dehydrogenase (NCBI ptt file) from Escherichia coli O157:H7 EDL933 (32% identity, 95% coverage)

b2453 / YffV predicted alcohol dehydrogenase in ethanolamine utilization from Escherichia coli K-12 (32% identity, 97% coverage) (see 3 papers)
b2453 ethanolamine utilization; homolog of Salmonella enzyme, similar to iron-containing alcohol dehydrogenase (VIMSS) from Escherichia coli str. K-12 substr. MG1655

Dde_3267 alcohol dehydrogenase (NCBI) from Desulfovibrio desulfuricans G20 (30% identity, 91% coverage)

Geoth_1941 alcohol dehydrogenase (NCBI) from Geobacillus thermoglucosidasius C56-YS93 (30% identity, 95% coverage)

CtherDRAFT_1096 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium thermocellum DSM 4150 (31% identity, 40% coverage)

Cthe_0423 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium thermocellum ATCC 27405 (31% identity, 40% coverage)

PP2049 alcohol dehydrogenase, iron-containing (NCBI ptt file) from Pseudomonas putida KT2440 (34% identity, 96% coverage)

BC4365 Alcohol dehydrogenase (NCBI ptt file) from Bacillus cereus ATCC 14579 (30% identity, 43% coverage)

CBY_3753 aldehyde-alcohol dehydrogenase 2 (RefSeq) from Clostridium butyricum 5521 (31% identity, 40% coverage)

EF0900 aldehyde-alcohol dehydrogenase (NCBI ptt file) from Enterococcus faecalis V583 (30% identity, 42% coverage)

lmo1171 similar to NADPH-dependent butanol dehydrogenase (NCBI ptt file) from Listeria monocytogenes EGD-e (29% identity, 92% coverage)

SO2136 aldehyde-alcohol dehydrogenase (NCBI ptt file) from Shewanella oneidensis MR-1 (32% identity, 39% coverage)

BAS4267 aldehyde-alcohol dehydrogenase (NCBI) from Bacillus anthracis str. Sterne (29% identity, 43% coverage)
BA4599 aldehyde-alcohol dehydrogenase (NCBI ptt file) from Bacillus anthracis str. Ames

MSMEG_6242 alcohol dehydrogenase, iron-containing (NCBI) from Mycobacterium smegmatis str. MC2 155 (31% identity, 86% coverage)

SL2424 no description from Salmonella enterica Typhimurium str. SL1344 (31% identity, 97% coverage)
NP_461396 alcohol dehydrogenase EutG from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

L910_4642, L911_3405 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Vibrio fluvialis PG41 (32% identity, 38% coverage)

Cphy_3925 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium phytofermentans ISDg (32% identity, 40% coverage)

LSA0379 Bifunctional enzyme: alcohol dehydrogenase, acetaldehyde dehydrogenase (NCBI) from Lactobacillus sakei subsp. sakei 23K (31% identity, 41% coverage)

LGG_00757 NAD-dependent alcohol-acetaldehyde dehydrogenase and iron-binding alcohol dehydrogenase (RefSeq) from Lactobacillus rhamnosus GG (30% identity, 42% coverage)

ETAE_1508 aldehyde-alcohol dehydrogenase (RefSeq) from Edwardsiella tarda EIB202 (31% identity, 38% coverage)

SSU0261 aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase; acetaldehyde dehydrogenase] (RefSeq) from Streptococcus suis P1/7 (31% identity, 40% coverage)

SSU05_0280 NAD-dependent aldehyde dehydrogenase (RefSeq) from Streptococcus suis 05ZYH33 (31% identity, 41% coverage)

YPTB2103 aldehyde-alcohol dehydrogenase (NCBI) from Yersinia pseudotuberculosis IP 32953 (31% identity, 38% coverage)
YPO2180 aldehyde-alcohol dehydrogenase (NCBI ptt file) from Yersinia pestis CO92

NT01EI_1665 aldehyde-alcohol dehydrogenase 2 (RefSeq) from Edwardsiella ictaluri 93-146 (32% identity, 38% coverage)

Ethha_0580 iron-containing alcohol dehydrogenase (NCBI) from Ethanoligenens harbinense YUAN-3 (31% identity, 92% coverage)

VAS14_18001 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Photobacterium angustum S14 (31% identity, 38% coverage)

STM1749 iron-dependent alcohol dehydrogenase of the multifunctional alcohol dehydrogenase AdhE (NCBI ptt file) from Salmonella typhimurium LT2 (31% identity, 38% coverage)

AKI40_3351 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Enterobacter sp. FY-07 (30% identity, 38% coverage)

lp_3662 bifunctional protein: alcohol dehydrogenase; acetaldehyde dehydrogenase (NCBI ptt file) from Lactobacillus plantarum WCFS1 (30% identity, 42% coverage)

Q9RCG0 Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase; MNO; EC 1.1.99.37; Methanol dehydrogenase (nicotinoprotein); Methanol:NDMA oxidoreductase from Amycolatopsis methanolica (34% identity, 72% coverage) (see paper)

Cphy_1029 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium phytofermentans ISDg (30% identity, 94% coverage)

VC2033 alcohol dehydrogenase/acetaldehyde dehydrogenase (NCBI ptt file) from Vibrio cholerae O1 biovar eltor str. N16961 (31% identity, 38% coverage)

SACOL0135 alcohol dehydrogenase, iron-containing (NCBI) from Staphylococcus aureus subsp. aureus COL (31% identity, 39% coverage)
SAOUHSC_00113 alcohol dehydrogenase, iron-containing, putative (NCBI) from Staphylococcus aureus subsp. aureus NCTC 8325

SAR0150 putative aldehyde-alcohol dehydrogenase (NCBI) from Staphylococcus aureus subsp. aureus MRSA252 (31% identity, 39% coverage)

NP_465159 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Listeria monocytogenes EGD-e (29% identity, 43% coverage)
lmo1634 similar to Alcohol-acetaldehyde dehydrogenase (NCBI ptt file) from Listeria monocytogenes EGD-e

SAOV_0095 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Staphylococcus aureus subsp. aureus ED133 (31% identity, 39% coverage)

LMRG_01332 alcohol dehydrogenase, iron-containing (RefSeq) from Listeria monocytogenes 10403S (29% identity, 43% coverage)

SA0143 alcohol-acetaldehyde dehydrogenase (NCBI) from Staphylococcus aureus subsp. aureus N315 (31% identity, 39% coverage)

NP_213782 1,3 propanediol dehydrogenase from Aquifex aeolicus VF5 (29% identity, 89% coverage)

CtherDRAFT_0616 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium thermocellum DSM 4150 (31% identity, 91% coverage)

Cphy_1421 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium phytofermentans ISDg (30% identity, 92% coverage)

Ethha_1385 iron-containing alcohol dehydrogenase (NCBI) from Ethanoligenens harbinense YUAN-3 (31% identity, 40% coverage)

EHI_150490 alcohol dehydrogenase from Entamoeba histolytica HM-1:IMSS (29% identity, 44% coverage)

EHI_160940 alcohol dehydrogenase from Entamoeba histolytica HM-1:IMSS (29% identity, 44% coverage)

b1241 / AdhC aldehyde-alcohol dehydrogenase from Escherichia coli K-12 (30% identity, 38% coverage) (see 9 papers)
ECs1741 CoA-linked acetaldehyde dehydrogenase/iron-dependent alcohol dehydrogenase (NCBI ptt file) from Escherichia coli O157:H7 str. Sakai
NP_415757 fused acetaldehyde-CoA dehydrogenase/iron-dependent alcohol dehydrogenase/pyruvate-formate lyase deactivase from Escherichia coli str. K-12 substr. MG1655
b1241 fused acetaldehyde-CoA dehydrogenase/iron-dependent alcohol dehydrogenase/pyruvate-formate lyase deactivase (NCBI) from Escherichia coli str. K-12 substr. MG1655

c1705 Aldehyde-alcohol dehydrogenase (NCBI ptt file) from Escherichia coli CFT073 (30% identity, 38% coverage)

CAETHG_3747 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium autoethanogenum DSM 10061 (30% identity, 43% coverage)

Q24803 Aldehyde-alcohol dehydrogenase 2 from Entamoeba histolytica (29% identity, 44% coverage) (see paper)

SERP0389 alcohol dehydrogenase, iron-containing (NCBI) from Staphylococcus epidermidis RP62A (31% identity, 39% coverage)

Ccel_1083 NADPH-dependent butanol dehydrogenase from [Clostridium] cellulolyticum H10 (30% identity, 94% coverage)
Ccel_1083 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium cellulolyticum H10

A1S_2053 putative iron-containing alcohol dehydrogenase (RefSeq) from Acinetobacter baumannii ATCC 17978 (34% identity, 83% coverage)

KPN_02199 CoA-linked acetaldehyde dehydrogenase and iron-dependent alcohol dehydrogenase; pyruvate-formate-lyase deactivase (RefSeq) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (30% identity, 38% coverage)

SpyM3_0036 putative alcohol dehydrogenase II (NCBI ptt file) from Streptococcus pyogenes MGAS315 (29% identity, 40% coverage)

TVAG_422780 alcohol dehydrogensae from Trichomonas vaginalis G3 (30% identity, 94% coverage)

CD0334 aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase; acetaldehyde dehydrogenase [acetylating]; pyruvate-formate-lyase deactivase (RefSeq) from Clostridium difficile 630 (28% identity, 42% coverage)

M5005_Spy_0039 alcohol dehydrogenase/acetaldehyde dehydrogenase (acetylating) (NCBI) from Streptococcus pyogenes MGAS5005 (29% identity, 40% coverage)

Cthe_2579 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium thermocellum ATCC 27405 (31% identity, 91% coverage)

plu2496 Aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase (ADH) and acetaldehyde dehydrogenase [acetylating] (ACDH); pyruvate-formate-lyase deactivase (PFL deactivase)] (NCBI) from Photorhabdus luminescens subsp. laumondii TTO1 (31% identity, 39% coverage)

SE0506 alcohol dehydrogenase (NCBI ptt file) from Staphylococcus epidermidis ATCC 12228 (31% identity, 39% coverage)

SAR11_1287 iron-containing alcohol dehydrogenase (NCBI) from Candidatus Pelagibacter ubique HTCC1062 (27% identity, 98% coverage)

CD2966 aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase and pyruvate-formate-lyase deactivase (RefSeq) from Clostridium difficile 630 (31% identity, 40% coverage)

Spaf_0058 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Streptococcus parasanguinis FW213 (30% identity, 40% coverage)

CD0274 putative 1,3-propanediol dehydrogenase (RefSeq) from Clostridium difficile 630 (28% identity, 96% coverage)

Q53062 Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase; MNO; EC 1.1.99.37; Methanol dehydrogenase (nicotinoprotein); Methanol:NDMA oxidoreductase from Rhodococcus erythropolis (Arthrobacter picolinophilus) (32% identity, 86% coverage)

SSA_0068 Alcohol-acetaldehyde dehydrogenase, putative (NCBI) from Streptococcus sanguinis SK36 (30% identity, 40% coverage)

SGO_0113 alcohol-acetaldehyde dehydrogenase (RefSeq) from Streptococcus gordonii str. Challis substr. CH1 (30% identity, 40% coverage)

Cbei_4552 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium beijerincki NCIMB 8052 (32% identity, 79% coverage)

A1S_2702 putative alcohol dehydrogenase (RefSeq) from Acinetobacter baumannii ATCC 17978 (31% identity, 74% coverage)

Ccel_3198 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium cellulolyticum H10 (30% identity, 40% coverage)
Ccel_3198 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from [Clostridium] cellulolyticum H10

EHI_024240, XP_001913653 aldehyde-alcohol dehydrogenase 2 from Entamoeba histolytica HM-1:IMSS (30% identity, 46% coverage)

APL_1011 aldehyde-alcohol dehydrogenase 2 (NCBI) from Actinobacillus pleuropneumoniae L20 (30% identity, 44% coverage)

spr1837 Alcohol-acetaldehyde dehydrogenase (NCBI ptt file) from Streptococcus pneumoniae R6 (30% identity, 39% coverage)

SPD_1834 alcohol dehydrogenase, iron-containing (NCBI) from Streptococcus pneumoniae D39 (30% identity, 40% coverage)

gbs0053 Unknown (NCBI ptt file) from Streptococcus agalactiae NEM316 (28% identity, 40% coverage)
SAG0053 aldehyde-alcohol dehydrogenase (NCBI ptt file) from Streptococcus agalactiae 2603V/R

pRL100103 putative alcohol dehydrogenase (NCBI) from Rhizobium leguminosarum bv. viciae 3841 (32% identity, 97% coverage)

Cbei_4354 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium beijerincki NCIMB 8052 (26% identity, 96% coverage)

C5MRT8 Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase; MDO; EC 1.1.99.37; Methanol dehydrogenase (nicotinoprotein); Methanol:NDMA oxidoreductase from Mycobacterium sp. (strain DSM 3803 / JC1) (30% identity, 88% coverage) (see paper)

F502_06447 bifunctional acetaldehyde-CoA/alcohol dehydrogenase from Clostridium pasteurianum DSM 525 = ATCC 6013 (29% identity, 42% coverage)

SSA_0514 PduQ protein, putative (NCBI) from Streptococcus sanguinis SK36 (28% identity, 96% coverage)

TM0111 alcohol dehydrogenase, iron-containing (NCBI ptt file) from Thermotoga maritima MSB8 (29% identity, 96% coverage)

PA5186 probable iron-containing alcohol dehydrogenase (NCBI) from Pseudomonas aeruginosa PAO1 (35% identity, 95% coverage)

CTN_0580 Alcohol dehydrogenase, iron-containing (RefSeq) from Thermotoga neapolitana DSM 4359 (28% identity, 96% coverage)

Cbei_1937 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium beijerincki NCIMB 8052 (27% identity, 95% coverage)

Cthe_0394 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium thermocellum ATCC 27405 (30% identity, 77% coverage)

EF1635 propanol dehydrogenase PduQ, putative (NCBI ptt file) from Enterococcus faecalis V583 (27% identity, 96% coverage)

Tpet_0813 iron-containing alcohol dehydrogenase (RefSeq) from Thermotoga petrophila RKU-1 (28% identity, 98% coverage)

Csac_0711 iron-containing alcohol dehydrogenase (RefSeq) from Caldicellulosiruptor saccharolyticus DSM 8903 (29% identity, 89% coverage)

BBMN68_1612 puta2 (NCBI) from Bifidobacterium longum subsp. longum BBMN68 (30% identity, 37% coverage)

XP_001703585 dual function alcohol dehydrogenase / acetaldehyde dehydrogenase from Chlamydomonas reinhardtii (28% identity, 39% coverage)

D11S_1811 oxidoreductase domain protein (RefSeq) from Aggregatibacter actinomycetemcomitans D11S-1 (29% identity, 40% coverage)

BL1575 Adh2 (NCBI) from Bifidobacterium longum NCC2705 (30% identity, 37% coverage)

Asuc_0591 iron-containing alcohol dehydrogenase (RefSeq) from Actinobacillus succinogenes 130Z (32% identity, 32% coverage)

PP2650 4-hydroxybutyrate dehydrogenase (NCBI ptt file) from Pseudomonas putida KT2440 (30% identity, 95% coverage)

Tpet_0563 iron-containing alcohol dehydrogenase (RefSeq) from Thermotoga petrophila RKU-1 (30% identity, 90% coverage)

PA1146 probable iron-containing alcohol dehydrogenase (NCBI) from Pseudomonas aeruginosa PAO1 (30% identity, 97% coverage)

PF0608 alcohol dehydrogenase (NCBI ptt file) from Pyrococcus furiosus DSM 3638 (30% identity, 97% coverage)

AF0024 alcohol dehydrogenase, iron-containing (NCBI ptt file) from Archaeoglobus fulgidus DSM 4304 (28% identity, 88% coverage)

GL50803_93358 Alcohol dehydrogenase from Giardia lamblia ATCC 50803 (27% identity, 38% coverage)

Mvan_0443 iron-containing alcohol dehydrogenase (NCBI) from Mycobacterium vanbaalenii PYR-1 (31% identity, 41% coverage)

AF0339 alcohol dehydrogenase, iron-containing (NCBI ptt file) from Archaeoglobus fulgidus DSM 4304 (28% identity, 94% coverage)

PF0075 alcohol dehydrogenase (NCBI ptt file) from Pyrococcus furiosus DSM 3638 (28% identity, 96% coverage)

LLKF_2398 alcohol dehydrogenase/ acetaldehyde dehydrogenase (RefSeq) from Lactococcus lactis subsp. lactis KF147 (27% identity, 37% coverage)

LF82_344 hypothetical protein from Escherichia coli LF82 (30% identity, 83% coverage)

Dhaf_0588 iron-containing alcohol dehydrogenase (RefSeq) from Desulfitobacterium hafniense DCB-2 (28% identity, 75% coverage)

NP_460997 propanediol utilization protein from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 (30% identity, 83% coverage)

llmg_2432 alcohol-acetaldehyde dehydrogenase (NCBI) from Lactococcus lactis subsp. cremoris MG1363 (27% identity, 37% coverage)

lmo1166 similar to NADPH-dependent butanol dehydrogenase (NCBI ptt file) from Listeria monocytogenes EGD-e (27% identity, 96% coverage)

LSA0258 Putative iron-containing alcohol dehydrogenase (oxidoreductase) (NCBI) from Lactobacillus sakei subsp. sakei 23K (30% identity, 71% coverage)

Csac_0622 iron-containing alcohol dehydrogenase (RefSeq) from Caldicellulosiruptor saccharolyticus DSM 8903 (27% identity, 92% coverage)

Ethha_2239 iron-containing alcohol dehydrogenase (NCBI) from Ethanoligenens harbinense YUAN-3 (26% identity, 79% coverage)

Ethha_1164 iron-containing alcohol dehydrogenase (NCBI) from Ethanoligenens harbinense YUAN-3 (29% identity, 97% coverage)

TK1569 iron-containing alcohol dehydrogenase (NCBI) from Thermococcus kodakaraensis KOD1 (29% identity, 86% coverage)

TON_0544 alcohol dehydrogenase (RefSeq) from Thermococcus onnurineus NA1 (28% identity, 91% coverage)

Q9F282 Long-chain primary alcohol dehydrogenase AdhA; EC 1.1.1.2 from Thermoanaerobacter ethanolicus (Clostridium thermohydrosulfuricum) (28% identity, 93% coverage) (see paper)

Ccel_0894 alcohol dehydrogenase from [Clostridium] cellulolyticum H10 (28% identity, 93% coverage)
Ccel_0894 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium cellulolyticum H10

Teth39_0220 iron-containing alcohol dehydrogenase (RefSeq) from Thermoanaerobacter ethanolicus ATCC 33223 (28% identity, 92% coverage)

TM0920 alcohol dehydrogenase, iron-containing (NCBI ptt file) from Thermotoga maritima MSB8 (27% identity, 78% coverage)

CTN_1655 Iron-containing alcohol dehydrogenase (RefSeq) from Thermotoga neapolitana DSM 4359 (26% identity, 99% coverage)

WP_011953576 alcohol dehydrogenase from Lactobacillus reuteri mlc3 (26% identity, 91% coverage)

Teth514_0654 iron-containing alcohol dehydrogenase (RefSeq) from Thermoanaerobacter ethanolicus X514 (27% identity, 92% coverage)

Pcar_1095 NADH-dependent butanol dehydrogenase II (NCBI) from Pelobacter carbinolicus str. DSM 2380 (29% identity, 88% coverage)

Q8IWW8 Hydroxyacid-oxoacid transhydrogenase, mitochondrial; HOT; EC 1.1.99.24; Alcohol dehydrogenase iron-containing protein 1; ADHFe1; Fe-containing alcohol dehydrogenase from Homo sapiens (Human) (28% identity, 73% coverage) (see paper)
NP_653251 hydroxyacid-oxoacid transhydrogenase, mitochondrial from Homo sapiens

Tpet_0007 iron-containing alcohol dehydrogenase (RefSeq) from Thermotoga petrophila RKU-1 (27% identity, 78% coverage)

TK1008 Fe-containing alcohol dehydrogenase (NCBI) from Thermococcus kodakaraensis KOD1 (27% identity, 91% coverage)

Teth39_1597 iron-containing alcohol dehydrogenase (RefSeq) from Thermoanaerobacter ethanolicus ATCC 33223 (26% identity, 90% coverage)

TTE0313 NADH-dependent alcohol dehydrogenase from Caldanaerobacter subterraneus subsp. tengcongensis MB4 (29% identity, 75% coverage)
TTE0313 uncharacterized oxidoreductases, Fe-dependent alcohol dehydrogenase family (NCBI ptt file) from Thermoanaerobacter tengcongensis MB4

TTE0696 Alcohol dehydrogenase IV (NCBI ptt file) from Thermoanaerobacter tengcongensis MB4 (28% identity, 86% coverage)

Q4QQW3 Hydroxyacid-oxoacid transhydrogenase, mitochondrial; HOT; EC 1.1.99.24; Alcohol dehydrogenase iron-containing protein 1; ADHFe1 from Rattus norvegicus (Rat) (26% identity, 80% coverage)

L21SP2_0358 hypothetical protein from Salinispira pacifica (28% identity, 70% coverage)

P33744 Aldehyde-alcohol dehydrogenase; AAD from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (26% identity, 40% coverage) (see paper)
CAP0162, CA_P0162 Aldehyde dehydrogenase (NAD+) (NCBI ptt file) from Clostridium acetobutylicum ATCC 824

Teth39_1979 iron-containing alcohol dehydrogenase (RefSeq) from Thermoanaerobacter ethanolicus ATCC 33223 (25% identity, 90% coverage)

XP_017168188 hydroxyacid-oxoacid transhydrogenase, mitochondrial isoform X2 from Mus musculus (26% identity, 89% coverage)

Q8R0N6 Hydroxyacid-oxoacid transhydrogenase, mitochondrial; HOT; EC 1.1.99.24; Alcohol dehydrogenase iron-containing protein 1; ADHFe1 from Mus musculus (Mouse) (26% identity, 80% coverage)

Csac_1500 iron-containing alcohol dehydrogenase (RefSeq) from Caldicellulosiruptor saccharolyticus DSM 8903 (26% identity, 72% coverage)

Athe_0928 alcohol dehydrogenase from Caldicellulosiruptor bescii DSM 6725 (26% identity, 73% coverage)
Athe_0928 iron-containing alcohol dehydrogenase (RefSeq) from Anaerocellum thermophilum DSM 6725

Cbei_2421 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium beijerincki NCIMB 8052 (27% identity, 97% coverage)

A4ISB9 Long-chain-alcohol dehydrogenase 2; EC 1.1.1.192; Alcohol dehydrogenase 2; ADH2; Fatty alcohol oxidoreductase 2 from Geobacillus thermodenitrificans (strain NG80-2) (25% identity, 91% coverage) (see paper)
GTNG_2878 NADH-dependent butanol dehydrogenase A (RefSeq) from Geobacillus thermodenitrificans NG80-2

EHI_166490 alcohol dehydrogenase from Entamoeba histolytica HM-1:IMSS (29% identity, 71% coverage)

Geoth_0631 alcohol dehydrogenase (NADP(+)) (NCBI) from Geobacillus thermoglucosidasius C56-YS93 (24% identity, 91% coverage)

CTN_1756 Iron-containing alcohol dehydrogenase (RefSeq) from Thermotoga neapolitana DSM 4359 (25% identity, 88% coverage)

APL_1859 Probable NADH-dependent butanol dehydrogenase 1 (NCBI) from Actinobacillus pleuropneumoniae L20 (26% identity, 76% coverage)

CPE0858 NADH-dependent butanol dehydrogenase (NCBI ptt file) from Clostridium perfringens str. 13 (26% identity, 97% coverage)

DW66_3577 maleylacetate reductase from Pseudomonas putida (27% identity, 78% coverage)

CtherDRAFT_0189 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium thermocellum DSM 4150 (26% identity, 75% coverage)
Cthe_0101 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium thermocellum ATCC 27405

EF0194 NADH-dependent butanol dehydrogenase, putative (NCBI ptt file) from Enterococcus faecalis V583 (27% identity, 74% coverage)

Atu2528 maleylacetate reductase (RefSeq) from Agrobacterium tumefaciens str. C58 (Cereon) (28% identity, 94% coverage)

C8J_1329 hypothetical protein (RefSeq) from Campylobacter jejuni subsp. jejuni 81116 (28% identity, 72% coverage)

CA_C3299 NADH-dependent butanol dehydrogenase from Clostridium acetobutylicum ATCC 824 (23% identity, 90% coverage)
CAC3299 NADH-dependent butanol dehydrogenase A (BDH I) (NCBI ptt file) from Clostridium acetobutylicum ATCC 824

DW66_3594 maleylacetate reductase from Pseudomonas putida (26% identity, 77% coverage)

SMB_G3335 NADH-dependent butanol dehydrogenase B (NCBI) from Clostridium acetobutylicum DSM 1731 (28% identity, 73% coverage)
CA_C3298 NADH-dependent butanol dehydrogenase from Clostridium acetobutylicum ATCC 824
CAC3298 NADH-dependent butanol dehydrogenase B (BDH II) (NCBI ptt file) from Clostridium acetobutylicum ATCC 824

Ccel_3337 NADH-dependent alcohol dehydrogenase from [Clostridium] cellulolyticum H10 (25% identity, 90% coverage)
Ccel_3337 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium cellulolyticum H10

Swit_4891 iron-containing alcohol dehydrogenase (RefSeq) from Sphingomonas wittichii RW1 (26% identity, 81% coverage)

TM0820 NADH-dependent butanol dehydrogenase, putative (NCBI ptt file) from Thermotoga maritima MSB8 (25% identity, 88% coverage)

Reut_A1589 Iron-containing alcohol dehydrogenase (NCBI) from Ralstonia eutropha JMP134 (28% identity, 78% coverage)

CBO1407 NADH-dependent butanol dehydrogenase (RefSeq) from Clostridium botulinum A str. ATCC 3502 (24% identity, 90% coverage)

Tpet_0107 iron-containing alcohol dehydrogenase (RefSeq) from Thermotoga petrophila RKU-1 (25% identity, 88% coverage)

SOV_2c03040 alcohol dehydrogenase from Sporomusa ovata DSM 2662 (31% identity, 66% coverage)

Pcar_1085 NADH-dependent butanol dehydrogenase I (NCBI) from Pelobacter carbinolicus str. DSM 2380 (25% identity, 66% coverage)

PG0689 NAD-dependent 4-hydroxybutyrate dehydrogenase (NCBI) from Porphyromonas gingivalis W83 (30% identity, 53% coverage)
PGN_0724 NAD-dependent 4-hydroxybutyrate dehydrogenase (RefSeq) from Porphyromonas gingivalis ATCC 33277

CD2338 NAD-dependent 4-hydroxybutyrate dehydrogenase (RefSeq) from Clostridium difficile 630 (28% identity, 62% coverage)

pRL120215 putative maleylacetate reductase (NCBI) from Rhizobium leguminosarum bv. viciae 3841 (27% identity, 72% coverage)

Reut_D6463 Iron-containing alcohol dehydrogenase (NCBI) from Ralstonia eutropha JMP134 (25% identity, 76% coverage)

Reut_D6471 Iron-containing alcohol dehydrogenase (NCBI) from Ralstonia eutropha JMP134 (26% identity, 78% coverage)

Reut_B4129 Iron-containing alcohol dehydrogenase (NCBI) from Ralstonia eutropha JMP134 (24% identity, 77% coverage)

Cphy_2463 iron-containing alcohol dehydrogenase (RefSeq) from Clostridium phytofermentans ISDg (26% identity, 70% coverage)

Reut_B4694 Iron-containing alcohol dehydrogenase (NCBI) from Ralstonia eutropha JMP134 (25% identity, 78% coverage)

cg3386 maleylacetate reductase (RefSeq) from Corynebacterium glutamicum ATCC 13032 (25% identity, 76% coverage)
NCgl2952 maleylacetate reductase (NCBI) from Corynebacterium glutamicum ATCC 13032

NCgl1112 alcohol dehydrogenase IV (NCBI) from Corynebacterium glutamicum ATCC 13032 (25% identity, 74% coverage)
cg1310 maleylacetate reductase (RefSeq) from Corynebacterium glutamicum ATCC 13032

Fitness Blast

Query Sequence

>VIMSS3615187
MSHDLSQLRKFVSPEIIFGAGSRHNVGNYAKTFGARKVLIVSDPGVVAAGWAGDVEASLQ
AQGIDYCLYTGVSPNPRVEEVMTGAELYRSEGCNVIVAVGGGSPMDCAKGIGIVVAHGRN
ILEFEGVDTLRVPSPPLILIPTTAGTSADVSQFVIISNQQERMKFSIVSKAVVPDVSLID
PETTLSMDPFLSACTGIDALVHAIEAFVSTGHGPLTDPHALEAMRLINGNLVQMIANPAD
IALREKIMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSAA
PERFKVIAETLGIDCRGLTHTQIRQRLVEHLIAFKHAVGFRETLGLHGVGTSDIPFLSSH
AMDDPCILTNPRESTQRDVEVVYGEAL

New Search

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, Swiss-Prot, and EcoCyc. As of March 2017, PaperBLAST links over 360,000 different protein sequences to over 700,000 articles. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access.

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

We also use manually-curated links between protein sequences and articles. We index proteins from NCBI's RefSeq if a GeneRIF entries links the gene to an article in PubMed®. GeneRIF also provides a short summary of the article's claim about the protein, which we provide instead of a snippet. We index proteins from Swiss-Prot (the curated part of UniProt) if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). And we index every protein EcoCyc, a curated database of the proteins in Escherichia coli K-12. For the entries from Swiss-Prot and EcoCyc, we provide a short curated description of the protein's function. Most of these entries also link to articles in PubMed.

The code for PaperBLAST is available here.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory