Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate 3607933 Dshi_1341 ABC transporter related (RefSeq)
Query= uniprot:Q88GX0 (260 letters) >FitnessBrowser__Dino:3607933 Length = 362 Score = 152 bits (383), Expect = 1e-41 Identities = 89/247 (36%), Positives = 135/247 (54%), Gaps = 8/247 (3%) Query: 13 EPDPRPVLIRIEGLNKHYGAFHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVA 72 +P PR + + L + + V+ D+ ++V G+ L GPSG GKST +R I ++ Sbjct: 4 QPIPR---LEVSHLVRDFQGQRVVDDVSIRVMPGQVTCLLGPSGCGKSTTLRIIAGVDRQ 60 Query: 73 QQGSIQVDGIDLAATTREAAQVRSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKDA 132 G++ VDG +++ +G++FQ F LFPH+ V DN + SRK+ Sbjct: 61 DSGTLTVDGEVVSSDDIHLPPEARSVGLMFQDFALFPHLCVADNVGFGLSG----SRKEK 116 Query: 133 EERARMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMVA 192 RA L +VG+ A K+P QLSGG+QQRVA+ARA+ +PR+ML DEP S LD + Sbjct: 117 RARAHELLDRVGLLGDAGKFPHQLSGGEQQRVALARAIAPRPRVMLMDEPFSGLDNRLRD 176 Query: 193 EVLD-VLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIEDSPPQVFFNQPRTERA 251 + D L L G +L VTHE A ++A+ + + GG+I++ P +N P + A Sbjct: 177 GIRDETLEVLKDEGTAVLLVTHEPEEAMRMADNIALMRGGKIVQQGAPYNVYNSPVDKAA 236 Query: 252 KAFLAQI 258 AF + I Sbjct: 237 AAFFSDI 243 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 362 Length adjustment: 27 Effective length of query: 233 Effective length of database: 335 Effective search space: 78055 Effective search space used: 78055 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory