Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate 3608380 Dshi_1781 acetolactate synthase, small subunit (RefSeq)
Query= BRENDA::P00894 (163 letters) >FitnessBrowser__Dino:3608380 Length = 190 Score = 128 bits (321), Expect = 6e-35 Identities = 75/156 (48%), Positives = 104/156 (66%), Gaps = 3/156 (1%) Query: 5 LSVLLENESGALSRVIGLFSQRGYNIESLTVAPTD-DPTLSRMTIQTVGDEKVLEQIEKQ 63 L+V+++NE+G L+RVIGLFS RGYNIESLTVA D + SR+TI T G +V+EQI+ Q Sbjct: 31 LAVVVDNEAGVLARVIGLFSGRGYNIESLTVAEIDHEGHRSRITIVTTGTPQVIEQIKAQ 90 Query: 64 LHKLVDVLRVSELG-QGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLYTV 122 L ++V V V +L +GA VERE+ L K+ +G R E R EIFR ++D T + Sbjct: 91 LARMVPVHEVHDLTVEGASVERELALFKVAGTGDKRIEALRLAEIFRANVVDSTLQSFVF 150 Query: 123 QLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRG 158 ++ GT K+DAF +R + + E+AR+GV LSRG Sbjct: 151 EITGTPAKIDAFGELMRPLG-LTEIARTGVAALSRG 185 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 104 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 190 Length adjustment: 19 Effective length of query: 144 Effective length of database: 171 Effective search space: 24624 Effective search space used: 24624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
Align candidate 3608380 Dshi_1781 (acetolactate synthase, small subunit (RefSeq))
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.30685.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.30685.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.