Align ABC transporter related (characterized, see rationale)
to candidate 5208351 Shew_0863 ABC transporter-related protein (RefSeq)
Query= uniprot:B2TBJ9 (263 letters) >FitnessBrowser__PV4:5208351 Length = 342 Score = 140 bits (353), Expect = 4e-38 Identities = 82/237 (34%), Positives = 135/237 (56%), Gaps = 15/237 (6%) Query: 9 LSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVSLA 68 L+++ +H + +L+G+ L HQG++ ++LG SG GK+T L+ + L+ G +S+ Sbjct: 4 LTIEQVHSDYQGQTILRGLDLVLHQGEIAALLGPSGCGKTTLLKAIAGLQPISQGRISIN 63 Query: 69 GEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKRSR 128 G L G PS+RR+V GM+FQ++ L+ H+TV EN++ G + K +R Sbjct: 64 GRLLS----GPETFVPSERREV-------GMIFQDYALFPHLTVAENILFGVKGLDKAAR 112 Query: 129 AESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALDPE 188 + E AL+ GL G YP LSGGQQQRV+IARALA P+++L DEP S +D + Sbjct: 113 QARLGEMLALVKLEGLG---GRYPHELSGGQQQRVSIARALAYEPELLLLDEPFSNIDAK 169 Query: 189 LVGEVLRVMRS-LAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFVE 244 + GE++ +R L + G + + VTH A ++++ G + G+ + ++ E Sbjct: 170 VRGEMMVEIREILKQRGVSAVFVTHSKDEAFVFADKLALFKDGGIAQYGSAESLYAE 226 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 342 Length adjustment: 27 Effective length of query: 236 Effective length of database: 315 Effective search space: 74340 Effective search space used: 74340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory