Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate 5210736 Shew_3164 ABC transporter-related protein (RefSeq)
Query= uniprot:A0A165KQ08 (355 letters) >FitnessBrowser__PV4:5210736 Length = 241 Score = 137 bits (344), Expect = 4e-37 Identities = 84/240 (35%), Positives = 135/240 (56%), Gaps = 10/240 (4%) Query: 5 LDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTEGE 64 + I+ ++K FG +VL+ +D +A GE + ++GPSG GKST L I L++PT+GE Sbjct: 2 IKISNLHKYFGDN----QVLKGIDESIARGEVVSVIGPSGSGKSTFLRCINLLEQPTQGE 57 Query: 65 IRIGGKNVVG----MPPRDRDIAMVFQSYALYPTLSVADNIGFA-LEMRKMPKPERQKRI 119 I I G+++ + + + MVFQ++ L+P +V NI A +++ M + E Sbjct: 58 IVIDGQSITAPDACIDKLRQKVGMVFQNFNLFPHKTVQQNITLAPVKLGLMTQAEADSEA 117 Query: 120 DEVAAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRA 179 + + +S P+ LSGGQ+QRVA+ RALA +P+L LFDEP S LD ++ ++ Sbjct: 118 MRLLDQVGLSDKASAYPASLSGGQKQRVAIARALAMKPELMLFDEPTSALDPEMVGDVLD 177 Query: 180 EIKRLHQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQLGTPDEIYNRPANTYVATFI 239 +K+L QA G+T V VTH+ A + R+ M GG V + P ++ +P F+ Sbjct: 178 VMKQLAQA-GMTMVIVTHEMGFAKDVSDRVIFMDGGYVVESNVPALLFGQPQEPRTQAFL 236 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 241 Length adjustment: 26 Effective length of query: 329 Effective length of database: 215 Effective search space: 70735 Effective search space used: 70735 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory