Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate 6938097 Sama_2218 maleylacetoacetate isomerase (RefSeq)
Query= reanno::MR1:200836 (216 letters) >FitnessBrowser__SB2B:6938097 Length = 213 Score = 297 bits (760), Expect = 1e-85 Identities = 145/215 (67%), Positives = 167/215 (77%), Gaps = 3/215 (1%) Query: 1 MILYGYWRSSAAYRVRIALNLKGVSAEQLSVHLVRDGGEQHKADYIALNPQELVPTLVVD 60 M LYGYWRSSAAYRVRIALNLKG+ AEQLSVHLV++GGEQH DY+ALNPQ LVP+LV+D Sbjct: 1 MKLYGYWRSSAAYRVRIALNLKGLDAEQLSVHLVKNGGEQHSDDYVALNPQHLVPSLVLD 60 Query: 61 DEQDGDALTQSLAIIEYLDELYPKTPLLPASALERAHVRAMALTIACEIHPLNNLRVLQY 120 D G LTQSLAI+EY ++ PLLP SA +RA VRAM L IACEIHPLNNLRVLQY Sbjct: 61 D---GTVLTQSLAIMEYFEDAGLGLPLLPESATDRATVRAMCLAIACEIHPLNNLRVLQY 117 Query: 121 LTQKLTVNEEAKSAWYHHWVATGFTALETQLVRHSGRYCFGDKVTIADLCLVPQVYNAQR 180 L+ + +++E K+ WYHHW+ GFTA E L RHSG YCFGD T+AD CL+PQVYNA+R Sbjct: 118 LSGDMGLSDEVKNTWYHHWIHEGFTAFEKLLARHSGEYCFGDSPTLADACLIPQVYNARR 177 Query: 181 FNVDLTPYPNIMRVWAECNQLPAFADAAPERQADA 215 FNV L YPNI+R+ A CN AF DA PE Q DA Sbjct: 178 FNVPLDNYPNILRIEAHCNATQAFIDALPENQPDA 212 Lambda K H 0.321 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 213 Length adjustment: 22 Effective length of query: 194 Effective length of database: 191 Effective search space: 37054 Effective search space used: 37054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate 6938097 Sama_2218 (maleylacetoacetate isomerase (RefSeq))
to HMM TIGR01262 (maiA: maleylacetoacetate isomerase (EC 5.2.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01262.hmm # target sequence database: /tmp/gapView.6717.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01262 [M=211] Accession: TIGR01262 Description: maiA: maleylacetoacetate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-89 284.9 0.0 2.1e-89 284.8 0.0 1.0 1 lcl|FitnessBrowser__SB2B:6938097 Sama_2218 maleylacetoacetate iso Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6938097 Sama_2218 maleylacetoacetate isomerase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 284.8 0.0 2.1e-89 2.1e-89 1 210 [. 2 212 .. 2 213 .] 0.99 Alignments for each domain: == domain 1 score: 284.8 bits; conditional E-value: 2.1e-89 TIGR01262 1 klYsyfrSsasyRvRiaLaLkgidyesvpvnLlkd.GeqkkeefkalNPqelvPtLkidegevltqSlAiieyLeet 76 klY+y+rSsa+yRvRiaL+Lkg+d e +v+L+k+ Geq+++++ alNPq+lvP L+ d+g+vltqSlAi+ey e++ lcl|FitnessBrowser__SB2B:6938097 2 KLYGYWRSSAAYRVRIALNLKGLDAEQLSVHLVKNgGEQHSDDYVALNPQHLVPSLVLDDGTVLTQSLAIMEYFEDA 78 69*********************************9***************************************** PP TIGR01262 77 ypepaLlpkdpakrarvralalliacdihPlqNlrvlqlleeklgvdeeekkewlkhwiekGlaalEellkekagaf 153 +Llp+ +++ra vra+ l+iac+ihPl+Nlrvlq+l+ +g ++e k++w++hwi++G++a+E+ll++++g++ lcl|FitnessBrowser__SB2B:6938097 79 GLGLPLLPESATDRATVRAMCLAIACEIHPLNNLRVLQYLSGDMGLSDEVKNTWYHHWIHEGFTAFEKLLARHSGEY 155 ***************************************************************************** PP TIGR01262 154 cvGdevtladvcLvpqvynAerfevdlaqyPtlkrieealaelpafqeahpenqpdt 210 c+Gd++tlad cL+pqvynA+rf+v l++yP + rie+++++++af +a penqpd+ lcl|FitnessBrowser__SB2B:6938097 156 CFGDSPTLADACLIPQVYNARRFNVPLDNYPNILRIEAHCNATQAFIDALPENQPDA 212 ********************************************************7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (213 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.98 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory