Align IGP synthase glutamine amidotransferase subunit; EC 2.4.2.- (characterized)
to candidate 7024672 Shewana3_1850 imidazole glycerol phosphate synthase subunit HisH (RefSeq)
Query= CharProtDB::CH_024511 (196 letters) >FitnessBrowser__ANA3:7024672 Length = 216 Score = 195 bits (495), Expect = 6e-55 Identities = 104/207 (50%), Positives = 140/207 (67%), Gaps = 12/207 (5%) Query: 2 NVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRERE 61 +VVI+DTGCANL+SV+ A R G + V+ D + A ++ LPGVG+A AAM + E+ Sbjct: 9 DVVIIDTGCANLSSVRFAFERLGAKVLVTDDKASIKAAKRVVLPGVGSAGAAMASLTEKA 68 Query: 62 LFDLIKACTQPVLGICLGMQLLGRRSEESNGVDL----LGIIDEDVPKMTDF-----GLP 112 L +LI+ TQPVLG+CLGMQ+L S+E G L LGII ++ ++ GLP Sbjct: 69 LVELIQGLTQPVLGVCLGMQMLTLLSKERGGQALDCQCLGIIPTEIDELDRQILKAEGLP 128 Query: 113 LPHMGWNRVY---PQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQK 169 LPHMGWN++ P + LF G+ G+Y YFVHSY P++ +T+AQC YGE F+AA+ K Sbjct: 129 LPHMGWNQLTFSNPSQVHPLFTGVPAGSYVYFVHSYRAPLSDYTLAQCRYGEDFSAAIGK 188 Query: 170 DNFYGVQFHPERSGAAGAKLLKNFLEM 196 DNF GVQFHPE+S A GA++L NFL+M Sbjct: 189 DNFMGVQFHPEKSAAVGAQILGNFLKM 215 Lambda K H 0.322 0.140 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 216 Length adjustment: 21 Effective length of query: 175 Effective length of database: 195 Effective search space: 34125 Effective search space used: 34125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate 7024672 Shewana3_1850 (imidazole glycerol phosphate synthase subunit HisH (RefSeq))
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
../bin/blast/fastacmd -i /tmp/list.29940.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.29940.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.