Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate 7024902 Shewana3_2076 inner membrane ABC transporter permease protein YjfF (RefSeq)
Query= uniprot:A0A0C4Y7K0 (337 letters) >FitnessBrowser__ANA3:7024902 Length = 320 Score = 155 bits (392), Expect = 1e-42 Identities = 104/299 (34%), Positives = 166/299 (55%), Gaps = 18/299 (6%) Query: 41 LLCIGFSVLTENFAGWQNLSIIAQQASIN---MVLAAGMTFVILTGGIDLSVGSILSISA 97 LL F V T F G+ + ++ N ++ A GMT VI++GGIDLSVG+++++S Sbjct: 15 LLLTMFLVGTFQFDGFASGRVVTNLLRDNAFLLITALGMTLVIISGGIDLSVGAVIALSG 74 Query: 98 VV-AMLVSLMPQLGMLSVPAALLCGLLFGIVNGALVAFMKLPPFIVTLGTLTAVRGLARL 156 VV ++L++ +L+ L G LFG + G ++ KL PFIVTL + RGLA Sbjct: 75 VVTSLLITEYQWHPLLAFVVILPLGTLFGALMGTIIHVYKLQPFIVTLAGMFLARGLATT 134 Query: 157 VGNDS-TIYNP------DIGFAFIGNGEVLGVPWLVIIAFAVVAVSWFVLRRTVLGLQIY 209 + +S I +P ++ A GNG + + I+ F ++AV V+ T G +Y Sbjct: 135 LSEESIAIDHPFYDAVAEMSIALPGNGALDLSSLIFILFFVIIAV---VMHYTRFGTNVY 191 Query: 210 AVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAANGLQLGQ-SYELDAI 268 A+GGN +A L GI + + +YA+S LA L G++ + Y +G LG ELDAI Sbjct: 192 AIGGNQHSAELMGISIAKTTISIYAISSFLATLAGIVFT--FYTFSGYALGAIGVELDAI 249 Query: 269 AAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLG-VSDIWQYIIKGLVIIGAVAL 326 AAV++GGT GG+G ++GT++G +++ V+ + G +S W I+ GL++ + L Sbjct: 250 AAVVIGGTLLTGGSGFVLGTVLGVILMGVIQTYITFDGSLSSWWTKIVIGLLLFFFILL 308 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 320 Length adjustment: 28 Effective length of query: 309 Effective length of database: 292 Effective search space: 90228 Effective search space used: 90228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory