Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate 8500054 DvMF_0817 Biotin carboxylase (RefSeq)
Query= metacyc::MONOMER-13597 (509 letters) >FitnessBrowser__Miya:8500054 Length = 472 Score = 198 bits (504), Expect = 3e-55 Identities = 144/437 (32%), Positives = 226/437 (51%), Gaps = 33/437 (7%) Query: 6 RVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYLNI 65 +VLVANRGEIA R+++A +++G+ VY+ D + H + A E + SY + Sbjct: 7 KVLVANRGEIAIRIVQACRKLGLAFTCVYTAEDAASGHVRIARELGGDKSLCRVSSYHDA 66 Query: 66 EHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAG--ITFIGPSSEVMRKIKDKLDGKR 123 ++ A+ A A+HPGYGF +E+ FA V + + FIGPS V+R++ DK++ KR Sbjct: 67 NELMAVADDAGATAVHPGYGFFAEDYRFARRVSQRDRKLIFIGPSWRVIRELGDKINTKR 126 Query: 124 LANMAGVPTAPGSDGPVTSIDEALKLAEK---------IGYP-IMVKAASGGGGVGITRV 173 LA GVPT PGSD P+ EA K+A+ I P ++VKA++GGGG+GI V Sbjct: 127 LARSLGVPTVPGSDRPIYDEMEAEKVAQSLFEFQEQQGIRKPLVLVKASAGGGGMGIEEV 186 Query: 174 DNQDQLMDVWERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYG-NYVVAWERECT 232 + D V+ R + A + F + IE+ + H+E Q++ D+ G N V R C+ Sbjct: 187 YDIDLFRSVYRRIRNYALRQFKDEGVLIEQRIRDFNHLEVQVVSDRSGRNPVHFGTRNCS 246 Query: 233 IQRRN-QKLIEEAP--SPAL------KMEERESMFEPIIKFGKLINYFTLGTFETAFSDV 283 IQ QK IE AP P+ + + + + + + Y +GT+E + Sbjct: 247 IQSTGLQKRIEIAPGFDPSSIEYGFDAAQVLRDITQHSLAMARKVGYDNVGTWEWIVTRD 306 Query: 284 SRDFYFLELNKRLQVEHPTTELIFR------IDLVKLQIKLAAGEHLPFSQEDLNKRVRG 337 R F +E+N R+QVE+ + I R +DL+ QI++ GE L + QED+ G Sbjct: 307 GRPF-LMEVNTRIQVENGVSATIARVRGQKGVDLIAEQIRIGLGEPLGYGQEDVT--FEG 363 Query: 338 TAIEYRINAEDALNNFTGSSGFVTYYREPTGPGVRVDSGIESGS--YVPPYYDSLVSKLI 395 IEYR+ AED N FT G V + P P + + + + S +P +D ++ I Sbjct: 364 VGIEYRLIAEDPDNRFTPWVGRVDGFGWPERPWLAMHTHVPSDDPYDIPTEFDPNLALAI 423 Query: 396 VYGESREYAIQAGIRAL 412 ++G+ A + G+ L Sbjct: 424 IWGKDLAEARERGVEFL 440 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 24 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 472 Length adjustment: 34 Effective length of query: 475 Effective length of database: 438 Effective search space: 208050 Effective search space used: 208050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory