Align High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale)
to candidate 8500413 DvMF_1163 ABC transporter related (RefSeq)
Query= uniprot:A0A159ZWS6 (255 letters) >FitnessBrowser__Miya:8500413 Length = 255 Score = 236 bits (603), Expect = 3e-67 Identities = 115/250 (46%), Positives = 174/250 (69%) Query: 5 ILKVENLSMRFGGLLAVNGVALTVKEKQVVALIGPNGAGKTTVFNCLTGFYQPTGGTILL 64 +L+++ ++ RFGGL AV+ ++++E++++ALIGPNGAGKTTVFN ++GFYQPT G I+ Sbjct: 3 LLEMKGVTQRFGGLQAVSDFNISLEERKLIALIGPNGAGKTTVFNLVSGFYQPTEGQIIF 62 Query: 65 DGEPIQGLPGHHIARKGVVRTFQNVRLFKDMTAVENLLIAQHRHLNTNFFAGLFKTPAFR 124 DG+P GL H + +G+ RTFQN+RL+ +M+ ++N+ IAQH L + +T F Sbjct: 63 DGKPTAGLRPHQVTARGIARTFQNIRLWHEMSVLDNIRIAQHHRLGYTIWDAFLRTGRFT 122 Query: 125 KSEREAMEYAEYWLDKVNLTEFANRPAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAGL 184 +SE A L+ ++L + A+ L YG QRR+EIAR M RP++L+LDEPAAGL Sbjct: 123 RSEGNIDTIAWEMLEAMDLKDAAHELPRNLPYGLQRRVEIARAMSIRPKLLLLDEPAAGL 182 Query: 185 NPKETEDLKALIGVLREEHNVTVLLIEHDMKLVMSISDHIVVINQGTPLADGTPEQIRDN 244 N + + L LI + +E ++ + +IEH MK+VMS+ + I VI+ G+ +A+GTPE+I+ N Sbjct: 183 NSADVDGLIKLIRWIHDEFDIAIWMIEHQMKVVMSLCEWIKVIDFGSTIAEGTPEEIQSN 242 Query: 245 PEVIKAYLGE 254 P VIKAYLG+ Sbjct: 243 PVVIKAYLGD 252 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 255 Length adjustment: 24 Effective length of query: 231 Effective length of database: 231 Effective search space: 53361 Effective search space used: 53361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory