GapMind for catabolism of small carbon sources

 

Protein 8500595 in Desulfovibrio vulgaris Miyazaki F

Annotation: FitnessBrowser__Miya:8500595

Length: 337 amino acids

Source: Miya in FitnessBrowser

Candidate for 19 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism Ac3H11_2554 lo ABC transporter for L-Histidine, permease component 1 (characterized) 37% 90% 150.2 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-asparagine catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 37% 93% 136.7 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-aspartate catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 37% 93% 136.7 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-glutamate catabolism gltK lo Glutamate/aspartate import permease protein GltK (characterized) 37% 93% 136.7 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-asparagine catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 35% 73% 136.3 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-aspartate catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 35% 73% 136.3 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-glutamate catabolism gltJ lo Amino acid ABC transporter membrane protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized) 35% 85% 134.4 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-asparagine catabolism aatQ lo PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) 34% 85% 132.5 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-aspartate catabolism aatQ lo PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) 34% 85% 132.5 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-arginine catabolism artQ lo Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 32% 92% 127.5 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-histidine catabolism hisQ lo Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 32% 92% 127.5 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-lysine catabolism hisQ lo Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 32% 92% 127.5 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
D-glucosamine (chitosamine) catabolism AO353_21720 lo ABC transporter for D-glucosamine, permease component 2 (characterized) 32% 91% 125.6 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-arginine catabolism artM lo AotP aka AotM aka PA0890, component of Arginine/ornithine (but not lysine) porter (characterized) 31% 94% 124.8 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-glutamate catabolism gluC lo GluC aka CGL1952, component of Glutamate porter (characterized) 32% 95% 109.8 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-histidine catabolism hisM lo Histidine transport system permease protein HisM (characterized) 31% 91% 107.5 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-lysine catabolism hisM lo Histidine transport system permease protein HisM (characterized) 31% 91% 107.5 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
D-alanine catabolism Pf6N2E2_5403 lo ABC transporter for D-Alanine, permease component 2 (characterized) 34% 58% 100.1 Probable glutamine ABC transporter permease protein GlnM 44% 167.5
L-histidine catabolism aapQ lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 1 (characterized) 32% 53% 97.8 Probable glutamine ABC transporter permease protein GlnM 44% 167.5

Sequence Analysis Tools

View 8500595 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTQYRGLDKPKGRGFFLFWKAMFVAAMLALVAFFWVASSSVEYIWRWNRVPQYFWVNEAA
DVRAEAEGDVTIIDRQGNEQRVVVRDASGEEHTHLLPGESKVLVSSGDFTYRGDVLGRYQ
LNRPGILLEGLWITLEVSVLAIIGGIVIGVVTGLCRISINPMLRWGAITYIEIIRGSPLL
VQIFLWYFVVGTLINALLEHVGLGGISPLWYGVMALALFTGAYVAEIVRAGIQSVHRGQM
EAARSLGMNYAQAMRKVILPQAFRRIMPPLAGQFISLIKDSSLLGVIAIRELTKATREVV
TTSLQPFELWIVCAVLYLVLTFTLSLFVQYLERRAIR

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory