Protein 8500849 in Desulfovibrio vulgaris Miyazaki F
Annotation: FitnessBrowser__Miya:8500849
Length: 366 amino acids
Source: Miya in FitnessBrowser
Candidate for 47 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
putrescine catabolism | potA | med | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) | 43% | 85% | 242.3 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
trehalose catabolism | thuK | med | Trehalose import ATP-binding protein SugC; EC 7.5.2.- (characterized) | 41% | 88% | 236.5 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
L-fucose catabolism | SM_b21106 | med | ABC transporter for L-Fucose, ATPase component (characterized) | 40% | 100% | 235.7 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-maltose catabolism | malK_Bb | med | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 43% | 84% | 233 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-sorbitol (glucitol) catabolism | mtlK | med | ABC transporter for D-Sorbitol, ATPase component (characterized) | 41% | 88% | 226.1 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-maltose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 42% | 88% | 225.3 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-maltose catabolism | thuK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 42% | 88% | 225.3 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
sucrose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 42% | 88% | 225.3 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
trehalose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 42% | 88% | 225.3 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
L-arabinose catabolism | xacJ | med | Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) | 41% | 75% | 221.1 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
N-acetyl-D-glucosamine catabolism | SMc02869 | med | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 40% | 91% | 219.2 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-glucosamine (chitosamine) catabolism | SMc02869 | med | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 40% | 91% | 219.2 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
lactose catabolism | lacK | med | LacK, component of Lactose porter (characterized) | 41% | 82% | 217.2 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-glucosamine (chitosamine) catabolism | SM_b21216 | med | ABC transporter for D-Glucosamine, ATPase component (characterized) | 41% | 83% | 214.2 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-cellobiose catabolism | gtsD | med | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 41% | 79% | 213.8 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-galactose catabolism | PfGW456L13_1897 | med | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 41% | 79% | 213.8 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-glucose catabolism | gtsD | med | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 41% | 79% | 213.8 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
lactose catabolism | gtsD | med | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 41% | 79% | 213.8 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-maltose catabolism | gtsD | med | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 41% | 79% | 213.8 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
sucrose catabolism | gtsD | med | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 41% | 79% | 213.8 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
trehalose catabolism | gtsD | med | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 41% | 79% | 213.8 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-maltose catabolism | malK1 | med | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 43% | 79% | 213 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-cellobiose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 40% | 84% | 209.5 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-glucose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 40% | 84% | 209.5 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
lactose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 40% | 84% | 209.5 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-maltose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 40% | 84% | 209.5 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
sucrose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 40% | 84% | 209.5 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
trehalose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 40% | 84% | 209.5 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
trehalose catabolism | treV | med | TreV, component of Trehalose porter (characterized) | 43% | 75% | 206.5 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
L-histidine catabolism | hutV | med | ABC transporter for L-Histidine, ATPase component (characterized) | 40% | 85% | 161 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-maltose catabolism | malK | lo | ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) | 40% | 94% | 228.4 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-mannose catabolism | TT_C0211 | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 37% | 96% | 220.7 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
sucrose catabolism | thuK | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 37% | 96% | 220.7 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-xylose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 37% | 97% | 218.8 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-mannitol catabolism | mtlK | lo | ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) | 37% | 99% | 218 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
xylitol catabolism | HSERO_RS17020 | lo | ABC-type sugar transport system, ATPase component protein (characterized, see rationale) | 38% | 88% | 214.5 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
xylitol catabolism | Dshi_0546 | lo | ABC transporter for Xylitol, ATPase component (characterized) | 37% | 99% | 211.5 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-cellobiose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 92% | 189.9 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-galactose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 92% | 189.9 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-glucose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 92% | 189.9 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
lactose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 92% | 189.9 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-maltose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 92% | 189.9 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
D-mannose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 92% | 189.9 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
sucrose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 92% | 189.9 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
trehalose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 92% | 189.9 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
glycerol catabolism | glpT | lo | ABC transporter for Glycerol, ATPase component 2 (characterized) | 34% | 80% | 163.7 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
glycerol catabolism | glpS | lo | ABC transporter for Glycerol, ATPase component 1 (characterized) | 34% | 96% | 157.5 | CP4-6 prophage; ABC transporter ATP-binding protein AfuC | 42% | 258.8 |
Sequence Analysis Tools
View 8500849 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MADITLAGIGKAYGAHAVLDGLSLTVNHGECFTLLGPSGCGKTVLLRLIAGFETPDAGTI
SIGGEPVSDAVTGDCVPPDARDLGVVFQDYAVWPHMSVADNIGYPLKLAGLPAAERTRQV
LETVEMVNLTGLENRMPSQLSGGQQQRVALARALVGRPSLMLLDEPLCNLDANLREEMRF
EIKELQRTLGITILYVTHDQEIALAISDRLAIMDHAGAIRQVGTPWEIFERPADEFVFRF
MGVANFLPARRRGMAMLAAGGEQPVPWGLPDGDAEHWMAGFRPSDVRLARQGDGLRGTVR
RASFLGAMTDYLIEVDGASFRTQLDTHEALARGLMFAEGEPCVVGFHDLHWFDAATVAAQ
APQGGE
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory