Align 3-isopropylmalate dehydratase (EC 4.2.1.33) (characterized)
to candidate 8501057 DvMF_1793 3-isopropylmalate dehydratase, small subunit (RefSeq)
Query= BRENDA::Q58673 (168 letters) >FitnessBrowser__Miya:8501057 Length = 163 Score = 167 bits (423), Expect = 8e-47 Identities = 81/159 (50%), Positives = 112/159 (70%) Query: 7 GRVWKFGNNVDTDAILPARYLVYTKPEELAQFVMTGADPDFPKKVKPGDIIVGGKNFGCG 66 G K G ++DTDAI+PAR+LV T ++L + M G + + K+VKPGD++V G+NFGCG Sbjct: 5 GTAHKVGEHIDTDAIIPARFLVTTDTQKLGENCMAGLEEGWVKRVKPGDVMVAGRNFGCG 64 Query: 67 SSREHAPLGLKGAGISCVIAESFARIFYRNAINVGLPLIECKGISEKVNEGDELEVNLET 126 SSREHAP+ + GAG+ VIA SFARIFYRNA N+GL L+E +K+ +GD +EV+ Sbjct: 65 SSREHAPIAILGAGMPVVIAHSFARIFYRNAFNMGLLLLEVGDEVDKIADGDTVEVDAAK 124 Query: 127 GEIKNLTTGEVLKGQKLPEFMMEILEAGGLMPYLKKKMA 165 G I N TTG + LP M E+L+ GGL+PY+++K+A Sbjct: 125 GLITNRTTGATITCPPLPASMRELLDKGGLVPYVREKLA 163 Lambda K H 0.317 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 110 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 163 Length adjustment: 18 Effective length of query: 150 Effective length of database: 145 Effective search space: 21750 Effective search space used: 21750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate 8501057 DvMF_1793 (3-isopropylmalate dehydratase, small subunit (RefSeq))
to HMM TIGR02087 (3-isopropylmalate dehydratase, small subunit)
../bin/blast/fastacmd -i /tmp/list.14808.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.14808.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.