Align ornithine aminotransferase (EC 2.6.1.13) (characterized)
to candidate 8501786 DvMF_2502 glutamate-1-semialdehyde aminotransferase (RefSeq)
Query= BRENDA::B1A0U3 (469 letters) >FitnessBrowser__Miya:8501786 Length = 425 Score = 148 bits (373), Expect = 4e-40 Identities = 107/318 (33%), Positives = 157/318 (49%), Gaps = 26/318 (8%) Query: 52 PIVFAHAKGSSVWDPEGNKYIDFLSGYSAVNQGHCHPKILKALHDQADRLTVSSRAFYND 111 P+ AHAKGS + +G ++D++ + + GH HP + A+H DR T S A D Sbjct: 34 PLFVAHAKGSHLTTVDGTSFVDYVQSWGPMLLGHAHPVVASAIHAAVDRGT-SYGAPCED 92 Query: 112 RFPVFAEYLTALFGYDMVLPMNTGAEGVETALKLARKWGYEKKKIPNDEALIVSCCGCFN 171 + + AL G +MV +N+G E +AL+LAR K +V GC++ Sbjct: 93 EVVLAEAVIDALPGVEMVRMVNSGTEATMSALRLARGVTGRNK--------VVKFVGCYH 144 Query: 172 GRTLGVISMSCDNEATRGFGPLMPG--------HLKVDFGDAEAIERIFKEKGDRVAAFI 223 G ++ + AT P PG L + D A+ +F G +AA I Sbjct: 145 GHADAFLASAGSGVATLSI-PGTPGVPEATVRDTLLAPYNDLTAVAELFTLHGKDIAAII 203 Query: 224 LEPIQGEAGVVIPPDGYLKAVRDLCSKYNVLMIADEIQTGLARTGKMLACDWEDVRPDVV 283 +EP+ G G+V+P +G+L+ +RDLC+++ L+I DE+ TG R A D+ PD+ Sbjct: 204 VEPVAGNMGLVLPMNGFLQGLRDLCTEHGALLIFDEVITGF-RVNYGGAQKRFDITPDLT 262 Query: 284 ILGKALGGGILPVSAVLADKDVMLCIKP-GQ--HGSTFGGNPLASAVAIAALEVIKE--- 337 LGK +GGG LPV A D+M I P G+ T GNPLA A IA L +K+ Sbjct: 263 TLGKIIGGG-LPVGAYGGRADLMRRIAPCGEVYQAGTLSGNPLAMAAGIATLAELKKSDY 321 Query: 338 ERLTERSTKLGGELLGLL 355 + L R L EL +L Sbjct: 322 DALEARVAALATELQAIL 339 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 469 Length of database: 425 Length adjustment: 33 Effective length of query: 436 Effective length of database: 392 Effective search space: 170912 Effective search space used: 170912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory