Align Branched-chain amino acid ABC transporter permease LivH; SubName: Full=Branched-chain amino acid transporter permease subunit LivH; SubName: Full=L-leucine ABC transporter membrane protein /L-isoleucine ABC transporter membrane protein /L-valine ABC transporter membrane protein (characterized, see rationale)
to candidate 8502038 DvMF_2751 inner-membrane translocator (RefSeq)
Query= uniprot:A0A0D9B2B6 (307 letters) >FitnessBrowser__Miya:8502038 Length = 301 Score = 262 bits (669), Expect = 8e-75 Identities = 137/301 (45%), Positives = 195/301 (64%), Gaps = 3/301 (0%) Query: 7 FFQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVAFIAIAGLAMMGLD 66 FFQQL NGL VG YALIA+GYTMVYG++ +INFAHG+++ IG+Y+ F + G Sbjct: 4 FFQQLTNGLAVGGIYALIALGYTMVYGVLKLINFAHGDLFTIGAYLGFTLFTAFGLSGFV 63 Query: 67 SVPLLMTAAFIASIVVTSSYGYSIERIAYRPLRGSNRLIPLISAIGMSIFLQNTVLLSQD 126 S P + + + + + G+ +ER+AYRPLR S+RL ++SA+G SIF QN V+L Sbjct: 64 SGPGGVLLVLVMVMGLVALIGFLLERVAYRPLRSSSRLSAVVSALGASIFFQNAVMLIYG 123 Query: 127 SKDKSIPNLIPGNFAIGPGGAHEVLISYMQIVVFVVTLVAMLGLTLFISRSRLGRACRAC 186 +K + PN I ++ + G L+ M I +L ML L F R+R+G A RA Sbjct: 124 AKFQVYPNDIRPSYVLSIMGIDVPLVRIMMIAA---SLGLMLALYWFTQRTRIGAAIRAT 180 Query: 187 AEDIKMANLLGINTNNIIALTFVIGAALAAIAAVLLSMQYGVINPNAGFLVGLKAFTAAV 246 A D A L+GI+ N +I+L F+IG AL +A V++ + YG ++ G++ GLKAFTAA+ Sbjct: 181 AIDQGAAKLMGIDVNRVISLVFMIGPALGGVAGVMVGLYYGQVDFTMGWVYGLKAFTAAI 240 Query: 247 LGGIGSIPGAMLGGLVLGVAEAFGADIFGDQYKDVVAFGLLVLVLLFRPTGILGRPEVEK 306 LGGIG+IPGAM+GGL+LGV EA GA +KD +AF +L+L+L+ RPTG+LG +K Sbjct: 241 LGGIGNIPGAMVGGLLLGVIEALGAAYISIAWKDAIAFLVLILILIIRPTGLLGERVADK 300 Query: 307 V 307 + Sbjct: 301 I 301 Lambda K H 0.327 0.144 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 301 Length adjustment: 27 Effective length of query: 280 Effective length of database: 274 Effective search space: 76720 Effective search space used: 76720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory