Align 3-hydroxyisobutyrate dehydrogenase subunit (EC 1.1.1.31) (characterized)
to candidate 8502217 DvMF_2927 tartronate semialdehyde reductase (RefSeq)
Query= metacyc::MONOMER-11664 (295 letters) >FitnessBrowser__Miya:8502217 Length = 299 Score = 173 bits (439), Expect = 4e-48 Identities = 104/292 (35%), Positives = 148/292 (50%), Gaps = 7/292 (2%) Query: 2 RIAFIGLGNMGAPMARNLIKAGHQLNLFDLNKTVLAELAELGGQISPSPKDAAANSELVI 61 RI FIGLG MGAPM RNL+KAG + + N L +A G + SP AA S++VI Sbjct: 3 RIGFIGLGIMGAPMCRNLLKAGFPVTAYTRNGDKLRAMAAEGAAAAESPAAVAAASDVVI 62 Query: 62 TMLPAAAHVRSVYLNDDGVLAGIRPGTPTVDCSTIDPQTARDVSKAAAAKGVDMGDAPVS 121 TMLP + VR+V L G+ G PG D S+I P +R+++ A K + M DAPVS Sbjct: 63 TMLPNSPEVRAVALGPGGIAEGAAPGCIVADMSSIAPLASREIAAELAKKSIRMLDAPVS 122 Query: 122 GGTGGAAAGTLTFMVGASAELFASLKPVLEQMGRNIVHCGEVGTGQIAKICNNLLLGISM 181 GG A GTL+ MVG + E F + PV + M ++V GEVG G + K+ N +++ ++ Sbjct: 123 GGEPKAIDGTLSVMVGGAQEDFDACLPVFKAMAASVVRVGEVGAGNVTKLANQIVVAGNI 182 Query: 182 IGVSEAMALGNALGIDTKVLAGIINSSTGRCWSSDTYNPWPGIIETAPASRGYTGGFGAE 241 +SEA+ L G D ++ I D P +T GF Sbjct: 183 AAMSEALVLATRAGADPDLVYQAIRGGLAGSTVLDAKAP-------LVMDGRFTPGFRIR 235 Query: 242 LMLKDLGLATEAARQAHQPVILGAVAQQLYQAMSLRGEGGKDFSAIVEGYRK 293 L KD+G E +R+ H P+ L A ++ Q + G G D A++ + K Sbjct: 236 LHAKDMGNVLETSRELHVPLPLAAQLMEVMQGLMADGLGDADHGALIRHWEK 287 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 299 Length adjustment: 26 Effective length of query: 269 Effective length of database: 273 Effective search space: 73437 Effective search space used: 73437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory