Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate 8502447 DvMF_3153 polar amino acid ABC transporter, inner membrane subunit (RefSeq)
Query= SwissProt::P0AER5 (224 letters) >FitnessBrowser__Miya:8502447 Length = 233 Score = 132 bits (331), Expect = 7e-36 Identities = 76/227 (33%), Positives = 133/227 (58%), Gaps = 21/227 (9%) Query: 2 YEFDWSSIVPS--LPYLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAY 59 Y FDW ++ L +++DG+V+T +I+ ++V+ + GT++AVMRLS+ P+ WF+ + Sbjct: 3 YNFDWKLVLSGEYLQWIIDGVVVTCQISALSLVLAMALGTLIAVMRLSAVRPLVWFSAGF 62 Query: 60 VNVFRSIPL-VMVLLWFY---LIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEI 115 FR+ PL V + W++ ++P + L K + + +++ +++ AA+ +E Sbjct: 63 TEFFRNTPLLVQIFFWYFGSDAVLPTAVNQWLY---KQNFEFAAGVISLAVYTAAFIAEE 119 Query: 116 IRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVL 175 IR+GI SI R Q A+ A G+T Q+M+ ++LPQAFR +VP L++Q + LF+++SL + Sbjct: 120 IRSGIFSIPRTQLEASRACGLTFLQAMRYVVLPQAFRIIVPPLISQALNLFKNSSLCMTI 179 Query: 176 SLADFFRTASTIGERDGTQVEMILFAGFVYFVIS----LSASLLVSY 218 + + A Q+E F GF F +S L+ SLLVS+ Sbjct: 180 GVMELTYMA--------RQIESYTFHGFEAFTVSTLIYLTISLLVSF 218 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 233 Length adjustment: 23 Effective length of query: 201 Effective length of database: 210 Effective search space: 42210 Effective search space used: 42210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory