Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate AMB_RS17745 AMB_RS17745 acetolactate synthase small subunit
Query= BRENDA::P00894 (163 letters) >FitnessBrowser__Magneto:AMB_RS17745 Length = 171 Score = 131 bits (329), Expect = 6e-36 Identities = 74/159 (46%), Positives = 107/159 (67%), Gaps = 3/159 (1%) Query: 2 RRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTD-DPTLSRMTIQTVGDEKVLEQI 60 R ++VL++NESG L+RV+GLFS RGYNIESLTVA D LSR+TI T G ++EQI Sbjct: 10 RHTIAVLVDNESGVLARVVGLFSGRGYNIESLTVAEVDAGEKLSRITIVTSGTAMIIEQI 69 Query: 61 EKQLHKLVDVLRVSELG-QGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSL 119 + QL +LV V +V +L +G HV RE+ LVK+ A+G R E R +IFR + ID T Sbjct: 70 KNQLRRLVPVYKVHDLTIEGPHVSRELALVKVAATGDKRVESLRIADIFRARAIDSTNES 129 Query: 120 YTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRG 158 + ++ G + K+DAF+ + + + +V+R+GVV ++RG Sbjct: 130 FVFEVVGATDKVDAFI-KLMEPLGLTDVSRTGVVAIARG 167 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 96 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 171 Length adjustment: 18 Effective length of query: 145 Effective length of database: 153 Effective search space: 22185 Effective search space used: 22185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate AMB_RS17745 AMB_RS17745 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.15743.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.15743.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.