Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate AZOBR_RS05415 AZOBR_RS05415 N-formylglutamate amidohydrolase
Query= reanno::Korea:Ga0059261_3962 (264 letters) >FitnessBrowser__azobra:AZOBR_RS05415 Length = 292 Score = 99.4 bits (246), Expect = 8e-26 Identities = 74/245 (30%), Positives = 112/245 (45%), Gaps = 27/245 (11%) Query: 5 EQGSAPLIVSVPHAGTVIPADIQGL--VSPELARYDADLYVDHLYAFARGLDATIVRTTV 62 ++ + PL+++ PH+G PA+ + P R D +VD ++A A L ++R Sbjct: 20 DEQTKPLVLASPHSGNRYPAEFLAAARLDPRALRKSEDCFVDEIFAGAPTLGIPLIRALF 79 Query: 63 SRTVIDVNRDPSGQTLYPGQFTTGLCPIQTF-----------------DGTPLYEPGALP 105 R +DVNR+ L P F L P +G +Y G L Sbjct: 80 PRAFLDVNRE--AYELDPEMFADPLPPYVNTRSPRVAAGLGTIARVVANGEDIYR-GKLR 136 Query: 106 DAHEIERRRAEWFDPYHTALAIQIERLRAIHPAIVVYDAHSIRSVVPKLFDGELPNFNIG 165 + + RR + + PYH AL +E RA V+ D HS+ S P L D + +I Sbjct: 137 FSEAV-RRVEQCYTPYHNALRRLVEDTRARFGHAVLIDCHSMPS--PGLGDRDNRRSDIV 193 Query: 166 TND--GTSCAPALTQAVEAICDASPYSRVTNGRFKGGWITRHYARPAGGVHSIQMELAMR 223 D G SCAPA+T+ E Y+ N + GG+ TRHY RP G+H +Q+E++ Sbjct: 194 LGDCFGNSCAPAVTETAERFLRGLGYTVSRNAPYAGGYTTRHYGRPRQGIHVLQIEISRD 253 Query: 224 TYLVE 228 Y+ E Sbjct: 254 LYMDE 258 Lambda K H 0.321 0.136 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 292 Length adjustment: 25 Effective length of query: 239 Effective length of database: 267 Effective search space: 63813 Effective search space used: 63813 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory