Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate AZOBR_RS06565 AZOBR_RS06565 acetolactate synthase
Query= BRENDA::P00894 (163 letters) >FitnessBrowser__azobra:AZOBR_RS06565 Length = 168 Score = 125 bits (314), Expect = 3e-34 Identities = 70/159 (44%), Positives = 108/159 (67%), Gaps = 3/159 (1%) Query: 2 RRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPT-LSRMTIQTVGDEKVLEQI 60 + ++VL++NE G L+RVIGLFS RGYNIESLTVA ++ LSR+T+ T G V+EQI Sbjct: 7 KHTIAVLVDNEPGVLARVIGLFSGRGYNIESLTVAEVNNADHLSRITLVTSGTRMVVEQI 66 Query: 61 EKQLHKLVDVLRVSEL-GQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSL 119 + QL +LV V +V +L +G VERE+ LVK+ +G R E R +IF+ +++D T + Sbjct: 67 KAQLDRLVPVHKVHDLTDEGPSVERELALVKVAGTGERRIEALRLADIFKAKVVDATLTS 126 Query: 120 YTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRG 158 + +L GT+ ++D F+ + + +VE +R+GVV +S+G Sbjct: 127 FVFELTGTTAEVDDFVGLMAQLG-LVEASRTGVVAMSKG 164 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 85 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 168 Length adjustment: 18 Effective length of query: 145 Effective length of database: 150 Effective search space: 21750 Effective search space used: 21750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate AZOBR_RS06565 AZOBR_RS06565 (acetolactate synthase)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.9315.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.9315.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.