Align Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 (characterized)
to candidate AZOBR_RS16015 AZOBR_RS16015 3-phosphoglycerate dehydrogenase
Query= SwissProt::Q9UBQ7 (328 letters) >FitnessBrowser__azobra:AZOBR_RS16015 Length = 336 Score = 124 bits (312), Expect = 3e-33 Identities = 82/210 (39%), Positives = 112/210 (53%), Gaps = 4/210 (1%) Query: 76 KVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKN 135 +V+ VG D + + ++ GI PD T+ A+ AVSLLL+ RRL E + Sbjct: 75 RVVVRFGVGYDKVDVAALEAAGIPFCNNPDYGTEEVADHAVSLLLSLQRRLWEHDARAR- 133 Query: 136 GGWTSWKPLWLCGYGLTQS-TVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAE 194 G T+W+ L + + TVG++G+GRIG A+ RLKPFG + Y +QP E A Sbjct: 134 GYSTTWQANTLTPLRRSSAATVGVVGVGRIGTAVVNRLKPFGYRILGYDPQQPAGHEKAV 193 Query: 195 FQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDV-VNQDD 253 EL A+SD + C LTP T GL + DF K+K A+ +N +RG++ D Sbjct: 194 GYRRVRRLDELLAESDIVTFHCPLTPETRGLIDADFLAKLKPGALLVNTARGEMFAGLDP 253 Query: 254 LYQALASGKIAAAGLDVTSPEPLPTNHPLL 283 L AL SG +AA G DV EP P HPLL Sbjct: 254 LEAALRSGHVAAVGTDVLPTEP-PAPHPLL 282 Lambda K H 0.320 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 336 Length adjustment: 28 Effective length of query: 300 Effective length of database: 308 Effective search space: 92400 Effective search space used: 92400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory