Align 3-hydroxybutyryl-CoA dehydrogenase; EC 1.1.1.157 (characterized)
to candidate AZOBR_RS16920 AZOBR_RS16920 3-hydroxybutyryl-CoA dehydrogenase
Query= CharProtDB::CH_091789 (282 letters) >FitnessBrowser__azobra:AZOBR_RS16920 Length = 292 Score = 315 bits (807), Expect = 7e-91 Identities = 158/282 (56%), Positives = 201/282 (71%) Query: 1 MKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFINKNLSKLVKKGKIEEA 60 +KK+ +IGAG MGSGIA A G+EVV+ DI E + + + I+KN+ + V+KGK+ EA Sbjct: 4 IKKIGIIGAGQMGSGIAHVCAQAGYEVVISDISPEILQKSVAAISKNMDRQVQKGKLTEA 63 Query: 61 TKVEILTRISGTVDLNMAADCDLVIEAAVERMDIKKQIFADLDNICKPETILASNTSSLS 120 K + RI+ DL++ D DLV+EAA E +K++IF L KPE ++A+NTSS+S Sbjct: 64 DKTAAIARIATGSDLSVFHDADLVVEAATENEALKREIFKKLVPNLKPEALIATNTSSIS 123 Query: 121 ITEVASATKRPDKVIGMHFFNPAPVMKLVEVIRGIATSQETFDAVKETSIAIGKDPVEVA 180 IT +A++T RP K +GMHF NP PVM+LVE+IRGIAT + TF A+ E + IGK Sbjct: 124 ITRLAASTDRPSKFMGMHFMNPVPVMQLVELIRGIATDEATFSAIAELTANIGKTAAVAE 183 Query: 181 EAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGANHPMGPLELGDFIGLDICLA 240 + P F+VNRIL+PMINEAV L EG+ V+ ID A+ LGANHPMGPLEL DFIGLD CLA Sbjct: 184 DFPAFIVNRILLPMINEAVYTLYEGVGGVQAIDTALMLGANHPMGPLELADFIGLDTCLA 243 Query: 241 IMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDYSK 282 +M VLY DSKYRP LL KYV AGW+GRK G+GFYDYSK Sbjct: 244 VMQVLYEGLADSKYRPCPLLVKYVEAGWVGRKVGRGFYDYSK 285 Lambda K H 0.319 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 292 Length adjustment: 26 Effective length of query: 256 Effective length of database: 266 Effective search space: 68096 Effective search space used: 68096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory