Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate AZOBR_RS18775 AZOBR_RS18775 3-oxoacyl-ACP reductase
Query= SwissProt::Q92RN6 (256 letters) >FitnessBrowser__azobra:AZOBR_RS18775 Length = 259 Score = 145 bits (365), Expect = 1e-39 Identities = 95/259 (36%), Positives = 143/259 (55%), Gaps = 17/259 (6%) Query: 10 DLRDRGVLVTGGGSGIGAALVEAFARQGARVAFVDI----AAESSLALCEKVAAQTGQAP 65 D RD+ VLVTG GIGAA+ +AFA +GA VA + AAE+ A C + + G Sbjct: 2 DFRDKTVLVTGASRGIGAAIAKAFAAEGAAVAVNYLQNAEAAEAVAAACRDLGREAGGDA 61 Query: 66 HFIQADLRNVEAVRAAADEAVAKLGSVRVLVNNAARD---DRQALEAVTEESWDE---SL 119 +QAD+ + EAV + + G + V+VNNA R D + + + W + + Sbjct: 62 WAVQADVTDAEAVNRMVERTAEEFGKIDVVVNNAFRPYAFDPEKRKLFWDTDWADYRGQV 121 Query: 120 SVNLRHLFFMCQAVAPHMQRQGGGSIVNFSSIAFLLNMPEIPA--YSTAKAGIIGLTKSL 177 L + +C+AV P M+R+ GGSIVN ++ L+ P +P Y+TAKA ++G +++L Sbjct: 122 DGALLGTYNVCRAVLPVMRRRPGGSIVNMATD--LVARPTVPYHDYTTAKAALVGFSRNL 179 Query: 178 AGKLGPDNIRVNAILPGMIVTERQRRLWLTEESIARMQERQC-LKRMLVADDLVGPCLFL 236 A +LGP IRVN + PG++ R T+E + Q L+R+ +D+ GP LFL Sbjct: 180 AAELGPLGIRVNCVAPGLVYPTDASR--ATKEDVKDAIVAQTPLRRIATPEDVTGPVLFL 237 Query: 237 ASDSSAAMTAQAMIIDGGV 255 AS S MT Q + +DGG+ Sbjct: 238 ASGWSRFMTGQVLYVDGGL 256 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 259 Length adjustment: 24 Effective length of query: 232 Effective length of database: 235 Effective search space: 54520 Effective search space used: 54520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory